SlideShare a Scribd company logo

Describe the various types of computer-based information systems in .pdf

•
•
K
karymadelaneyrenne19

Describe the various types of computer-based information systems in an organization Solution Major Capabilities of Information Systems: Breadth of Support of IS’s: In this two information systems are supported: Enterprise Resource Planning (ERP) Systems: Provide communication between functional area IS, Transaction Processing Systems support the “real time” monitoring, gathering, storage, and processing of data from the organization’s day to day operations. Support for Organizational Employees:.

Education
1 of 1
Download to read offline
Describe the various types of computer-based information systems in an organization Solution Major Capabilities of Information Systems: Breadth of Support of IS’s: In this two information systems are supported: Enterprise Resource Planning (ERP) Systems: Provide communication between functional area IS, Transaction Processing Systems support the “real time” monitoring, gathering, storage, and processing of data from the organization’s day to day operations. Support for Organizational Employees:

Recommended

Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfPart A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfkarymadelaneyrenne19
 
JAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfJAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfkarymadelaneyrenne19
 
Is this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfIs this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfkarymadelaneyrenne19
 
in the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfin the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfkarymadelaneyrenne19
 
In HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfIn HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfkarymadelaneyrenne19
 
How is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfHow is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfkarymadelaneyrenne19
 
How do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfHow do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfkarymadelaneyrenne19
 
How do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfHow do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfkarymadelaneyrenne19
 

Recommended

Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfPart A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdf
Part A - Lymph Node Structure and FunctionUsing no more than 14 pr.pdfkarymadelaneyrenne19
 
JAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfJAVA.Q4 Create a Time class. This class will represent a point in.pdf
JAVA.Q4 Create a Time class. This class will represent a point in.pdfkarymadelaneyrenne19
 
Is this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfIs this a binomial probability experiment Please give a reason for .pdf
Is this a binomial probability experiment Please give a reason for .pdfkarymadelaneyrenne19
 
in the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfin the case of the Bacillis strain, why would a young culture be use.pdf
in the case of the Bacillis strain, why would a young culture be use.pdfkarymadelaneyrenne19
 
In HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfIn HTTP response headers, what is the syntax of most lines (which ar.pdf
In HTTP response headers, what is the syntax of most lines (which ar.pdfkarymadelaneyrenne19
 
How is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfHow is the mouth of planaria similar to the proboscis of Nemertean.pdf
How is the mouth of planaria similar to the proboscis of Nemertean.pdfkarymadelaneyrenne19
 
How do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfHow do you define a species for asexually reproducing organisms; orga.pdf
How do you define a species for asexually reproducing organisms; orga.pdfkarymadelaneyrenne19
 
How do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfHow do cognitive changes contribute to decision-making during adoles.pdf
How do cognitive changes contribute to decision-making during adoles.pdfkarymadelaneyrenne19
 
Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfkarymadelaneyrenne19
 
Consider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfConsider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfkarymadelaneyrenne19
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfkarymadelaneyrenne19
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfkarymadelaneyrenne19
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfkarymadelaneyrenne19
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfkarymadelaneyrenne19
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfkarymadelaneyrenne19
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdfkarymadelaneyrenne19
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfkarymadelaneyrenne19
 
Why do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfWhy do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfkarymadelaneyrenne19
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfkarymadelaneyrenne19
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfkarymadelaneyrenne19
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfkarymadelaneyrenne19
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfkarymadelaneyrenne19
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfkarymadelaneyrenne19
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfkarymadelaneyrenne19
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfkarymadelaneyrenne19
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfkarymadelaneyrenne19
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfkarymadelaneyrenne19
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfkarymadelaneyrenne19
 
Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Association for Project Management
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfagholdier
 

More Related Content

More from karymadelaneyrenne19

Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfkarymadelaneyrenne19
 
Consider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfConsider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfkarymadelaneyrenne19
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfkarymadelaneyrenne19
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfkarymadelaneyrenne19
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfkarymadelaneyrenne19
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfkarymadelaneyrenne19
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfkarymadelaneyrenne19
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdfkarymadelaneyrenne19
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfkarymadelaneyrenne19
 
Why do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfWhy do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfkarymadelaneyrenne19
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfkarymadelaneyrenne19
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfkarymadelaneyrenne19
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfkarymadelaneyrenne19
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfkarymadelaneyrenne19
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfkarymadelaneyrenne19
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfkarymadelaneyrenne19
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfkarymadelaneyrenne19
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfkarymadelaneyrenne19
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfkarymadelaneyrenne19
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfkarymadelaneyrenne19
 

More from karymadelaneyrenne19 (20)

Day care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdfDay care centers expose children to a wider variety of germs than th.pdf
Day care centers expose children to a wider variety of germs than th.pdf
 
Consider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdfConsider a two-state paramagnet with a very large number N of elemen.pdf
Consider a two-state paramagnet with a very large number N of elemen.pdf
 
An administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdfAn administrator wishes to force remote access users to connect usin.pdf
An administrator wishes to force remote access users to connect usin.pdf
 
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdfBelow is a quote from Bobby Kennedy on what the Gross National Produ.pdf
Below is a quote from Bobby Kennedy on what the Gross National Produ.pdf
 
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdfAbstract Data Types (a) Explain briefly what is meant by the ter.pdf
Abstract Data Types (a) Explain briefly what is meant by the ter.pdf
 
Across the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdfAcross the field of human development, “development” is defined as .pdf
Across the field of human development, “development” is defined as .pdf
 
A linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdfA linked list is a linear data structure consisting of a set of nodes.pdf
A linked list is a linear data structure consisting of a set of nodes.pdf
 
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
12. The white “Spirit” black bear, Ursys anerucabys kermodei, differ.pdf
 
With respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdfWith respect to the study of lawWhat is the purpose of discovery.pdf
With respect to the study of lawWhat is the purpose of discovery.pdf
 
Why do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdfWhy do you need proteins to allow ions to cross the cell membrane an.pdf
Why do you need proteins to allow ions to cross the cell membrane an.pdf
 
When you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdfWhen you digest a sample of your protein with Chymotrypsin you get a.pdf
When you digest a sample of your protein with Chymotrypsin you get a.pdf
 
What type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdfWhat type of rock can be dated with radiometric methodsSolution.pdf
What type of rock can be dated with radiometric methodsSolution.pdf
 
What isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdfWhat isSuperfortressand the Flying Fortress their roles in recen.pdf
What isSuperfortressand the Flying Fortress their roles in recen.pdf
 
Volvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdfVolvox was formerly classified as a complex colony, but now scientist.pdf
Volvox was formerly classified as a complex colony, but now scientist.pdf
 
Using netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdfUsing netbeans javaThe purpose of this exercise is t.pdf
Using netbeans javaThe purpose of this exercise is t.pdf
 
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdfTossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
Tossing dice. Consider the experiment of tossing a pair of dice. Let .pdf
 
This is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdfThis is the last homework problem im having trouble with. Can anyo.pdf
This is the last homework problem im having trouble with. Can anyo.pdf
 
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdfTheodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
Theodore Roosevelts mediation in the Russo-J(APanese War reflected .pdf
 
The problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdfThe problem is called Name Search and it has to be in C# 6. .pdf
The problem is called Name Search and it has to be in C# 6. .pdf
 
The displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdfThe displacement d of an object at time t seconds is given by the equ.pdf
The displacement d of an object at time t seconds is given by the equ.pdf
 

Recently uploaded

Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Association for Project Management
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfagholdier
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfPoh-Sun Goh
 
Introduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsIntroduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsTechSoup
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxVishalSingh1417
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesCeline George
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSCeline George
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsMebane Rash
 
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...christianmathematics
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdfQucHHunhnh
 
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxSKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxAmanpreet Kaur
 
Dyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptxDyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptxcallscotland1987
 
ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701bronxfugly43
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...Poonam Aher Patil
 
How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17Celine George
 
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...pradhanghanshyam7136
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.pptRamjanShidvankar
 
Spellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseSpellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseAnaAcapella
 

Recently uploaded (20)

Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...Making communications land - Are they received and understood as intended? we...
Making communications land - Are they received and understood as intended? we...
 
Holdier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdfHoldier Curriculum Vitae (April 2024).pdf
Holdier Curriculum Vitae (April 2024).pdf
 
Micro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdfMicro-Scholarship, What it is, How can it help me.pdf
Micro-Scholarship, What it is, How can it help me.pdf
 
Introduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The BasicsIntroduction to Nonprofit Accounting: The Basics
Introduction to Nonprofit Accounting: The Basics
 
Unit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptxUnit-V; Pricing (Pharma Marketing Management).pptx
Unit-V; Pricing (Pharma Marketing Management).pptx
 
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin ClassesMixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
Mixin Classes in Odoo 17 How to Extend Models Using Mixin Classes
 
How to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POSHow to Manage Global Discount in Odoo 17 POS
How to Manage Global Discount in Odoo 17 POS
 
On National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan FellowsOn National Teacher Day, meet the 2024-25 Kenan Fellows
On National Teacher Day, meet the 2024-25 Kenan Fellows
 
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
Explore beautiful and ugly buildings. Mathematics helps us create beautiful d...
 
1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf1029 - Danh muc Sach Giao Khoa 10 . pdf
1029 - Danh muc Sach Giao Khoa 10 . pdf
 
Spatium Project Simulation student brief
Spatium Project Simulation student briefSpatium Project Simulation student brief
Spatium Project Simulation student brief
 
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptxSKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
SKILL OF INTRODUCING THE LESSON MICRO SKILLS.pptx
 
Dyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptxDyslexia AI Workshop for Slideshare.pptx
Dyslexia AI Workshop for Slideshare.pptx
 
ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701ComPTIA Overview | Comptia Security+ Book SY0-701
ComPTIA Overview | Comptia Security+ Book SY0-701
 
Asian American Pacific Islander Month DDSD 2024.pptx
Asian American Pacific Islander Month DDSD 2024.pptxAsian American Pacific Islander Month DDSD 2024.pptx
Asian American Pacific Islander Month DDSD 2024.pptx
 
General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...General Principles of Intellectual Property: Concepts of Intellectual Proper...
General Principles of Intellectual Property: Concepts of Intellectual Proper...
 
How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17How to Create and Manage Wizard in Odoo 17
How to Create and Manage Wizard in Odoo 17
 
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
Kodo Millet PPT made by Ghanshyam bairwa college of Agriculture kumher bhara...
 
Application orientated numerical on hev.ppt
Application orientated numerical on hev.pptApplication orientated numerical on hev.ppt
Application orientated numerical on hev.ppt
 
Spellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please PractiseSpellings Wk 3 English CAPS CARES Please Practise
Spellings Wk 3 English CAPS CARES Please Practise
 

Describe the various types of computer-based information systems in .pdf

  • 1. Describe the various types of computer-based information systems in an organization Solution Major Capabilities of Information Systems: Breadth of Support of IS’s: In this two information systems are supported: Enterprise Resource Planning (ERP) Systems: Provide communication between functional area IS, Transaction Processing Systems support the “real time” monitoring, gathering, storage, and processing of data from the organization’s day to day operations. Support for Organizational Employees: