Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

Bab ii rev1

561 views

Published on

  • Be the first to comment

  • Be the first to like this

Bab ii rev1

  1. 1. BAB II TINJAUAN PUSTAKA2.1 StudiPustaka 2.1.1 SistemPendukungKeputusan SistemPendukungKeputusan / Desecion Support System (DSS)secaraumumdidefinisikansebagaisebuahsistem yangmampumemeberikankemampuanpemecahanmasalahmaupunkemampuanpengkomunikasionuntukmasalah semi terstruktur. Padadasarnyapengambilankeputusanadalahsuatupendekatansistematissuatumasalahdenganpengumpulanfakta, penentuan yangmatangdanalternatif yang dihadapi, danpengambilantindakan yangmenerutperhitunganmerupakantindakan yang palingtepat.SistemPendukungKeputusanmerupakansuatusisteminteraktif, yangmembantupengambilankeputusanmelaluipenggunaan data dan model-modelkeputusanuntukmemecahkanmasalah-masalahkeputusan yang bersifat semiterstrukturdantidakterstruktur. (Man & Watson,(dalamZainalArifin)). AdapunpengertianlaindariSistemPendukungKeputusanadalahsistemkomputer yang mengolah data menjadiinformasiuntukmengambilkeputusansemi – tersturktur yang spesifik (Wikipedia Indonesia, 2007). BerdasarkanuraiandiatasdapatdisimpulkanbahwaSistemPendukungKeputusan (SPK) adalahsistem yang
  2. 2. dapatmembantukinerjadalammenyelsaikansuatumasalahsebagaipenunjangpengambilankeputusan yang akan di ambil. 2.1.2 Pengertian PHP PHP adalah salah satu program skrip yang dirancang untukmembangun aplikasi web. Ketika dipanggil dari browser, program yangditulis dengan PHP akan di-diparsing didalam web server oleh interpreterPHPdan diterjemhkan kedalam dokumen html, yang selanjutnya akanditampilkan kembali ke web browser. 2.1.3 Analisis AHP Analytical Hierarchy Process merupakan suatu model pendukungkeputusan yang di kembangkan oleh Thomas L. Saaty. AHP menguraikanmasalah multi faktor atau multi kriteria yang kompleks menjadi suatuhierarchy. Proses pengambilan keputusan pada dasarnya adalah memilih suatualternatif. peralatan utama AHP adalah sebuah fungsional dengan inoututamanya persepsi manusia. keberadaan hierarchy memnungkinkan dipecahnya masalah kompleks atau tidak terstruktur dalam sub - submasalaah, lalu munculnya suatu bentuk hierarki .(Kusrini, (dalam ZainalArifin)). Peralatan utama dari model ini adalah sebuah hirarki fungsionaldengan input utamanya adalah persepsi manusia. Jadi perbedaan yang
  3. 3. mencolok model AHP dengan model lainnya terletak pada jenisinputnya.Terdapat 4 aksioma-aksioma yang terkandung dalam model AHP. 1. Reciprocal Comparison artinya pengambilan keputusan harus dapat memuat perbandingan dan menyatakan preferensinya. Prefesensi tersebut harus memenuhi syarat resiprokal yaitu apabila A lebih disukai daripada B dengan skala x, maka B lebih disukai daripada A dengan skala 1/x 2. Homogenity artinya preferensi seseorang harus dapat dinyatakan dalam skala terbatas ataudengan kata lain elemen- elemennya dapat dibandingkan satu sama lainnya. Kalau aksioma ini tidak dipenuhi maka elemen- elemen yang dibandingkan tersebut tidak homogen dan harus dibentuk cluster (kelompok elemen) yang baru 3. Independence artinya preferensi dinyatakan dengan mengasumsikan bahwa kriteria tidak dipengaruhi oleh alternatif-alternatif yang ada melainkan oleh objektif keseluruhan. Ini menunjukkan bahwa pola ketergantungan dalam AHP adalah searah, maksudnya perbandingan antara elemen- elemen dalam satu tingkat dipengaruhi atau tergantung oleh elemen- elemen pada tingkat diatasnya 4. Expectation artinya untuk tujuan pengambil keputusan. Struktur hirarki diasumsikan lengkap. Apabila asumsi ini tidak dipenuhi maka pengambil keputusan tidak memakai seluruh kriteria atau
  4. 4. objectif yang tersedia atau diperlukan sehingga keputusan yang diambil dianggap tidak lengkap. 2.1.4 Metode Berorientasi Obyek Metode berorientasi obyek (object oriented method) merupakansuatu cara pengembangan perangkat lunak dan sistem informasiberdasarkan abstraksi obyek-obyek yang ada di dunia nyata. Metode ini dipercaya memungkinkan para pengembang sisteminformasi untuk menyederhanakan dan menyingkat waktu yang diperlukanuntuk pengembangan sistem informasi, terutama dalam pemakaian kembalikomponen-komponen perangkat lunak. 2.1.5 Unified Modeling Language Banyaknya alat bantu yang dapat digunakan dalam analisis dandesain berorientasi obyek menyebabkan munculnya ketidakjelasan alatbantu apa yang paling unggul. Para pengguna harus memilih diantarabahasa pemodelan dan alat bantu pemodelan yang beragam. Untukmengatasi masalah tersebut maka Object Management Group (OMG)kemudian mengeluarkan UML, dimana dengan adanya UML ini diharapkandapat mengurangi kekacauan dalam bahasa pemodelan yang selama initerjadi dalam lingkugan industri perangkat lunak (Suhendar, 2002). UML merupakan gabungan dari Booch, OMT, OOSE denganmembuang elemen-elemen yang tidak praktis, ditambah dengan elemen-elemen lain yang lebih efektif dan elemen-elemen baru yang belum ada
  5. 5. pada metode terdahulu, sehingga UML lebih ekspresif dan seragamdaripada metode lainnya (Suhendar, 2002). Menurut Suhendar (2002) untuk membuat suatu model, UMLmemiliki diagram grafis sebagai berikut: a. Diagram use case Diagram use case menjelaskan manfaat sistem jika dilihat menurut pandangan orang yang berada diluar sistem (aktor). Diagram ini menunjukkan fungsionalitas suatu sistem atau kelas dan bagaimana sistem berinteraksi dengan dunia luar. b. Diagram class Diagram class menggambarkan seluruh class yang terlibat dalam sebuah perangkat lunak. Diagram ini menggambarkan seluruh atribut dan operasi suatu class beserta hubungannya dengan class lainnya. c. Diagram aktivitas Diagram aktivitas adalah diagram flowchart yang disempurnakan. Diagram aktivitas menggambarkan operasi pada suatu Obyek atau proses pada sebuah organisasi. Kelebihan diagram aktivitas dibandingkan dengan diagram flowchart adalah adanya dukungan konkurensi (pelaksanaan aktivitas secara bersamaan), pengiriman pesan dan swimlane (pelaku/penanggung jawab aktivitas). d. Diagram interaksi
  6. 6. Diagram interaksi menggambarkan interaksi antar Obyek dalam sebuah urutan waktu. Nama asli diagram interaksi dalam UML adalah sequence diagram, namun diterjemahkan sebagai diagram interaksi agar lebih tepat.e. Diagram kolaborasi Diagram kolaborasi merupakan sebuah cara alternatif dalam menggambarkan interaksi antar obyek. Tipe diagram ini menekankan pada hubungan (relationship) antar obyek, sedangkan sequence diagram lebih menekankan pada urutan kejadian. Dalam satu diagram kolaborasi terdapat beberapa obyek, link, dan message. Diagram kolaborasi digunakan sebagai alat untuk menggambarkan interaksi yang mengungkapkan keputusan mengenai perilaku sistem.f. Diagram keadaan Diagram ini memperlihatkan urutan keadaan sesaat (state) yang dilalui sebuah obyek, kejadian yang menyebabkan transisi dari satu state atau aktivitas kepada yang lainnya, dan aksi yang menyebabkan perubahan satu state atau aktivitas.g. Diagram komponen Diagram komponen menggambarkan alokasi semua kelas dan obyek kedalam komponen-komponen dalam desain fisik sistem software. Diagram ini memperlihatkan pengaturan dan kebergantungan antara komponen-komponen software, seperti soure code, binary code dan komponen tereksekusi.
  7. 7. h. Deployment diagram Diagram deployment menggambarkan bagaimana konfigurasi perangkat keras dimana sistem akan diinstalasikan. Diagram ini memberi simbol untuk segala bentuk perangkat keras, seperti: komputer, printer, router, hub, jaringan, dan sebagainya.Synthesize : menggabungkan beberapa literatur menjadi sebuahide.Analisis dan metode yang digunakan untuk penetian adalah analisisAHP metode berorintasi objek karena dengan menggunakan analisis danmetode ini lebih simpel dan sederhana serta dalam penelitian inimenggunakan bahasa pemrograman php berbasis web. 2.3 Penelitian Terkait Penelitian yang terkait dari penelitian ini adalah penelitian yangsebelumnya di lakukan olehJani Rahardjo, I Nyoman Sutapa, dalampenelitiannya yang berjudul”Aplikasi Fuzzy Analitical Hierarchy ProssesDalam Seleksi Karyawan”, dalam penelitian ini menggunakan AHPmetodenya fuzzy adalahangka -angkaygdigunakanuntukmemecahkanmasalahdalampenyelaksiankaryawan. Didalampenerapan Analytical Hierarchy Process (AHP)untukpengambilankeputusandenganbanyakkriteria yang bersifatsubjektif,seringkaliseorangpengambilkeputusandihadapkanpadasuatupermasalahanyang sulitdalampenentuanbobotsetiapkriteria. UntukmenanganikelemahanAHP inidiperlukansuatumetode yang
  8. 8. lebihmemperhatikankeberadaankriteria-kriteria yangbersifatsubjektiftersebut. Salah satumetodependekatan yangseringdipakaiadalahkonsep fuzzy. Konsep fuzzy yangdipakaidalampengembangan AHP iniadalah model Fuzzy AHPdenganpembobotan non- additive yang dikembangkanolehYudhistira, dkk.,(2000). Untukmemperjelaspenggunaan model Fuzzy AHP,dalammakalahinidibahasmengenaiseleksikaryawan, dimanaalternatif–alternatifkriteria yang adalebihbanyakbersifatsubjektif.Disampingitujugaditampilkanhasilperhitungandengan AHP (Saaty,1990),dengantujuanmembandingkanhasilnyadengan Fuzzy AHP. Penerapan fuzzy AHP padaseleksikaryawanmemberikanhasilyang berbedadengan AHP konvensional,halinidikarenakanpadaperhitungan fuzzy AHP diperlukansuatunilai yangtidakhanyasatutetapinilaioptimisdannilaipesimisdarisuatunilai pairwisecomparison. Nilai CR fuzzy AHP lebihkecildaripada AHP konvensional. Fuzzy AHP mempunyaikelebihanyaitutingkatsubyektifitasdaripengambilankeputusandapatdiakomodasidankekurangandari fuzzy AHPadalahperlunyainformasitambahanyaitunilaioptimistikdannilaipesimistik.

×