SlideShare a Scribd company logo
1 of 64
Download to read offline
Swiss-PdbViewer
Wenwen Wang
E-mail: wenwenwang@gmx.de
Wenwen.Wang@anatomie.med.uni-giessen.de
Dec. 2012
SPDBV
PDB
Tools
Selection
Labeling
Display
Measuring
Mutation
Torsions
Coloring
Protein &
Component
Structural
Alignment
Homology
Modeling
1. Download and Install
• Downloading the PDB files in your own PC
PDB home page
http://www.rcsb.org/pdb/home/home.do
• Downloading Swiss-PdbViewer
http://spdbv.vital-it.ch/download.html
Protein structure database: Protein data bank
(PDB)
• The Protein Data Bank (PDB) is a repository for the 3-D structural data of
large biological molecules, such as proteins and nucleic acids. The data,
typically obtained by X-ray crystallography or NMR spectroscopy
• The PDB is a key resource in areas of structural biology.
http://www.pdb.org/pdb/home/home.do
Get your target protein in PDB
Example :
thymidine kinase (TK)
1
2
Query Parameters
Protein name
Source Organism
Methods
Chemical Components
Structure Entity Hits
29 entries available
PDB ID of this entry TK from virus
with ligand (substrate)
X-ray crystallography
Structure and related data (1KIM)
Related data on each tag
The citation of this entry
Visualization of
biological assembly
Ligand component (1KIM)
Sequence data (1KIM)
Sequence ID of 1KIM in UniProtKB
Thymidine kinase
thymidine + ATP = thymidine 5'-phosphate + ADP
Download protein structure file from PDB
1.Save the file in your PC
2.Open the file by PbdViewer
Download and Install PdbViewer
• Download Swiss-PdbViewer
http://spdbv.vital-it.ch/download.html
• Download user guide
http://spdbv.vital-it.ch/Swiss-PdbViewerManualv3.7.pdf
• Tutorial video (English)
http://www.youtube.com/watch?v=nYT5qwtfNew&feat
ure=related
http://www.youtube.com/watch?v=yFE3CAHNkZg
Web page
Install and Run Swiss-PdbViewer
File Operations
2. Workspace
Layer info
Toolbar
Control Panel
3. Control panel
van der Waals dots spheres
C-white
O-red
N-blue
S-yellow
P-orange
H-cyan
Other-gray
3.1 Selection
3.2 Render in Solid 3D
4. Tools
Center
Enlarge
Translate Rotate
Distance
between
2 atoms
Angle
between
3 atoms
omega, phi
and psi angles
Identify
atoms
Display groups that are
at a certain distance
from a selected atom
Center the molecule
on one atom
Fit a molecule
onto an other
Mutation
Torsion
4.1 Measure distance between 2 atoms
---Open 1CRN
---Select
---Group Kind
---SS bonds
---Show only
---Side chain
---Label
---Measure the
distance between
2 Cα of Cys which
have disulphide
bonds
---Pick 1st atom
---Pick 2nd atom
---Hit “Esc”
4.2 Measure Angle between 3 atoms
---Press button
---pick center
atom
---pick 2nd atom
---pick 3rd atom
---Esc
1
3
2
4.3 Measure of omega, phi and psi angles of the
picked amino-acid
---Press “Ctrl”
key + button
---pick 4 atoms
---measure the
torsion angle
of any specific
bond
---Esc1
2
3
4
4.4 Provenance of an atom
4.5 Mutations
4.5 Mutations
4.5 Mutations
steric hindrances
4.5 Mutations
4.6 Torsions
---Open---1KIM
---select THM1
---only show THM1
---label it
---color it orange
---Zoom in & Center
---render in solid 3D
---select one atom and
display groups at 6A
---Show & Center
---col---white
---THM1 orange
---Tool
---Compute H-Bonds
---Display
---Show H-Bonds
Distance
---only select THM1
---Show Only H-Bonds
from Selection
---Select
---Pick on Screen
---Gln125 & Tyr101
---color them blue
---Torsion
---pick one atom
---pick 2nd atom
5.1 Coloring Chain
1
2
5.1.1 Coloring Chain acting on Ribbon
1-OR
-color
-ribbon
1
2
Chain A
Chain B
Chain C
Chain D
5.1.1 Coloring Chain acting on Ribbon
Chain A
Chain B
Chain C
Chain D
5.1.2 Coloring Chain acting on Backbone
OR
-color
-ribbon
1
2
5.2.1 Color B-factor acting on Ribbon
5.2.1 Color B-factor acting on Ribbon
1-OR
-color
-backbone
1
3 2
5.2.2 Color B-factor acting on Backbone
5.2.2 Color B-factor acting on Backbone
OR
-color
-ribbon
1
2
5.3 Color in Residue Type acting on Ribbon
5.3 Color in Residue Type acting on Ribbon
Type:
Gray-non polar amino acid: Val, Leu, Pro, Ala, Trp, Gly, Met, Phe, Cys, Ile
Yellow-polar amino acid: Ser, Thr, Asn, Try, Gln
Red-negtive charge (acid amino acid): Asp, Glu
Blue-positive charge (basic amino acid): Lys, His, Arg
5.4.1 Color Secondary Structure acting on
Ribbon
5.4.1 Color Secondary Structure acting on
Ribbon
5.4.2 Color Secondary Structure Succession
5.4.2 Color Secondary Structure Succession
6.1 Enzyme-ligand interaction---Merging
---Loading PDB
file of protease
---Color---Chain
---Loading PDB
file of inhibitor
---Merging 2
layers
---Alignment
window---select
protease---
Select---All
---select
inhibitor
---Edit---Create
Merged Layer
from Selection
(by layer)
6.2 Enzyme-ligand interaction---Active site
---display only
groups that are
within 10A of
the center atom
of inhibitor
---Center the
molecule
---label them
---Tools
---Compute H-
Bonds
6.2 Enzyme-ligand interaction---Active site
---select
I121145 in
Control Panel
---Display
---Show Only H-
Bonds from
Selection
1
2
6.2 Enzyme-ligand interaction---Active site
---remove the
other labels,
only label
residues
interact with
inhibitor, and
color them pink
---Display
---Show H-
Bonds Distances
7.1 Structural Alignment-Magic Fit
---Loading sars.pdb
---Loading IBV.pdb
---Color---Layer
---click the reset-
view button
---Wind
---Alignment
---Fit
---Iterative Magic
---aligned residues
are shaded in gray
---show structures
in ribbon
1
2
34
7.2 Structural Alignment-show in Ribbon
5
7.3 Structural Alignment vs Sequence Alignment
8.1 Homology Modeling: register with Swiss-
Model
http://swissmodel.expasy.org/workspace/index.php?func=account_create1
8.2 Swiss-Model Settings
>Murine_HV
SGIVKMVSPTSKVEPCIVSVTYGNMTLNGLWLDDKV
YCPRHVICSSADMTDPDYPNLLCRVTSSDFCVMSGR
MSLTVMSYQMQGCQLVLTVTLQNPNTPKYSFGVVK
PGETFTVLAAYNGRPQGAFHVTLRSSHTIKGSFLCGS
CGSVGYVLTGDSVRFVYMHQLELSTGCHTGTDFSGN
FYGPYRDAQVVQLPVQDYTQTVNVVAWLYAAIFNRC
NWFVQSDSCSLEEFNVWAMTNGFSSIKADLVLDAL
ASMTGVTVEQVLAAIKRLHSGFQGKQILGSCVLEDEL
TPSDVYQQLAGVKLQ
8.3 Loading Raw Sequence
8.4 Load template structure
---loading raw
amino acid
sequence:
Murine_HV.fasta
---loading SARS
protease with
known 3D
structure:
2h2zA.pdb
2h2zA
Murine_HV
8.5 ClustalW Alignment
8.6 Adjusting manually
31
2
4
5
“Ctrl + space bar”
8.7 Model Building
8.8 Template vs Model
2h2zA Murine_HV
Swiss-PdbViewer Introduction-Wenwen Wang

More Related Content

What's hot

Mass Spectrometry: Protein Identification Strategies
Mass Spectrometry: Protein Identification StrategiesMass Spectrometry: Protein Identification Strategies
Mass Spectrometry: Protein Identification StrategiesMichel Dumontier
 
Uni prot presentation
Uni prot presentationUni prot presentation
Uni prot presentationRida Khalid
 
Dynamic programming and pairwise sequence alignment
Dynamic programming and pairwise sequence alignmentDynamic programming and pairwise sequence alignment
Dynamic programming and pairwise sequence alignmentGeethanjaliAnilkumar2
 
Protein folding
Protein foldingProtein folding
Protein foldingsaba naeem
 
Sequencing of protein
Sequencing of proteinSequencing of protein
Sequencing of proteinArunima Sur
 
Protein dna interactions
Protein dna interactionsProtein dna interactions
Protein dna interactionsMandeep Kaur
 
A Beginner’s Guide to the Principles and Applications of FRET
A Beginner’s Guide to the Principles and Applications of FRETA Beginner’s Guide to the Principles and Applications of FRET
A Beginner’s Guide to the Principles and Applications of FRETExpedeon
 
Protein degradation(molecular biology)
Protein degradation(molecular biology)Protein degradation(molecular biology)
Protein degradation(molecular biology)IndrajaDoradla
 
Open Reading Frames
Open Reading FramesOpen Reading Frames
Open Reading FramesOsama Zahid
 
Peptide Mass Fingerprinting
Peptide Mass FingerprintingPeptide Mass Fingerprinting
Peptide Mass FingerprintingRida Khalid
 
Nucleic Acid / Protein structure & Functions
Nucleic Acid / Protein structure & FunctionsNucleic Acid / Protein structure & Functions
Nucleic Acid / Protein structure & FunctionsRGCL
 
Isolation, purification and characterisation of protein
Isolation, purification and characterisation of proteinIsolation, purification and characterisation of protein
Isolation, purification and characterisation of proteinsaumya pandey
 

What's hot (20)

Cromatin Remodeling
Cromatin RemodelingCromatin Remodeling
Cromatin Remodeling
 
Mass Spectrometry: Protein Identification Strategies
Mass Spectrometry: Protein Identification StrategiesMass Spectrometry: Protein Identification Strategies
Mass Spectrometry: Protein Identification Strategies
 
Protein data bank
Protein data bankProtein data bank
Protein data bank
 
Uni prot presentation
Uni prot presentationUni prot presentation
Uni prot presentation
 
Amino acid sequencing
Amino acid sequencingAmino acid sequencing
Amino acid sequencing
 
Gen bank databases
Gen bank databasesGen bank databases
Gen bank databases
 
Protein sequencing
Protein sequencingProtein sequencing
Protein sequencing
 
Clustal W - Multiple Sequence alignment
Clustal W - Multiple Sequence alignment   Clustal W - Multiple Sequence alignment
Clustal W - Multiple Sequence alignment
 
Fasta
FastaFasta
Fasta
 
Dynamic programming and pairwise sequence alignment
Dynamic programming and pairwise sequence alignmentDynamic programming and pairwise sequence alignment
Dynamic programming and pairwise sequence alignment
 
Protein folding
Protein foldingProtein folding
Protein folding
 
Dna sequencing.
Dna sequencing.Dna sequencing.
Dna sequencing.
 
Sequencing of protein
Sequencing of proteinSequencing of protein
Sequencing of protein
 
Protein dna interactions
Protein dna interactionsProtein dna interactions
Protein dna interactions
 
A Beginner’s Guide to the Principles and Applications of FRET
A Beginner’s Guide to the Principles and Applications of FRETA Beginner’s Guide to the Principles and Applications of FRET
A Beginner’s Guide to the Principles and Applications of FRET
 
Protein degradation(molecular biology)
Protein degradation(molecular biology)Protein degradation(molecular biology)
Protein degradation(molecular biology)
 
Open Reading Frames
Open Reading FramesOpen Reading Frames
Open Reading Frames
 
Peptide Mass Fingerprinting
Peptide Mass FingerprintingPeptide Mass Fingerprinting
Peptide Mass Fingerprinting
 
Nucleic Acid / Protein structure & Functions
Nucleic Acid / Protein structure & FunctionsNucleic Acid / Protein structure & Functions
Nucleic Acid / Protein structure & Functions
 
Isolation, purification and characterisation of protein
Isolation, purification and characterisation of proteinIsolation, purification and characterisation of protein
Isolation, purification and characterisation of protein
 

Viewers also liked

Lesson 3 4 Laboratory Pt
Lesson 3 4 Laboratory PtLesson 3 4 Laboratory Pt
Lesson 3 4 Laboratory PtMiami Dade
 
3. bleeding disorders dr. sinhasan- mdzah
3. bleeding disorders   dr. sinhasan- mdzah3. bleeding disorders   dr. sinhasan- mdzah
3. bleeding disorders dr. sinhasan- mdzahkciapm
 
los santos mas sorprendestes de la historia
los santos mas sorprendestes de la historia los santos mas sorprendestes de la historia
los santos mas sorprendestes de la historia kleverycamila
 
Linked in contacts
Linked in contactsLinked in contacts
Linked in contactsPrince Patni
 
Zasqr para centros comerciales 2013
Zasqr para centros comerciales 2013Zasqr para centros comerciales 2013
Zasqr para centros comerciales 2013Marco Cimino
 
CK Science Biocity Advert
CK Science Biocity AdvertCK Science Biocity Advert
CK Science Biocity AdvertCK Group
 
Enmas o & m broucher new
Enmas o & m broucher   newEnmas o & m broucher   new
Enmas o & m broucher newlvsamy
 
El poder como una creacion cultural
El poder como una creacion culturalEl poder como una creacion cultural
El poder como una creacion culturalandru pacheco
 
ICS UserGroup - 2015 - App Throwdown - MarvelClient Roaming
ICS UserGroup - 2015 - App Throwdown - MarvelClient RoamingICS UserGroup - 2015 - App Throwdown - MarvelClient Roaming
ICS UserGroup - 2015 - App Throwdown - MarvelClient RoamingChristoph Adler
 
Fou!!!!!
Fou!!!!!Fou!!!!!
Fou!!!!!jensct
 
Fundamentos de Redes - Conector Modular 8 pc8
Fundamentos de Redes - Conector Modular 8 pc8Fundamentos de Redes - Conector Modular 8 pc8
Fundamentos de Redes - Conector Modular 8 pc8Pattzy Montero García
 
Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...
Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...
Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...Thorne & Derrick International
 

Viewers also liked (20)

Primary databases ncbi
Primary databases ncbiPrimary databases ncbi
Primary databases ncbi
 
Lesson 3 4 Laboratory Pt
Lesson 3 4 Laboratory PtLesson 3 4 Laboratory Pt
Lesson 3 4 Laboratory Pt
 
3. bleeding disorders dr. sinhasan- mdzah
3. bleeding disorders   dr. sinhasan- mdzah3. bleeding disorders   dr. sinhasan- mdzah
3. bleeding disorders dr. sinhasan- mdzah
 
Valencia6
Valencia6Valencia6
Valencia6
 
los santos mas sorprendestes de la historia
los santos mas sorprendestes de la historia los santos mas sorprendestes de la historia
los santos mas sorprendestes de la historia
 
Trabajo práctico nº 2
Trabajo práctico nº 2Trabajo práctico nº 2
Trabajo práctico nº 2
 
dossier_MACA
dossier_MACAdossier_MACA
dossier_MACA
 
El Gran Pepe
El Gran PepeEl Gran Pepe
El Gran Pepe
 
Linked in contacts
Linked in contactsLinked in contacts
Linked in contacts
 
Zasqr para centros comerciales 2013
Zasqr para centros comerciales 2013Zasqr para centros comerciales 2013
Zasqr para centros comerciales 2013
 
Reishi rojo
Reishi rojoReishi rojo
Reishi rojo
 
CK Science Biocity Advert
CK Science Biocity AdvertCK Science Biocity Advert
CK Science Biocity Advert
 
Expo edu mex 2013
Expo edu mex 2013Expo edu mex 2013
Expo edu mex 2013
 
Enmas o & m broucher new
Enmas o & m broucher   newEnmas o & m broucher   new
Enmas o & m broucher new
 
El poder como una creacion cultural
El poder como una creacion culturalEl poder como una creacion cultural
El poder como una creacion cultural
 
ICS UserGroup - 2015 - App Throwdown - MarvelClient Roaming
ICS UserGroup - 2015 - App Throwdown - MarvelClient RoamingICS UserGroup - 2015 - App Throwdown - MarvelClient Roaming
ICS UserGroup - 2015 - App Throwdown - MarvelClient Roaming
 
Fou!!!!!
Fou!!!!!Fou!!!!!
Fou!!!!!
 
Systems & robotic integration
Systems & robotic integrationSystems & robotic integration
Systems & robotic integration
 
Fundamentos de Redes - Conector Modular 8 pc8
Fundamentos de Redes - Conector Modular 8 pc8Fundamentos de Redes - Conector Modular 8 pc8
Fundamentos de Redes - Conector Modular 8 pc8
 
Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...
Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...
Craig and Derricott Isolators & Switch Disconnectors - Isolation Equipment an...
 

Similar to Swiss-PdbViewer Introduction-Wenwen Wang

IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal AssessmentIB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal AssessmentLawrence kok
 
IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...
IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...
IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...Lawrence kok
 
IB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal AssessmentIB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal AssessmentLawrence kok
 
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal AssessmentIB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal AssessmentLawrence kok
 
Practical 9 protein structure and function (3)
Practical 9 protein structure and function  (3)Practical 9 protein structure and function  (3)
Practical 9 protein structure and function (3)Osama Barayan
 
IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...
IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...
IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...Lawrence kok
 
Cn abi7500 setup_20120808e
Cn abi7500 setup_20120808eCn abi7500 setup_20120808e
Cn abi7500 setup_20120808eElsa von Licy
 

Similar to Swiss-PdbViewer Introduction-Wenwen Wang (9)

Auto dock tutorial
Auto dock tutorialAuto dock tutorial
Auto dock tutorial
 
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal AssessmentIB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
 
IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...
IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...
IB Chemistry on ICT, 3D software, Jmol, Pymol, Rasmol and ACD for Internal As...
 
IB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal AssessmentIB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Pymol and Rasmol for Internal Assessment
 
Advanced Computational Drug Design
Advanced Computational Drug DesignAdvanced Computational Drug Design
Advanced Computational Drug Design
 
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal AssessmentIB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
IB Chemistry on ICT, 3D software, Jmol, Rasmol and Pymol for Internal Assessment
 
Practical 9 protein structure and function (3)
Practical 9 protein structure and function  (3)Practical 9 protein structure and function  (3)
Practical 9 protein structure and function (3)
 
IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...
IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...
IB Chemistry on using ICT, 3D software with Jmol, Pymol, Rasmol and ACD for I...
 
Cn abi7500 setup_20120808e
Cn abi7500 setup_20120808eCn abi7500 setup_20120808e
Cn abi7500 setup_20120808e
 

Recently uploaded

Advancing Engineering with AI through the Next Generation of Strategic Projec...
Advancing Engineering with AI through the Next Generation of Strategic Projec...Advancing Engineering with AI through the Next Generation of Strategic Projec...
Advancing Engineering with AI through the Next Generation of Strategic Projec...OnePlan Solutions
 
Unlocking the Future of AI Agents with Large Language Models
Unlocking the Future of AI Agents with Large Language ModelsUnlocking the Future of AI Agents with Large Language Models
Unlocking the Future of AI Agents with Large Language Modelsaagamshah0812
 
Professional Resume Template for Software Developers
Professional Resume Template for Software DevelopersProfessional Resume Template for Software Developers
Professional Resume Template for Software DevelopersVinodh Ram
 
CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online ☂️
CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online  ☂️CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online  ☂️
CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online ☂️anilsa9823
 
(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...
(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...
(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...gurkirankumar98700
 
Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...
Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...
Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...kellynguyen01
 
Diamond Application Development Crafting Solutions with Precision
Diamond Application Development Crafting Solutions with PrecisionDiamond Application Development Crafting Solutions with Precision
Diamond Application Development Crafting Solutions with PrecisionSolGuruz
 
Clustering techniques data mining book ....
Clustering techniques data mining book ....Clustering techniques data mining book ....
Clustering techniques data mining book ....ShaimaaMohamedGalal
 
5 Signs You Need a Fashion PLM Software.pdf
5 Signs You Need a Fashion PLM Software.pdf5 Signs You Need a Fashion PLM Software.pdf
5 Signs You Need a Fashion PLM Software.pdfWave PLM
 
Salesforce Certified Field Service Consultant
Salesforce Certified Field Service ConsultantSalesforce Certified Field Service Consultant
Salesforce Certified Field Service ConsultantAxelRicardoTrocheRiq
 
Active Directory Penetration Testing, cionsystems.com.pdf
Active Directory Penetration Testing, cionsystems.com.pdfActive Directory Penetration Testing, cionsystems.com.pdf
Active Directory Penetration Testing, cionsystems.com.pdfCionsystems
 
Unveiling the Tech Salsa of LAMs with Janus in Real-Time Applications
Unveiling the Tech Salsa of LAMs with Janus in Real-Time ApplicationsUnveiling the Tech Salsa of LAMs with Janus in Real-Time Applications
Unveiling the Tech Salsa of LAMs with Janus in Real-Time ApplicationsAlberto González Trastoy
 
Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...
Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...
Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...harshavardhanraghave
 
Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...
Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...
Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...MyIntelliSource, Inc.
 
Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...
Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...
Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...MyIntelliSource, Inc.
 
TECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service providerTECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service providermohitmore19
 
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...panagenda
 

Recently uploaded (20)

Advancing Engineering with AI through the Next Generation of Strategic Projec...
Advancing Engineering with AI through the Next Generation of Strategic Projec...Advancing Engineering with AI through the Next Generation of Strategic Projec...
Advancing Engineering with AI through the Next Generation of Strategic Projec...
 
Unlocking the Future of AI Agents with Large Language Models
Unlocking the Future of AI Agents with Large Language ModelsUnlocking the Future of AI Agents with Large Language Models
Unlocking the Future of AI Agents with Large Language Models
 
Professional Resume Template for Software Developers
Professional Resume Template for Software DevelopersProfessional Resume Template for Software Developers
Professional Resume Template for Software Developers
 
CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online ☂️
CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online  ☂️CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online  ☂️
CALL ON ➥8923113531 🔝Call Girls Kakori Lucknow best sexual service Online ☂️
 
(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...
(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...
(Genuine) Escort Service Lucknow | Starting ₹,5K To @25k with A/C 🧑🏽‍❤️‍🧑🏻 89...
 
Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...
Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...
Short Story: Unveiling the Reasoning Abilities of Large Language Models by Ke...
 
Diamond Application Development Crafting Solutions with Precision
Diamond Application Development Crafting Solutions with PrecisionDiamond Application Development Crafting Solutions with Precision
Diamond Application Development Crafting Solutions with Precision
 
Clustering techniques data mining book ....
Clustering techniques data mining book ....Clustering techniques data mining book ....
Clustering techniques data mining book ....
 
5 Signs You Need a Fashion PLM Software.pdf
5 Signs You Need a Fashion PLM Software.pdf5 Signs You Need a Fashion PLM Software.pdf
5 Signs You Need a Fashion PLM Software.pdf
 
Salesforce Certified Field Service Consultant
Salesforce Certified Field Service ConsultantSalesforce Certified Field Service Consultant
Salesforce Certified Field Service Consultant
 
Active Directory Penetration Testing, cionsystems.com.pdf
Active Directory Penetration Testing, cionsystems.com.pdfActive Directory Penetration Testing, cionsystems.com.pdf
Active Directory Penetration Testing, cionsystems.com.pdf
 
Microsoft AI Transformation Partner Playbook.pdf
Microsoft AI Transformation Partner Playbook.pdfMicrosoft AI Transformation Partner Playbook.pdf
Microsoft AI Transformation Partner Playbook.pdf
 
Unveiling the Tech Salsa of LAMs with Janus in Real-Time Applications
Unveiling the Tech Salsa of LAMs with Janus in Real-Time ApplicationsUnveiling the Tech Salsa of LAMs with Janus in Real-Time Applications
Unveiling the Tech Salsa of LAMs with Janus in Real-Time Applications
 
Call Girls In Mukherjee Nagar 📱 9999965857 🤩 Delhi 🫦 HOT AND SEXY VVIP 🍎 SE...
Call Girls In Mukherjee Nagar 📱  9999965857  🤩 Delhi 🫦 HOT AND SEXY VVIP 🍎 SE...Call Girls In Mukherjee Nagar 📱  9999965857  🤩 Delhi 🫦 HOT AND SEXY VVIP 🍎 SE...
Call Girls In Mukherjee Nagar 📱 9999965857 🤩 Delhi 🫦 HOT AND SEXY VVIP 🍎 SE...
 
Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...
Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...
Reassessing the Bedrock of Clinical Function Models: An Examination of Large ...
 
CHEAP Call Girls in Pushp Vihar (-DELHI )🔝 9953056974🔝(=)/CALL GIRLS SERVICE
CHEAP Call Girls in Pushp Vihar (-DELHI )🔝 9953056974🔝(=)/CALL GIRLS SERVICECHEAP Call Girls in Pushp Vihar (-DELHI )🔝 9953056974🔝(=)/CALL GIRLS SERVICE
CHEAP Call Girls in Pushp Vihar (-DELHI )🔝 9953056974🔝(=)/CALL GIRLS SERVICE
 
Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...
Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...
Try MyIntelliAccount Cloud Accounting Software As A Service Solution Risk Fre...
 
Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...
Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...
Steps To Getting Up And Running Quickly With MyTimeClock Employee Scheduling ...
 
TECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service providerTECUNIQUE: Success Stories: IT Service provider
TECUNIQUE: Success Stories: IT Service provider
 
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
W01_panagenda_Navigating-the-Future-with-The-Hitchhikers-Guide-to-Notes-and-D...
 

Swiss-PdbViewer Introduction-Wenwen Wang