SlideShare a Scribd company logo
1 of 12
Download to read offline
See discussions, stats, and author profiles for this publication at: https://www.researchgate.net/publication/344296104
Recent Trends in Civil Engineering
Book · January 2021
DOI: 10.1007/978-981-15-8293-6
CITATIONS
0
READS
6,791
4 authors:
Some of the authors of this publication are also working on these related projects:
Hot weather concreting: Early age behaviour and cracking risk of concretes with GGBS View project
Rational design of low-CO2 alkali-activated concretes for eco-efficiency and durability View project
Bibhuti Bhusan Das
National Institute of Technology Karnataka
102 PUBLICATIONS 1,107 CITATIONS
SEE PROFILE
Sreejith V. Nanukuttan
Queen's University Belfast
108 PUBLICATIONS 1,508 CITATIONS
SEE PROFILE
Anil Patnaik
University of Akron
49 PUBLICATIONS 1,002 CITATIONS
SEE PROFILE
Neena Panandikar
Don Bosco college of Engineering Fatorda Goa
8 PUBLICATIONS 27 CITATIONS
SEE PROFILE
All content following this page was uploaded by Bibhuti Bhusan Das on 15 April 2022.
The user has requested enhancement of the downloaded file.
Lecture Notes in Civil Engineering
Bibhuti Bhusan Das
SreejithV. Nanukuttan
Anil K. Patnaik
Neena Shekhar Panandikar Editors
Recent
Trends
in Civil
Engineering
Select Proceedings ofTMSF 2019
Lecture Notes in Civil Engineering
Volume 105
Series Editors
Marco di Prisco, Politecnico di Milano, Milano, Italy
Sheng-Hong Chen, School of Water Resources and Hydropower Engineering,
Wuhan University, Wuhan, China
Ioannis Vayas, Institute of Steel Structures, National Technical University of
Athens, Athens, Greece
Sanjay Kumar Shukla, School of Engineering, Edith Cowan University, Joondalup,
WA, Australia
Anuj Sharma, Iowa State University, Ames, IA, USA
Nagesh Kumar, Department of Civil Engineering, Indian Institute of Science
Bangalore, Bengaluru, Karnataka, India
Chien Ming Wang, School of Civil Engineering, The University of Queensland,
Brisbane, QLD, Australia
Lecture Notes in Civil Engineering (LNCE) publishes the latest developments in
Civil Engineering - quickly, informally and in top quality. Though original research
reported in proceedings and post-proceedings represents the core of LNCE, edited
volumes of exceptionally high quality and interest may also be considered for publi-
cation. Volumes published in LNCE embrace all aspects and subfields of, as well as
new challenges in, Civil Engineering. Topics in the series include:
• Construction and Structural Mechanics
• Building Materials
• Concrete, Steel and Timber Structures
• Geotechnical Engineering
• Earthquake Engineering
• Coastal Engineering
• Ocean and Offshore Engineering; Ships and Floating Structures
• Hydraulics, Hydrology and Water Resources Engineering
• Environmental Engineering and Sustainability
• Structural Health and Monitoring
• Surveying and Geographical Information Systems
• Indoor Environments
• Transportation and Traffic
• Risk Analysis
• Safety and Security
To submit a proposal or request further information, please contact the appropriate
Springer Editor:
– Mr. Pierpaolo Riva at pierpaolo.riva@springer.com (Europe and Americas);
– Ms. Swati Meherishi at swati.meherishi@springer.com (Asia - except China, and
Australia, New Zealand);
– Dr. Mengchu Huang at mengchu.huang@springer.com (China).
All books in the series now indexed by Scopus and EI Compendex database!
More information about this series at http://www.springer.com/series/15087
Bibhuti Bhusan Das · Sreejith V. Nanukuttan ·
Anil K. Patnaik · Neena Shekhar Panandikar
Editors
Recent Trends in Civil
Engineering
Select Proceedings of TMSF 2019
Editors
Bibhuti Bhusan Das
Department of Civil Engineering
National Institute of Technology Karnataka
Mangalore, Karnataka, India
Anil K. Patnaik
Civil Egineering
University of Akron
Akron, OH, USA
Sreejith V. Nanukuttan
Civil Engineering
Queen’s University Belfast
Belfast, UK
Neena Shekhar Panandikar
Civil Engineering
Don Bosco College of Engineering
Fatorda, Goa, India
ISSN 2366-2557 ISSN 2366-2565 (electronic)
Lecture Notes in Civil Engineering
ISBN 978-981-15-8292-9 ISBN 978-981-15-8293-6 (eBook)
https://doi.org/10.1007/978-981-15-8293-6
© Springer Nature Singapore Pte Ltd. 2021
This work is subject to copyright. All rights are reserved by the Publisher, whether the whole or part of
the material is concerned, specifically the rights of translation, reprinting, reuse of illustrations, recitation,
broadcasting, reproduction on microfilms or in any other physical way, and transmission or information
storage and retrieval, electronic adaptation, computer software, or by similar or dissimilar methodology
now known or hereafter developed.
The use of general descriptive names, registered names, trademarks, service marks, etc. in this publication
does not imply, even in the absence of a specific statement, that such names are exempt from the relevant
protective laws and regulations and therefore free for general use.
The publisher, the authors and the editors are safe to assume that the advice and information in this book
are believed to be true and accurate at the date of publication. Neither the publisher nor the authors or
the editors give a warranty, expressed or implied, with respect to the material contained herein or for any
errors or omissions that may have been made. The publisher remains neutral with regard to jurisdictional
claims in published maps and institutional affiliations.
This Springer imprint is published by the registered company Springer Nature Singapore Pte Ltd.
The registered company address is: 152 Beach Road, #21-01/04 Gateway East, Singapore 189721,
Singapore
Preface
One of the oldest and classical professions is Civil Engineering; however, the same is
poised to undergo trending moments in upcoming years, and advancement in research
and technology is the steering force behind the innovativeness which construc-
tion industry is going to witness. Sustainability, energy efficiency, high-rise build-
ings, smart structures, intelligent built environment, 3D printing, augmented reality,
building information modelling, etc. are equivalently gaining prominence. Keeping
all this in mind, this conference aimed to explore innovative applications and recent
trends of research in the areas of Structural and Concrete Engineering, Geotechnical
Engineering, Transportation Engineering, Environmental Engineering and Construc-
tion Technology and Management. “International Conference on Trending Moments
and Steer Forces (TMSF-2019)” was organised during 31 October—1 November
2019 at Don Bosco College of Engineering (DBCE), Goa, in association with
National Institute of Technology Karnataka (NITK), Surathkal. Selected and peer-
reviewed papers from the conference are being published in this book, and the papers
are categorised under five different themes: Recent Trends in Structural Engineering,
Recent Trends in Geotechnical Engineering, Recent Trends in Construction Tech-
nology and Management, Recent Trends in Environmental Engineering and Recent
Trends in Transportation Engineering.
I thank Springer Editorial Management Team, Co-editors, Reviewers, Student
Volunteers, DBCE Management, Faculty and Staff for their full support and coop-
eration at all the stages of this event. Special thanks to Dr. Shivaprasad K. N.,
Assistant Professor, JSSST University, Mysuru and my research scholar Ms. Snehal
Kusumadhar for helping me in the editorial activities starting from the beginning
till the end. I do hope that this book will be beneficial to students, researchers and
practitioners working in the field of Civil Engineering.
Mangalore, India Bibhuti Bhusan Das
v
Contents
Recent Trends in Structural Engineering
Assessment of Pushover Response Parameters Using Response
Surface Methodology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Neena Panandikar and K. S. Babu Narayan
Application of Proper Orthogonal Decomposition in Concrete
Performance Appraisal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
A. Manoj and K. S. Babu Narayan
Effect of Curing Methods on the Artificial Production of Fly Ash
Aggregates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23
K. N. Shivaprasad, B. B. Das, and S. Krishnadas
Influence of Incorporating Phase Change Materials
on Cementitious System—A Review . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33
K. Snehal and Bibhuti Bhusan Das
Review on Characteristics of Sewage Sludge Ash and Its Partial
Replacement as Binder Material in Concrete . . . . . . . . . . . . . . . . . . . . . . . . . 65
Mithesh Kumar, P. Shreelaxmi, and Muralidhar Kamath
Characterization of Rheological and Mechanical Properties
of Self-Compacting Concrete with Indian Standard Gradation
and Particle Packing Gradations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79
Adithya Tantri, Adithya Shenoy, and Gopinatha Nayak
A Review on Properties of Sustainable Concrete Using Iron
and Steel Slag Aggregate as Replacement for Natural Aggregate . . . . . . . 93
Jagadisha, K. Balakrishna Rao, Gopinatha Nayak, and B. Adithya Shenoy
Review of Low to High Strength Alkali-Activated and Geopolymer
Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105
Muralidhar V. Kamath, Shreelaxmi Prashanth, and Mithesh Kumar
vii
viii Contents
Hydrodynamic Performance of Spar-Type Wind Turbine Platform
Combined with Wave Energy Converter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 115
Ajay H. Patil and D. Karmakar
Study of Dynamic Characteristics of Circular Liquid Storage
Tanks Using Acoustic Principles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 125
P. Nimisha, B. R. Jayalekshmi, and Katta Venkataramana
Repairs and Rehabilitation of Concrete Structures: Case Studies . . . . . . 137
Shekhar Panandiker, Neena Panandikar, and Celestan Braganza
Strength and Fire Behaviour of Concrete Reinforced with PET
Fibres . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 145
Shruti K. Chodankar and P. Savoikar
Assessment of Construction and Demolition Waste in Goa
for Re-use in New Construction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 157
Kohen Duarte, Paraj Fernandes, Nadya Baracho, Roshani Majik,
Samantha Dias, and Manisha Dias
A Comprehensive Review of Ultra-Fine Materials
as Supplementary Cementitious Materials in Cement
Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 171
Vinay Mohan Agrawal and Purnanand Savoikar
Optimization of Infrared Thermography for Damage Detection
in Concrete Structures Using Finite Element Modelling . . . . . . . . . . . . . . . 177
Madhuraj Naik, Ganesh Hegde, and Lalat Indu Giri
Evaluation of Pozzolanic Performance of Bagasse Ash and Rice
Husk Ash . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 189
S. Praveenkumar, G. Sankarasubramanian, and S. Sindhu
An Overview of Indian Steel Industry and Its Impact
on Construction Sector . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 197
James Mattom, P. Herrick, and Vinay Mohan Agrawal
Partial Replacement of Fine Aggregates with Coconut Shell Ash
in Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 207
Aditi Lawande, Areeb Ahmed, Laukik Dessai, Rahul Naik,
Tanvi Kavlekar, Gauresh Desai, Starina Dias, and Kaushik Pai Fondekar
Brick Manufacturing Using Laterite Soil . . . . . . . . . . . . . . . . . . . . . . . . . . . . 217
Satyesh A. S. Kakodkar, Atish Lolienkar, Sajal Kamat,
Shwetang Nadkarni, Gaurai Naik Gaunekar, and Vikesh Malik
Contents ix
Recent Trends in Geotechnical Engineering
A Numerical Study on Interference Effects of Closely Spaced Strip
Footings on Cohesionless Soils . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231
S. Anaswara and R. Shivashankar
The Need for Unsaturated Soil Mechanics: A Brief Review . . . . . . . . . . . . 239
K. Ujwala Shenoy, K. S. Babu Narayan, and B. M. Sunil
Seismic Behaviour of Soil Nailed Wall . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 251
Amrita, B. R. Jayalekshmi, and R. Shivashankar
Design and Development of Efficient Under-Drainage System
for Lined Canals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 259
Anuj Sharma and Bibhuti Bhusan Das
A Correlation Equation on the Influence of Length to Diameter
Ratio on the Unconfined Compressive Strength of Lateritic Rocks
in Goa . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 273
Mrudula R. Ingale and Purnanand P. Savoikar
Is Global Warming Hampering the Stability of Substructure? . . . . . . . . . 285
K. S. Varun, T. Hari Lokesh, K. Tejas, and S. Shilpa Shet
Estimation of Ultimate Bearing Capacity of Soil for Shallow
Foundation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 305
Ajay Gaonkar, Shubham Arondekar, Akshay Mungarwadi,
Pritesh Gaude, Vishwesh Gaude, Vedant Haldankar, Swaroopa Sail,
and Akshata Kudchadkar
Recent Trends in Transportation Engineering
Experimental Investigations on RBI Grade 81 Stabilized Lateritic
Soil . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 319
B. A. Chethan, Saswati Das, S. Amulya, and A. U. Ravi Shankar
Effect of Ggbs on Strength of Aluminium Refinery Residue
Stabilized by Alkali Solution . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 331
Nityanand Kudachimath, H. M. Raviraj, and Bibhuti Bhusan Das
Laboratory Investigation of Black Cotton Soil Modified
with Bioenzyme and Aggregates for Pavement Subgrade . . . . . . . . . . . . . . 341
Srinivas F. Chitragar, C. B. Shivayogimath, and Raviraj H. Mulangi
Recent Trends in Environmental Engineering
Removal of Pharmaceutical Drug from Water Using Activated
Kaolinite–TiO2 Nanocomposite . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 355
Vaibhav R. Chate, Soumya Meti, M. S. Veeresh, M. B. Shivaraj,
Utsav Naik, and Raviraj M. Kulkarni
x Contents
Green Synthesis of Bioleached Flyash Iron Nanoparticles
(GBFFeNP) Using Azadirachta Indica Leaves and Its Application
as Fenton’s Catalyst in the Degradation of Dicamba . . . . . . . . . . . . . . . . . . 365
S. Bhaskar, Basavaraju Manu, and M. Y. Sreenivasa
River Water Resource Management and Flood Control Using GIS . . . . . 373
Jyoti Kumari, Kohima Dessai, Zwegal Wynne Cardozo,
Blacinta Pereira, Rhea Fernandes, Annapurna Sakhardande,
and Sanford Mascarenhas
Recent Trends in Construction Technology and Management
Production of Artificial Aggregates Using Industrial By-Products
Admixed with Mine Tailings—A Sustainable Solution . . . . . . . . . . . . . . . . . 383
B. P. Sharath and Bibhuti Bhusan Das
PredictingtheServiceLifeofReinforcedConcretebyIncorporating
the Experimentally Determined Properties of Steel–Concrete
Interface and Corrosion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 399
E. P. Sumukh, Sharan Kumar Goudar, and Bibhuti Bhusan Das
Automation of Curing Using Prefabricated Sensors . . . . . . . . . . . . . . . . . . . 419
Akash Agarwalla and Bibhuti Bhusan Das
Inventory Management for Transmission Line Projects . . . . . . . . . . . . . . . 437
Chandra Kant Singh, Apurva Naik, and Bibhuti Bhusan Das
Resource Buffers in Construction Projects . . . . . . . . . . . . . . . . . . . . . . . . . . . 451
Arun L. Hegde, Aman Jain, and Bibhuti Bhusan Das
Productivity Analysis of Shuttering Works for Sewage Treatment
Plant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 461
Abhilash Pandey, Praveen Kumar Chaudhary, and Bibhuti Bhusan Das
Pre-Engineered Building Design of Gas-Insulated Substation
Housed Under Pressurized Ventilation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 473
N. Roopesh, K. A. Swamy, and Bibhuti Bhusan Das
Developing a Standard Template for Activity Linkage and Resource
Estimation of MEP Works . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 485
Sushant Shekhar, Prince Shukla, and Bibhuti Bhusan Das
Multi-criteria Decision-making Approach for Selecting a Bridge
Superstructure Construction Method . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 497
Prabhath R. Upadhya, Mriganka Shekhar Das, and Bibhuti Bhusan Das
Safety Stock in Inventory Management and Wastage Analysis
at Construction Sites . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 509
Bishal Paul, Santosh Tondihal, and Bibhuti Bushan Das
Contents xi
A Multi-dimensional Study on Impact of Energy Efficiency on Life
Cycle Cost of a Single-Family Residential Building . . . . . . . . . . . . . . . . . . . 519
S. Shifad, Pratikshya Pati, and Bibhuti Bhusan Das
Influence of Particle Size of Bottom Ash on Mechanical Properties
of M30 Grade Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 533
Sharan Kumar Goudar and Bibhuti Bhusan Das
Experimental Studies on Concrete Using the Partial Replacement
of Cement by Glass Powder and Fine Aggregate as Manufactured
Sand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 545
Y. Pierce, Sumit Kumar B. Kanaka, and B. Niteen
Experimental Investigation of Using Eggshell Powder as Partial
Replacement of Cement in Fiber Reinforced Concrete . . . . . . . . . . . . . . . . 557
Evetta Raneyia Cardoso, Neena Panandikar, and Kaushik V. Pai Fondekar
View publication stats

More Related Content

Similar to RecentTrendsinCivilEngineering.pdf

An Investigation on Processing and Properties of Recycle Aggregate Concrete
An Investigation on Processing and Properties of Recycle Aggregate ConcreteAn Investigation on Processing and Properties of Recycle Aggregate Concrete
An Investigation on Processing and Properties of Recycle Aggregate Concrete
Mohammed Alauddin
 
Hindustan_Journal_Vol-6
Hindustan_Journal_Vol-6Hindustan_Journal_Vol-6
Hindustan_Journal_Vol-6
Samuel Jacob
 
Rhushikesh Ghotkar Mechanical Engineer
Rhushikesh Ghotkar Mechanical EngineerRhushikesh Ghotkar Mechanical Engineer
Rhushikesh Ghotkar Mechanical Engineer
Rhushikesh Ghotkar
 
PROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docx
PROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docxPROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docx
PROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docx
SamalaSandeep
 
Metaheuristics and Optimiztion in Civil Engineering
Metaheuristics and Optimiztion in Civil EngineeringMetaheuristics and Optimiztion in Civil Engineering
Metaheuristics and Optimiztion in Civil Engineering
Xin-She Yang
 
Dissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project Management
Dissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project ManagementDissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project Management
Dissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project Management
Gagandeep Singh
 

Similar to RecentTrendsinCivilEngineering.pdf (20)

An Investigation on Processing and Properties of Recycle Aggregate Concrete
An Investigation on Processing and Properties of Recycle Aggregate ConcreteAn Investigation on Processing and Properties of Recycle Aggregate Concrete
An Investigation on Processing and Properties of Recycle Aggregate Concrete
 
David Dieter MS Thesis 2002
David Dieter MS Thesis 2002David Dieter MS Thesis 2002
David Dieter MS Thesis 2002
 
Cv dr.hbn
Cv dr.hbnCv dr.hbn
Cv dr.hbn
 
design engineering 2B report
design engineering 2B reportdesign engineering 2B report
design engineering 2B report
 
nwmaterincivilengin.pdf
nwmaterincivilengin.pdfnwmaterincivilengin.pdf
nwmaterincivilengin.pdf
 
Hindustan_Journal_Vol-6
Hindustan_Journal_Vol-6Hindustan_Journal_Vol-6
Hindustan_Journal_Vol-6
 
Thesis
ThesisThesis
Thesis
 
International Journal of Ceramics and Ceramic Technology vol 2 issue 1
 International Journal of Ceramics and Ceramic Technology vol 2 issue 1 International Journal of Ceramics and Ceramic Technology vol 2 issue 1
International Journal of Ceramics and Ceramic Technology vol 2 issue 1
 
Straw Bale Construction: The Application in Massachusetts
Straw Bale Construction: The Application in MassachusettsStraw Bale Construction: The Application in Massachusetts
Straw Bale Construction: The Application in Massachusetts
 
Rhushikesh Ghotkar Mechanical Engineer
Rhushikesh Ghotkar Mechanical EngineerRhushikesh Ghotkar Mechanical Engineer
Rhushikesh Ghotkar Mechanical Engineer
 
Lab and field eveluation of recycled cold mix
Lab and field eveluation of recycled cold mixLab and field eveluation of recycled cold mix
Lab and field eveluation of recycled cold mix
 
Paper battery
Paper batteryPaper battery
Paper battery
 
PROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docx
PROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docxPROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docx
PROJECT 1-ANALYSIS AND DESIGN OF MULTI STORIED BUILDING PROJECT.docx
 
Metaheuristics and Optimiztion in Civil Engineering
Metaheuristics and Optimiztion in Civil EngineeringMetaheuristics and Optimiztion in Civil Engineering
Metaheuristics and Optimiztion in Civil Engineering
 
metodos numericos.pdf
metodos numericos.pdfmetodos numericos.pdf
metodos numericos.pdf
 
Dissertation - Aqua cities, Demand for a new habitation
Dissertation - Aqua cities, Demand for a new habitationDissertation - Aqua cities, Demand for a new habitation
Dissertation - Aqua cities, Demand for a new habitation
 
Dissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project Management
Dissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project ManagementDissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project Management
Dissertation BE 1180 Gagandeep Singh 10038702 April 15, 2012 Project Management
 
Tubine foundation design
Tubine foundation designTubine foundation design
Tubine foundation design
 
Debiprasad Ghosh Ph D Thesis
Debiprasad Ghosh Ph D ThesisDebiprasad Ghosh Ph D Thesis
Debiprasad Ghosh Ph D Thesis
 
Bl31426430
Bl31426430Bl31426430
Bl31426430
 

More from akhileshakm

More from akhileshakm (11)

dynamic_capabilities_of_a_smart_city.pptx
dynamic_capabilities_of_a_smart_city.pptxdynamic_capabilities_of_a_smart_city.pptx
dynamic_capabilities_of_a_smart_city.pptx
 
FG-SSC_presentation_27032015.pptx
FG-SSC_presentation_27032015.pptxFG-SSC_presentation_27032015.pptx
FG-SSC_presentation_27032015.pptx
 
2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf
2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf
2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf
 
2023-02-01-A novel Road User Safety Field Theory for traffic safety assessmen...
2023-02-01-A novel Road User Safety Field Theory for traffic safety assessmen...2023-02-01-A novel Road User Safety Field Theory for traffic safety assessmen...
2023-02-01-A novel Road User Safety Field Theory for traffic safety assessmen...
 
2023-Exploring single-line walking in immersive virtual reality.pdf
2023-Exploring single-line walking in immersive virtual reality.pdf2023-Exploring single-line walking in immersive virtual reality.pdf
2023-Exploring single-line walking in immersive virtual reality.pdf
 
2023-08-01--Identifying risky driving behavior a field study using instrument...
2023-08-01--Identifying risky driving behavior a field study using instrument...2023-08-01--Identifying risky driving behavior a field study using instrument...
2023-08-01--Identifying risky driving behavior a field study using instrument...
 
2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf
2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf
2022- July Gamified_Mobile_Applications_for_Improving_Driving.pdf
 
2022-Investigating the role of beliefs in influencing the hand-held and hands...
2022-Investigating the role of beliefs in influencing the hand-held and hands...2022-Investigating the role of beliefs in influencing the hand-held and hands...
2022-Investigating the role of beliefs in influencing the hand-held and hands...
 
Harnessing social media data for analyzing public inconvenience in constructi...
Harnessing social media data for analyzing public inconvenience in constructi...Harnessing social media data for analyzing public inconvenience in constructi...
Harnessing social media data for analyzing public inconvenience in constructi...
 
IDirect_Dabur_Q3FY23.pdf
IDirect_Dabur_Q3FY23.pdfIDirect_Dabur_Q3FY23.pdf
IDirect_Dabur_Q3FY23.pdf
 
The swedish traffic conflict technique observer's manual tct manual2018
The swedish traffic conflict technique   observer's manual tct manual2018The swedish traffic conflict technique   observer's manual tct manual2018
The swedish traffic conflict technique observer's manual tct manual2018
 

Recently uploaded

VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...
VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...
VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...
dipikadinghjn ( Why You Choose Us? ) Escorts
 
From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...
From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...
From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...
From Luxury Escort : 9352852248 Make on-demand Arrangements Near yOU
 
VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...
VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...
VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...
dipikadinghjn ( Why You Choose Us? ) Escorts
 
VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...
VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...
VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...
dipikadinghjn ( Why You Choose Us? ) Escorts
 
VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...
VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...
VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...
dipikadinghjn ( Why You Choose Us? ) Escorts
 
Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7
Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7
Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7
9953056974 Low Rate Call Girls In Saket, Delhi NCR
 

Recently uploaded (20)

The Economic History of the U.S. Lecture 25.pdf
The Economic History of the U.S. Lecture 25.pdfThe Economic History of the U.S. Lecture 25.pdf
The Economic History of the U.S. Lecture 25.pdf
 
00_Main ppt_MeetupDORA&CyberSecurity.pptx
00_Main ppt_MeetupDORA&CyberSecurity.pptx00_Main ppt_MeetupDORA&CyberSecurity.pptx
00_Main ppt_MeetupDORA&CyberSecurity.pptx
 
(INDIRA) Call Girl Mumbai Call Now 8250077686 Mumbai Escorts 24x7
(INDIRA) Call Girl Mumbai Call Now 8250077686 Mumbai Escorts 24x7(INDIRA) Call Girl Mumbai Call Now 8250077686 Mumbai Escorts 24x7
(INDIRA) Call Girl Mumbai Call Now 8250077686 Mumbai Escorts 24x7
 
VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...
VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...
VIP Call Girl Service Andheri West ⚡ 9920725232 What It Takes To Be The Best ...
 
Stock Market Brief Deck (Under Pressure).pdf
Stock Market Brief Deck (Under Pressure).pdfStock Market Brief Deck (Under Pressure).pdf
Stock Market Brief Deck (Under Pressure).pdf
 
From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...
From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...
From Luxury Escort Service Kamathipura : 9352852248 Make on-demand Arrangemen...
 
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
Solution Manual for Financial Accounting, 11th Edition by Robert Libby, Patri...
 
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
05_Annelore Lenoir_Docbyte_MeetupDora&Cybersecurity.pptx
 
Vasai-Virar Fantastic Call Girls-9833754194-Call Girls MUmbai
Vasai-Virar Fantastic Call Girls-9833754194-Call Girls MUmbaiVasai-Virar Fantastic Call Girls-9833754194-Call Girls MUmbai
Vasai-Virar Fantastic Call Girls-9833754194-Call Girls MUmbai
 
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
02_Fabio Colombo_Accenture_MeetupDora&Cybersecurity.pptx
 
Gurley shaw Theory of Monetary Economics.
Gurley shaw Theory of Monetary Economics.Gurley shaw Theory of Monetary Economics.
Gurley shaw Theory of Monetary Economics.
 
VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...
VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...
VIP Independent Call Girls in Bandra West 🌹 9920725232 ( Call Me ) Mumbai Esc...
 
Booking open Available Pune Call Girls Shivane 6297143586 Call Hot Indian Gi...
Booking open Available Pune Call Girls Shivane  6297143586 Call Hot Indian Gi...Booking open Available Pune Call Girls Shivane  6297143586 Call Hot Indian Gi...
Booking open Available Pune Call Girls Shivane 6297143586 Call Hot Indian Gi...
 
VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...
VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...
VIP Call Girl in Mumbai 💧 9920725232 ( Call Me ) Get A New Crush Everyday Wit...
 
VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...
VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...
VIP Independent Call Girls in Andheri 🌹 9920725232 ( Call Me ) Mumbai Escorts...
 
Indore Real Estate Market Trends Report.pdf
Indore Real Estate Market Trends Report.pdfIndore Real Estate Market Trends Report.pdf
Indore Real Estate Market Trends Report.pdf
 
Top Rated Pune Call Girls Viman Nagar ⟟ 6297143586 ⟟ Call Me For Genuine Sex...
Top Rated  Pune Call Girls Viman Nagar ⟟ 6297143586 ⟟ Call Me For Genuine Sex...Top Rated  Pune Call Girls Viman Nagar ⟟ 6297143586 ⟟ Call Me For Genuine Sex...
Top Rated Pune Call Girls Viman Nagar ⟟ 6297143586 ⟟ Call Me For Genuine Sex...
 
The Economic History of the U.S. Lecture 26.pdf
The Economic History of the U.S. Lecture 26.pdfThe Economic History of the U.S. Lecture 26.pdf
The Economic History of the U.S. Lecture 26.pdf
 
Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7
Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7
Call Girls in New Ashok Nagar, (delhi) call me [9953056974] escort service 24X7
 
The Economic History of the U.S. Lecture 21.pdf
The Economic History of the U.S. Lecture 21.pdfThe Economic History of the U.S. Lecture 21.pdf
The Economic History of the U.S. Lecture 21.pdf
 

RecentTrendsinCivilEngineering.pdf

  • 1. See discussions, stats, and author profiles for this publication at: https://www.researchgate.net/publication/344296104 Recent Trends in Civil Engineering Book · January 2021 DOI: 10.1007/978-981-15-8293-6 CITATIONS 0 READS 6,791 4 authors: Some of the authors of this publication are also working on these related projects: Hot weather concreting: Early age behaviour and cracking risk of concretes with GGBS View project Rational design of low-CO2 alkali-activated concretes for eco-efficiency and durability View project Bibhuti Bhusan Das National Institute of Technology Karnataka 102 PUBLICATIONS 1,107 CITATIONS SEE PROFILE Sreejith V. Nanukuttan Queen's University Belfast 108 PUBLICATIONS 1,508 CITATIONS SEE PROFILE Anil Patnaik University of Akron 49 PUBLICATIONS 1,002 CITATIONS SEE PROFILE Neena Panandikar Don Bosco college of Engineering Fatorda Goa 8 PUBLICATIONS 27 CITATIONS SEE PROFILE All content following this page was uploaded by Bibhuti Bhusan Das on 15 April 2022. The user has requested enhancement of the downloaded file.
  • 2. Lecture Notes in Civil Engineering Bibhuti Bhusan Das SreejithV. Nanukuttan Anil K. Patnaik Neena Shekhar Panandikar Editors Recent Trends in Civil Engineering Select Proceedings ofTMSF 2019
  • 3. Lecture Notes in Civil Engineering Volume 105 Series Editors Marco di Prisco, Politecnico di Milano, Milano, Italy Sheng-Hong Chen, School of Water Resources and Hydropower Engineering, Wuhan University, Wuhan, China Ioannis Vayas, Institute of Steel Structures, National Technical University of Athens, Athens, Greece Sanjay Kumar Shukla, School of Engineering, Edith Cowan University, Joondalup, WA, Australia Anuj Sharma, Iowa State University, Ames, IA, USA Nagesh Kumar, Department of Civil Engineering, Indian Institute of Science Bangalore, Bengaluru, Karnataka, India Chien Ming Wang, School of Civil Engineering, The University of Queensland, Brisbane, QLD, Australia
  • 4. Lecture Notes in Civil Engineering (LNCE) publishes the latest developments in Civil Engineering - quickly, informally and in top quality. Though original research reported in proceedings and post-proceedings represents the core of LNCE, edited volumes of exceptionally high quality and interest may also be considered for publi- cation. Volumes published in LNCE embrace all aspects and subfields of, as well as new challenges in, Civil Engineering. Topics in the series include: • Construction and Structural Mechanics • Building Materials • Concrete, Steel and Timber Structures • Geotechnical Engineering • Earthquake Engineering • Coastal Engineering • Ocean and Offshore Engineering; Ships and Floating Structures • Hydraulics, Hydrology and Water Resources Engineering • Environmental Engineering and Sustainability • Structural Health and Monitoring • Surveying and Geographical Information Systems • Indoor Environments • Transportation and Traffic • Risk Analysis • Safety and Security To submit a proposal or request further information, please contact the appropriate Springer Editor: – Mr. Pierpaolo Riva at pierpaolo.riva@springer.com (Europe and Americas); – Ms. Swati Meherishi at swati.meherishi@springer.com (Asia - except China, and Australia, New Zealand); – Dr. Mengchu Huang at mengchu.huang@springer.com (China). All books in the series now indexed by Scopus and EI Compendex database! More information about this series at http://www.springer.com/series/15087
  • 5. Bibhuti Bhusan Das · Sreejith V. Nanukuttan · Anil K. Patnaik · Neena Shekhar Panandikar Editors Recent Trends in Civil Engineering Select Proceedings of TMSF 2019
  • 6. Editors Bibhuti Bhusan Das Department of Civil Engineering National Institute of Technology Karnataka Mangalore, Karnataka, India Anil K. Patnaik Civil Egineering University of Akron Akron, OH, USA Sreejith V. Nanukuttan Civil Engineering Queen’s University Belfast Belfast, UK Neena Shekhar Panandikar Civil Engineering Don Bosco College of Engineering Fatorda, Goa, India ISSN 2366-2557 ISSN 2366-2565 (electronic) Lecture Notes in Civil Engineering ISBN 978-981-15-8292-9 ISBN 978-981-15-8293-6 (eBook) https://doi.org/10.1007/978-981-15-8293-6 © Springer Nature Singapore Pte Ltd. 2021 This work is subject to copyright. All rights are reserved by the Publisher, whether the whole or part of the material is concerned, specifically the rights of translation, reprinting, reuse of illustrations, recitation, broadcasting, reproduction on microfilms or in any other physical way, and transmission or information storage and retrieval, electronic adaptation, computer software, or by similar or dissimilar methodology now known or hereafter developed. The use of general descriptive names, registered names, trademarks, service marks, etc. in this publication does not imply, even in the absence of a specific statement, that such names are exempt from the relevant protective laws and regulations and therefore free for general use. The publisher, the authors and the editors are safe to assume that the advice and information in this book are believed to be true and accurate at the date of publication. Neither the publisher nor the authors or the editors give a warranty, expressed or implied, with respect to the material contained herein or for any errors or omissions that may have been made. The publisher remains neutral with regard to jurisdictional claims in published maps and institutional affiliations. This Springer imprint is published by the registered company Springer Nature Singapore Pte Ltd. The registered company address is: 152 Beach Road, #21-01/04 Gateway East, Singapore 189721, Singapore
  • 7. Preface One of the oldest and classical professions is Civil Engineering; however, the same is poised to undergo trending moments in upcoming years, and advancement in research and technology is the steering force behind the innovativeness which construc- tion industry is going to witness. Sustainability, energy efficiency, high-rise build- ings, smart structures, intelligent built environment, 3D printing, augmented reality, building information modelling, etc. are equivalently gaining prominence. Keeping all this in mind, this conference aimed to explore innovative applications and recent trends of research in the areas of Structural and Concrete Engineering, Geotechnical Engineering, Transportation Engineering, Environmental Engineering and Construc- tion Technology and Management. “International Conference on Trending Moments and Steer Forces (TMSF-2019)” was organised during 31 October—1 November 2019 at Don Bosco College of Engineering (DBCE), Goa, in association with National Institute of Technology Karnataka (NITK), Surathkal. Selected and peer- reviewed papers from the conference are being published in this book, and the papers are categorised under five different themes: Recent Trends in Structural Engineering, Recent Trends in Geotechnical Engineering, Recent Trends in Construction Tech- nology and Management, Recent Trends in Environmental Engineering and Recent Trends in Transportation Engineering. I thank Springer Editorial Management Team, Co-editors, Reviewers, Student Volunteers, DBCE Management, Faculty and Staff for their full support and coop- eration at all the stages of this event. Special thanks to Dr. Shivaprasad K. N., Assistant Professor, JSSST University, Mysuru and my research scholar Ms. Snehal Kusumadhar for helping me in the editorial activities starting from the beginning till the end. I do hope that this book will be beneficial to students, researchers and practitioners working in the field of Civil Engineering. Mangalore, India Bibhuti Bhusan Das v
  • 8. Contents Recent Trends in Structural Engineering Assessment of Pushover Response Parameters Using Response Surface Methodology . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3 Neena Panandikar and K. S. Babu Narayan Application of Proper Orthogonal Decomposition in Concrete Performance Appraisal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 A. Manoj and K. S. Babu Narayan Effect of Curing Methods on the Artificial Production of Fly Ash Aggregates . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 23 K. N. Shivaprasad, B. B. Das, and S. Krishnadas Influence of Incorporating Phase Change Materials on Cementitious System—A Review . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33 K. Snehal and Bibhuti Bhusan Das Review on Characteristics of Sewage Sludge Ash and Its Partial Replacement as Binder Material in Concrete . . . . . . . . . . . . . . . . . . . . . . . . . 65 Mithesh Kumar, P. Shreelaxmi, and Muralidhar Kamath Characterization of Rheological and Mechanical Properties of Self-Compacting Concrete with Indian Standard Gradation and Particle Packing Gradations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 79 Adithya Tantri, Adithya Shenoy, and Gopinatha Nayak A Review on Properties of Sustainable Concrete Using Iron and Steel Slag Aggregate as Replacement for Natural Aggregate . . . . . . . 93 Jagadisha, K. Balakrishna Rao, Gopinatha Nayak, and B. Adithya Shenoy Review of Low to High Strength Alkali-Activated and Geopolymer Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105 Muralidhar V. Kamath, Shreelaxmi Prashanth, and Mithesh Kumar vii
  • 9. viii Contents Hydrodynamic Performance of Spar-Type Wind Turbine Platform Combined with Wave Energy Converter . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 115 Ajay H. Patil and D. Karmakar Study of Dynamic Characteristics of Circular Liquid Storage Tanks Using Acoustic Principles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 125 P. Nimisha, B. R. Jayalekshmi, and Katta Venkataramana Repairs and Rehabilitation of Concrete Structures: Case Studies . . . . . . 137 Shekhar Panandiker, Neena Panandikar, and Celestan Braganza Strength and Fire Behaviour of Concrete Reinforced with PET Fibres . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 145 Shruti K. Chodankar and P. Savoikar Assessment of Construction and Demolition Waste in Goa for Re-use in New Construction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 157 Kohen Duarte, Paraj Fernandes, Nadya Baracho, Roshani Majik, Samantha Dias, and Manisha Dias A Comprehensive Review of Ultra-Fine Materials as Supplementary Cementitious Materials in Cement Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 171 Vinay Mohan Agrawal and Purnanand Savoikar Optimization of Infrared Thermography for Damage Detection in Concrete Structures Using Finite Element Modelling . . . . . . . . . . . . . . . 177 Madhuraj Naik, Ganesh Hegde, and Lalat Indu Giri Evaluation of Pozzolanic Performance of Bagasse Ash and Rice Husk Ash . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 189 S. Praveenkumar, G. Sankarasubramanian, and S. Sindhu An Overview of Indian Steel Industry and Its Impact on Construction Sector . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 197 James Mattom, P. Herrick, and Vinay Mohan Agrawal Partial Replacement of Fine Aggregates with Coconut Shell Ash in Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 207 Aditi Lawande, Areeb Ahmed, Laukik Dessai, Rahul Naik, Tanvi Kavlekar, Gauresh Desai, Starina Dias, and Kaushik Pai Fondekar Brick Manufacturing Using Laterite Soil . . . . . . . . . . . . . . . . . . . . . . . . . . . . 217 Satyesh A. S. Kakodkar, Atish Lolienkar, Sajal Kamat, Shwetang Nadkarni, Gaurai Naik Gaunekar, and Vikesh Malik
  • 10. Contents ix Recent Trends in Geotechnical Engineering A Numerical Study on Interference Effects of Closely Spaced Strip Footings on Cohesionless Soils . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 S. Anaswara and R. Shivashankar The Need for Unsaturated Soil Mechanics: A Brief Review . . . . . . . . . . . . 239 K. Ujwala Shenoy, K. S. Babu Narayan, and B. M. Sunil Seismic Behaviour of Soil Nailed Wall . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 251 Amrita, B. R. Jayalekshmi, and R. Shivashankar Design and Development of Efficient Under-Drainage System for Lined Canals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 259 Anuj Sharma and Bibhuti Bhusan Das A Correlation Equation on the Influence of Length to Diameter Ratio on the Unconfined Compressive Strength of Lateritic Rocks in Goa . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 273 Mrudula R. Ingale and Purnanand P. Savoikar Is Global Warming Hampering the Stability of Substructure? . . . . . . . . . 285 K. S. Varun, T. Hari Lokesh, K. Tejas, and S. Shilpa Shet Estimation of Ultimate Bearing Capacity of Soil for Shallow Foundation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 305 Ajay Gaonkar, Shubham Arondekar, Akshay Mungarwadi, Pritesh Gaude, Vishwesh Gaude, Vedant Haldankar, Swaroopa Sail, and Akshata Kudchadkar Recent Trends in Transportation Engineering Experimental Investigations on RBI Grade 81 Stabilized Lateritic Soil . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 319 B. A. Chethan, Saswati Das, S. Amulya, and A. U. Ravi Shankar Effect of Ggbs on Strength of Aluminium Refinery Residue Stabilized by Alkali Solution . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 331 Nityanand Kudachimath, H. M. Raviraj, and Bibhuti Bhusan Das Laboratory Investigation of Black Cotton Soil Modified with Bioenzyme and Aggregates for Pavement Subgrade . . . . . . . . . . . . . . 341 Srinivas F. Chitragar, C. B. Shivayogimath, and Raviraj H. Mulangi Recent Trends in Environmental Engineering Removal of Pharmaceutical Drug from Water Using Activated Kaolinite–TiO2 Nanocomposite . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 355 Vaibhav R. Chate, Soumya Meti, M. S. Veeresh, M. B. Shivaraj, Utsav Naik, and Raviraj M. Kulkarni
  • 11. x Contents Green Synthesis of Bioleached Flyash Iron Nanoparticles (GBFFeNP) Using Azadirachta Indica Leaves and Its Application as Fenton’s Catalyst in the Degradation of Dicamba . . . . . . . . . . . . . . . . . . 365 S. Bhaskar, Basavaraju Manu, and M. Y. Sreenivasa River Water Resource Management and Flood Control Using GIS . . . . . 373 Jyoti Kumari, Kohima Dessai, Zwegal Wynne Cardozo, Blacinta Pereira, Rhea Fernandes, Annapurna Sakhardande, and Sanford Mascarenhas Recent Trends in Construction Technology and Management Production of Artificial Aggregates Using Industrial By-Products Admixed with Mine Tailings—A Sustainable Solution . . . . . . . . . . . . . . . . . 383 B. P. Sharath and Bibhuti Bhusan Das PredictingtheServiceLifeofReinforcedConcretebyIncorporating the Experimentally Determined Properties of Steel–Concrete Interface and Corrosion . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 399 E. P. Sumukh, Sharan Kumar Goudar, and Bibhuti Bhusan Das Automation of Curing Using Prefabricated Sensors . . . . . . . . . . . . . . . . . . . 419 Akash Agarwalla and Bibhuti Bhusan Das Inventory Management for Transmission Line Projects . . . . . . . . . . . . . . . 437 Chandra Kant Singh, Apurva Naik, and Bibhuti Bhusan Das Resource Buffers in Construction Projects . . . . . . . . . . . . . . . . . . . . . . . . . . . 451 Arun L. Hegde, Aman Jain, and Bibhuti Bhusan Das Productivity Analysis of Shuttering Works for Sewage Treatment Plant . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 461 Abhilash Pandey, Praveen Kumar Chaudhary, and Bibhuti Bhusan Das Pre-Engineered Building Design of Gas-Insulated Substation Housed Under Pressurized Ventilation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 473 N. Roopesh, K. A. Swamy, and Bibhuti Bhusan Das Developing a Standard Template for Activity Linkage and Resource Estimation of MEP Works . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 485 Sushant Shekhar, Prince Shukla, and Bibhuti Bhusan Das Multi-criteria Decision-making Approach for Selecting a Bridge Superstructure Construction Method . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 497 Prabhath R. Upadhya, Mriganka Shekhar Das, and Bibhuti Bhusan Das Safety Stock in Inventory Management and Wastage Analysis at Construction Sites . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 509 Bishal Paul, Santosh Tondihal, and Bibhuti Bushan Das
  • 12. Contents xi A Multi-dimensional Study on Impact of Energy Efficiency on Life Cycle Cost of a Single-Family Residential Building . . . . . . . . . . . . . . . . . . . 519 S. Shifad, Pratikshya Pati, and Bibhuti Bhusan Das Influence of Particle Size of Bottom Ash on Mechanical Properties of M30 Grade Concrete . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 533 Sharan Kumar Goudar and Bibhuti Bhusan Das Experimental Studies on Concrete Using the Partial Replacement of Cement by Glass Powder and Fine Aggregate as Manufactured Sand . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 545 Y. Pierce, Sumit Kumar B. Kanaka, and B. Niteen Experimental Investigation of Using Eggshell Powder as Partial Replacement of Cement in Fiber Reinforced Concrete . . . . . . . . . . . . . . . . 557 Evetta Raneyia Cardoso, Neena Panandikar, and Kaushik V. Pai Fondekar View publication stats