This document provides an overview of the global electric vehicle fast-charging system market with a focus on DC fast charging systems for public and private use. It analyzes the market by connector type, charging power output, applications, and regions. The report segments the market by connector type (CHADeMO, CCS, Tesla Supercharger, GB/T), charging power (<100 kW, 100-200 kW, >200 kW), applications (public, private), and regions (North America, South America, Europe). It also discusses industry trends, emerging technologies, policies, business models, and competitive landscape. Detailed market data by volume is presented for products and applications segmented by region and country.
This document provides an economic profile and competitiveness assessment of Puerto Rico. Some key details:
- Population in 2011 was 3.9 million with a GDP of $98.8 billion and GDP per capita of $26,500.
- Puerto Rico ranked 31st out of 144 countries on the Global Competitiveness Index in 2012-2013, with an overall score of 4.7, classified as a transitioning economy.
- The most problematic factors for doing business in Puerto Rico according to business executives were inefficient government bureaucracy, restrictive labor regulations, and access to financing.
This document discusses project portfolio selection for private corporations in Vietnam. It notes that selecting the right projects is critical for corporate strategies but challenging given limited resources. While academics have proposed complex selection frameworks, private corporations in Vietnam have not applied them. The document aims to understand literature on project selection, study current practices in Vietnam, and propose an adaptable framework. A case study of multiple private corporations will investigate how they select projects to ensure growth and development strategy success under Vietnam's booming economy. Recommendations will support investigated corporations and enable framework adaptation by other private firms.
The Global Point-of-Care Imaging Devices Market was valued to be $8.66 billion in 2019 and is anticipated to witness an impressive double-digit growth rate, to reach $19.84 billion by 2030.
This document provides an overview of the interactive gaming industry and compares two major companies within it - Activision-Blizzard Inc. and Electronic Arts Inc. It begins with an industry analysis covering the scope, competitors, value chain and Porter's 5 Forces. Ten major competitors are listed, with Electronic Arts the largest by sales and Activision-Blizzard third largest. Competition is described as strong. The document then analyzes each company's history, business model, finances, products, branding and SWOT. Electronic Arts is found to have higher revenues and market share while Activision-Blizzard has improved and grown. The document recommends Activision-Blizzard as the better investment due to its business model, global presence and growth opportunities in Asia-Pacific.
Competitive lanscape(Companies across the entire supply chain):- Smart lighti...Shmir
BIS Research is a leading market intelligence firm that publishes in-depth reports on various markets. This document contains profiles of 13 component manufacturers and 17 light manufacturers in the smart lighting and control market. It provides details on their product portfolios, financials, key developments, and SWOT analyses. It also includes sections on competitive landscape, market entropy, Porter's five forces analysis, and competitive benchmarking of companies in this market.
This white paper discusses the evolving environment of venture capital investment in biomedical companies. It notes that the landscape has changed, with more corporate venture capital players entering the space who have different timelines and expectations than traditional venture capital firms. The paper aims to develop models of the investment decision making process that can help biomedical entrepreneurs adapt to this changing environment. It will explore both rational and behavioral criteria that influence investment decisions, and develop decision tree and system dynamics models to better understand how strategic advantage and a company's micro and macro environment can impact investment outcomes. Case studies of actual investments will be analyzed to test and refine the models.
Camouflage Coatings Market: Robust Demand for Innovative Coatings and Technol...AmanpreetSingh409
Obtain the Sample Report at: https://bit.ly/3qMUliW
The global camouflage coatings market provides detailed market information for segmentation on the basis of product, application, and region. The purpose of this market analysis is to examine the Camouflage Coatings outlook in terms of factors driving the market, trends, technological developments, and competitive benchmarking, among others.
This document provides an overview of Aid for Trade (AfT), including its origins, objectives, and how development organizations like GIZ implement results-oriented AfT initiatives. It discusses how GIZ uses logical frameworks and indicators to measure AfT results. Key points include:
- AfT aims to address trade-related constraints and help developing countries better integrate into the global trading system.
- GIZ implements AfT across various sectors and uses results frameworks to link activities to outcomes like increased trade and investments, improved infrastructure, and removed barriers.
- GIZ monitors AfT results using indicators on topics such as trade volumes, market access, standards compliance, and policy reforms. Collecting baseline data and conducting evaluations
This document provides an economic profile and competitiveness assessment of Puerto Rico. Some key details:
- Population in 2011 was 3.9 million with a GDP of $98.8 billion and GDP per capita of $26,500.
- Puerto Rico ranked 31st out of 144 countries on the Global Competitiveness Index in 2012-2013, with an overall score of 4.7, classified as a transitioning economy.
- The most problematic factors for doing business in Puerto Rico according to business executives were inefficient government bureaucracy, restrictive labor regulations, and access to financing.
This document discusses project portfolio selection for private corporations in Vietnam. It notes that selecting the right projects is critical for corporate strategies but challenging given limited resources. While academics have proposed complex selection frameworks, private corporations in Vietnam have not applied them. The document aims to understand literature on project selection, study current practices in Vietnam, and propose an adaptable framework. A case study of multiple private corporations will investigate how they select projects to ensure growth and development strategy success under Vietnam's booming economy. Recommendations will support investigated corporations and enable framework adaptation by other private firms.
The Global Point-of-Care Imaging Devices Market was valued to be $8.66 billion in 2019 and is anticipated to witness an impressive double-digit growth rate, to reach $19.84 billion by 2030.
This document provides an overview of the interactive gaming industry and compares two major companies within it - Activision-Blizzard Inc. and Electronic Arts Inc. It begins with an industry analysis covering the scope, competitors, value chain and Porter's 5 Forces. Ten major competitors are listed, with Electronic Arts the largest by sales and Activision-Blizzard third largest. Competition is described as strong. The document then analyzes each company's history, business model, finances, products, branding and SWOT. Electronic Arts is found to have higher revenues and market share while Activision-Blizzard has improved and grown. The document recommends Activision-Blizzard as the better investment due to its business model, global presence and growth opportunities in Asia-Pacific.
Competitive lanscape(Companies across the entire supply chain):- Smart lighti...Shmir
BIS Research is a leading market intelligence firm that publishes in-depth reports on various markets. This document contains profiles of 13 component manufacturers and 17 light manufacturers in the smart lighting and control market. It provides details on their product portfolios, financials, key developments, and SWOT analyses. It also includes sections on competitive landscape, market entropy, Porter's five forces analysis, and competitive benchmarking of companies in this market.
This white paper discusses the evolving environment of venture capital investment in biomedical companies. It notes that the landscape has changed, with more corporate venture capital players entering the space who have different timelines and expectations than traditional venture capital firms. The paper aims to develop models of the investment decision making process that can help biomedical entrepreneurs adapt to this changing environment. It will explore both rational and behavioral criteria that influence investment decisions, and develop decision tree and system dynamics models to better understand how strategic advantage and a company's micro and macro environment can impact investment outcomes. Case studies of actual investments will be analyzed to test and refine the models.
Camouflage Coatings Market: Robust Demand for Innovative Coatings and Technol...AmanpreetSingh409
Obtain the Sample Report at: https://bit.ly/3qMUliW
The global camouflage coatings market provides detailed market information for segmentation on the basis of product, application, and region. The purpose of this market analysis is to examine the Camouflage Coatings outlook in terms of factors driving the market, trends, technological developments, and competitive benchmarking, among others.
This document provides an overview of Aid for Trade (AfT), including its origins, objectives, and how development organizations like GIZ implement results-oriented AfT initiatives. It discusses how GIZ uses logical frameworks and indicators to measure AfT results. Key points include:
- AfT aims to address trade-related constraints and help developing countries better integrate into the global trading system.
- GIZ implements AfT across various sectors and uses results frameworks to link activities to outcomes like increased trade and investments, improved infrastructure, and removed barriers.
- GIZ monitors AfT results using indicators on topics such as trade volumes, market access, standards compliance, and policy reforms. Collecting baseline data and conducting evaluations
This document provides an overview and market analysis of the global mobile health (mHealth) market from 2015 to 2022. It examines the mHealth ecosystem, including devices, services, applications, therapeutics areas, and regional markets. The report methodology uses both primary and secondary data sources to estimate and forecast market size and analyze key trends. It also evaluates factors driving market growth such as increased smartphone and device usage, as well as challenges like security and privacy concerns.
Sample global accumulation chains market report 2021 cognitive market researchCognitive Market Research
Cognitive Market Research provides detailed analysis of global accumulation chains in our recently published report titled, "global accumulation chains 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the global accumulation chains market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting global accumulation chains market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
Отчет из Германии о 4й промышленной революции Sergey Zhdanov
This document provides recommendations for implementing Industrie 4.0, a strategic initiative to secure the future of German manufacturing. It outlines a vision of smart, networked manufacturing where cyber-physical systems monitor physical processes, create a virtual copy of the physical world, and make decentralized decisions. The dual strategy proposed is for Germany to become both a leading supplier of Industrie 4.0 solutions and an early adopter creating a leading domestic market. Key priorities for action include standardization, managing complex systems, workforce training, and ensuring security and privacy in networked systems. The report compares Germany's position internationally and provides examples of potential Industrie 4.0 applications.
This document provides an overview and analysis of the global IT managed services market from 2016-2028. Some key points:
- The market is segmented by service type, enterprise size, end-user, and region. It provides revenue forecasts for each segment from 2021-2028.
- Major service types include data center/network management, desktop management, server management, and IT hardware support. Large enterprises and SMBs utilize these services, with top end-users being BFSI, manufacturing, telecom/IT, and healthcare.
- North America, Europe, Asia Pacific, Latin America, and Middle East/Africa are the regional segments covered, with market size and growth data for each provided.
-
A global and regional analysis of the advanced space composites marketsidbisresearch
Many industrialised and developing countries have focused their efforts on various space programmes and advances in space research.
for more info. visit: https://bisresearch.com/industry-report/advanced-space-composites-market.html
The document is a research project submitted by Mathilde Segouffin to fulfill the requirements of a Bachelor of Marketing with Honours in Business Studies degree from Dublin Business School. It examines the marketing power of companies through social media. The document includes a literature review on key concepts such as social media and how it has changed company behavior and empowered consumers. It also outlines the research objectives, methodology, and analysis of data collected through questionnaires and interviews on topics such as consumer trust, word-of-mouth marketing, and company influence on social media. The conclusions provide recommendations for how companies can best leverage social media.
This document analyzes UK trade performance across different markets and sectors. It finds that while UK goods exports have grown more slowly than France and Germany over the past decade, UK services exports have grown faster than France. The UK has a large share of global services exports but its share of goods exports has declined. The document examines variations in UK trade performance across different sectors and markets, finding the range of performance is striking. For example, the UK has a high share of South Africa's services imports but a low share of Indonesia's. It also analyzes opportunities and challenges for UK exports in specific sectors and key markets like China, India, Brazil and others.
Cognitive Market Research provides detailed analysis of Hair Spray in our recently published report titled, "Hair Spray 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Hair Spray market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Hair Spray market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
#HairSprayReport #HairSprayMarketForecast #HairSprayMarketStatus #HairSprayMarket2021
https://www.cognitivemarketresearch.com/hair-spray-market-report
A market survey issued by Stockholm County exploring the markets ideas and concepts for a new IT solution based on open architecture, in order for the hospitals in Stockholm to enable the future of care.
This document provides an overview and analysis of the global esports market. It covers market segments by product and application, analyzing revenue and growth rate for each segment from 2016 to 2028. It also examines the market share and growth in key geographic regions including North America, Europe, Asia Pacific, Latin America, and Middle East and Africa. Drivers, restraints and opportunities for the global esports market are identified and factors like COVID-19 impact, PESTEL forces, and manufacturing costs are analyzed. The market is then forecasted from 2021 to 2028.
Analysis of Financial Condition and Dividend Pattern of Beximco Pharmaceutica...Pantho Sarker
In this report, we discussed about the financial performance of the Beximco Pharmaceuticals Limited. Firstly, the corporate goal of this firm has been stated. Secondly, the market value and book value of the firm has been showed with calculation. Relative valuation gives us a picture of what the value of Beximco pharmaceuticals should be relative to its peers. Using the P/E and EV/EBITDA we found out Beximco pharmaceuticals to be undervalued.
The capital structure of the company is not at the optimum level. Both peer analysis and quantitative analysis has been used to analyze and identify an optimal capital structure to maximize the value of the firm
Beximco follows a Stable dividend policy as it pays stable dividends regardless of earnings and free cash flows and the managers of the firms are making the best use of the retained earnings as it is generating better ROE and ROC.
In contrast to other studies of competitiveness which often focus on the country and industry level, this is a study of competitiveness in Poland at the firm level. In this analysis, the authors focus primarily on how cooperation with external actors such as investors, creditors, customers, suppliers, local governments affects changes in Polish firms’ competitiveness.
Authored by: Katarzyna Binkiewicz, Jacek Cukrowski, Michal Gorzynski, Malgorzata Jakubiak, Amelia Kalukiewicz, Piotr Wojcik. Richard Woodward
Published in 2005
The document provides an overview and analysis of the global inverter technology refrigerator market. It discusses key drivers, restraints, and opportunities in the market. It analyzes the market size by region, type of refrigerator, application, and distribution channel from 2016 to 2021. It also forecasts revenue growth from 2021 to 2028. The market is segmented by 185-200L, 200-300L, 300-400L, 400-500L, 600-700L, and 700L+ refrigerator types. Applications include residential, commercial, and industrial refrigerators. Distribution channels include specialty retailers, department stores, mass retailers/hypermarkets, discount stores, and online. The document concludes with profiles of major refrigerator manufacturers.
Cognitive Market Research provides detailed analysis of Metallized Rollstock Film in our recently published report titled, "Metallized Rollstock Film 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Metallized Rollstock Film market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Metallized Rollstock Film market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
#MetallizedRollstockFilmReport #MetallizedRollstockFilmMarketForecast #MetallizedRollstockFilmMarketStatus #MetallizedRollstockFilmMarket2021
https://cognitivemarketresearch.com/chemical-%26-materials/metallized-rollstock-film-market-report
Cognitive Market Research provides detailed analysis of Managed Print Services in our recently published report titled, "Managed Print Services 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Managed Print Services market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Managed Print Services market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
#ManagedPrintServicesReport #ManagedPrintServicesMarketForecast #ManagedPrintServicesMarketStatus #ManagedPrintServicesMarket2021
Synthetic biology market global revenue, trends, growth, share, size and fore...Scalar Market Research
Synthetic Biology Market is worth USD 2.64 billion in 2014 and is expected to reach USD 37.21 billion by 2022, growing at a CAGR of 27.7% from 2014 to 2022.
Download Free Sample: https://www.scalarmarketresearch.com/request-sample.php?id=46
Cognitive Market Research provides detailed analysis of Direct Attached Storage DAS System in our recently published report titled, "Direct Attached Storage DAS System 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Direct Attached Storage DAS System market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Direct Attached Storage DAS System market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc. #DirectAttachedStorageDASSystemReport #DirectAttachedStorageDASSystemMarketForecast #DirectAttachedStorageDASSystemMarketStatus #DirectAttachedStorageDASSystemMarket2021
https://www.cognitivemarketresearch.com/direct-attached-storage-%28das%29-system-market-report
Cognitive Market Research provides detailed analysis of Cap Market in our recently published report titled, "Cap Market 2020" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Cap market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Cap market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
As per BIS Research analysis, the population sequencing market is projected to reach $64,047.6 million by 2030 from $21,730.4 million in 2020, at a CAGR of 11.41% during the forecast period, 2020-2030.
Advanced Missile Defense System Market Professional Survey And In-depth AnalysisBIS Research Inc.
The growth in the global advanced missile defense system market is expected to be driven by increasing defense budgets of countries across the globe.
Advanced missile defense system refers to a system that provides any defense against any missile type (conventional or nuclear) by any country. The mechanism that can detect and then destroy a missile before it can cause any harm is called a missile defense system (MDS).
The competitive landscape of the advanced missile defense system material market consists of several organic and inorganic strategies followed by the key players to increase their market share. The strategies include product innovations, contracts, partnerships, acquisitions, and business expansions, among others.
Request for the Sample of the Report: https://bisresearch.com/requestsample?id=1349&type=download
BIS Research - Variable Rate Technology Market | Trends and Forecast AnalysisBIS Research Inc.
The global variable rate technology market is highly consolidated, with a small number of dominant established players and a smaller number of rising start-ups.
Download the Sample Report of Variable Rate Technology Market at: https://bit.ly/3e3NP58
This document provides an overview and market analysis of the global mobile health (mHealth) market from 2015 to 2022. It examines the mHealth ecosystem, including devices, services, applications, therapeutics areas, and regional markets. The report methodology uses both primary and secondary data sources to estimate and forecast market size and analyze key trends. It also evaluates factors driving market growth such as increased smartphone and device usage, as well as challenges like security and privacy concerns.
Sample global accumulation chains market report 2021 cognitive market researchCognitive Market Research
Cognitive Market Research provides detailed analysis of global accumulation chains in our recently published report titled, "global accumulation chains 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the global accumulation chains market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting global accumulation chains market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
Отчет из Германии о 4й промышленной революции Sergey Zhdanov
This document provides recommendations for implementing Industrie 4.0, a strategic initiative to secure the future of German manufacturing. It outlines a vision of smart, networked manufacturing where cyber-physical systems monitor physical processes, create a virtual copy of the physical world, and make decentralized decisions. The dual strategy proposed is for Germany to become both a leading supplier of Industrie 4.0 solutions and an early adopter creating a leading domestic market. Key priorities for action include standardization, managing complex systems, workforce training, and ensuring security and privacy in networked systems. The report compares Germany's position internationally and provides examples of potential Industrie 4.0 applications.
This document provides an overview and analysis of the global IT managed services market from 2016-2028. Some key points:
- The market is segmented by service type, enterprise size, end-user, and region. It provides revenue forecasts for each segment from 2021-2028.
- Major service types include data center/network management, desktop management, server management, and IT hardware support. Large enterprises and SMBs utilize these services, with top end-users being BFSI, manufacturing, telecom/IT, and healthcare.
- North America, Europe, Asia Pacific, Latin America, and Middle East/Africa are the regional segments covered, with market size and growth data for each provided.
-
A global and regional analysis of the advanced space composites marketsidbisresearch
Many industrialised and developing countries have focused their efforts on various space programmes and advances in space research.
for more info. visit: https://bisresearch.com/industry-report/advanced-space-composites-market.html
The document is a research project submitted by Mathilde Segouffin to fulfill the requirements of a Bachelor of Marketing with Honours in Business Studies degree from Dublin Business School. It examines the marketing power of companies through social media. The document includes a literature review on key concepts such as social media and how it has changed company behavior and empowered consumers. It also outlines the research objectives, methodology, and analysis of data collected through questionnaires and interviews on topics such as consumer trust, word-of-mouth marketing, and company influence on social media. The conclusions provide recommendations for how companies can best leverage social media.
This document analyzes UK trade performance across different markets and sectors. It finds that while UK goods exports have grown more slowly than France and Germany over the past decade, UK services exports have grown faster than France. The UK has a large share of global services exports but its share of goods exports has declined. The document examines variations in UK trade performance across different sectors and markets, finding the range of performance is striking. For example, the UK has a high share of South Africa's services imports but a low share of Indonesia's. It also analyzes opportunities and challenges for UK exports in specific sectors and key markets like China, India, Brazil and others.
Cognitive Market Research provides detailed analysis of Hair Spray in our recently published report titled, "Hair Spray 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Hair Spray market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Hair Spray market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
#HairSprayReport #HairSprayMarketForecast #HairSprayMarketStatus #HairSprayMarket2021
https://www.cognitivemarketresearch.com/hair-spray-market-report
A market survey issued by Stockholm County exploring the markets ideas and concepts for a new IT solution based on open architecture, in order for the hospitals in Stockholm to enable the future of care.
This document provides an overview and analysis of the global esports market. It covers market segments by product and application, analyzing revenue and growth rate for each segment from 2016 to 2028. It also examines the market share and growth in key geographic regions including North America, Europe, Asia Pacific, Latin America, and Middle East and Africa. Drivers, restraints and opportunities for the global esports market are identified and factors like COVID-19 impact, PESTEL forces, and manufacturing costs are analyzed. The market is then forecasted from 2021 to 2028.
Analysis of Financial Condition and Dividend Pattern of Beximco Pharmaceutica...Pantho Sarker
In this report, we discussed about the financial performance of the Beximco Pharmaceuticals Limited. Firstly, the corporate goal of this firm has been stated. Secondly, the market value and book value of the firm has been showed with calculation. Relative valuation gives us a picture of what the value of Beximco pharmaceuticals should be relative to its peers. Using the P/E and EV/EBITDA we found out Beximco pharmaceuticals to be undervalued.
The capital structure of the company is not at the optimum level. Both peer analysis and quantitative analysis has been used to analyze and identify an optimal capital structure to maximize the value of the firm
Beximco follows a Stable dividend policy as it pays stable dividends regardless of earnings and free cash flows and the managers of the firms are making the best use of the retained earnings as it is generating better ROE and ROC.
In contrast to other studies of competitiveness which often focus on the country and industry level, this is a study of competitiveness in Poland at the firm level. In this analysis, the authors focus primarily on how cooperation with external actors such as investors, creditors, customers, suppliers, local governments affects changes in Polish firms’ competitiveness.
Authored by: Katarzyna Binkiewicz, Jacek Cukrowski, Michal Gorzynski, Malgorzata Jakubiak, Amelia Kalukiewicz, Piotr Wojcik. Richard Woodward
Published in 2005
The document provides an overview and analysis of the global inverter technology refrigerator market. It discusses key drivers, restraints, and opportunities in the market. It analyzes the market size by region, type of refrigerator, application, and distribution channel from 2016 to 2021. It also forecasts revenue growth from 2021 to 2028. The market is segmented by 185-200L, 200-300L, 300-400L, 400-500L, 600-700L, and 700L+ refrigerator types. Applications include residential, commercial, and industrial refrigerators. Distribution channels include specialty retailers, department stores, mass retailers/hypermarkets, discount stores, and online. The document concludes with profiles of major refrigerator manufacturers.
Cognitive Market Research provides detailed analysis of Metallized Rollstock Film in our recently published report titled, "Metallized Rollstock Film 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Metallized Rollstock Film market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Metallized Rollstock Film market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
#MetallizedRollstockFilmReport #MetallizedRollstockFilmMarketForecast #MetallizedRollstockFilmMarketStatus #MetallizedRollstockFilmMarket2021
https://cognitivemarketresearch.com/chemical-%26-materials/metallized-rollstock-film-market-report
Cognitive Market Research provides detailed analysis of Managed Print Services in our recently published report titled, "Managed Print Services 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Managed Print Services market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Managed Print Services market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
#ManagedPrintServicesReport #ManagedPrintServicesMarketForecast #ManagedPrintServicesMarketStatus #ManagedPrintServicesMarket2021
Synthetic biology market global revenue, trends, growth, share, size and fore...Scalar Market Research
Synthetic Biology Market is worth USD 2.64 billion in 2014 and is expected to reach USD 37.21 billion by 2022, growing at a CAGR of 27.7% from 2014 to 2022.
Download Free Sample: https://www.scalarmarketresearch.com/request-sample.php?id=46
Cognitive Market Research provides detailed analysis of Direct Attached Storage DAS System in our recently published report titled, "Direct Attached Storage DAS System 2021" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Direct Attached Storage DAS System market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Direct Attached Storage DAS System market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc. #DirectAttachedStorageDASSystemReport #DirectAttachedStorageDASSystemMarketForecast #DirectAttachedStorageDASSystemMarketStatus #DirectAttachedStorageDASSystemMarket2021
https://www.cognitivemarketresearch.com/direct-attached-storage-%28das%29-system-market-report
Cognitive Market Research provides detailed analysis of Cap Market in our recently published report titled, "Cap Market 2020" The market study focuses on industry dynamics including driving factors to provide the key elements fueling the current market growth. The report also identifies restraints and opportunities to identify high growth segments involved in the Cap market. Key industrial factors such as macroeconomic and microeconomic factors are studied in detail with help of PESTEL analysis in order to have a holistic view of factors impacting Cap market growth across the globe. Market growth is forecasted with the help of complex algorithms such as regression analysis, sentiment analysis of end-users, etc.
As per BIS Research analysis, the population sequencing market is projected to reach $64,047.6 million by 2030 from $21,730.4 million in 2020, at a CAGR of 11.41% during the forecast period, 2020-2030.
Advanced Missile Defense System Market Professional Survey And In-depth AnalysisBIS Research Inc.
The growth in the global advanced missile defense system market is expected to be driven by increasing defense budgets of countries across the globe.
Advanced missile defense system refers to a system that provides any defense against any missile type (conventional or nuclear) by any country. The mechanism that can detect and then destroy a missile before it can cause any harm is called a missile defense system (MDS).
The competitive landscape of the advanced missile defense system material market consists of several organic and inorganic strategies followed by the key players to increase their market share. The strategies include product innovations, contracts, partnerships, acquisitions, and business expansions, among others.
Request for the Sample of the Report: https://bisresearch.com/requestsample?id=1349&type=download
BIS Research - Variable Rate Technology Market | Trends and Forecast AnalysisBIS Research Inc.
The global variable rate technology market is highly consolidated, with a small number of dominant established players and a smaller number of rising start-ups.
Download the Sample Report of Variable Rate Technology Market at: https://bit.ly/3e3NP58
The global mobility-as-a-service market analysis by BIS Research projects the market to grow at a significant CAGR of 25.10% during the forecast period from 2020 to 2025.
Supersonic and Hypersonic Aircraft Market is expected to reach $5,400.4 million by 2032. Supersonic and hypersonic aircraft manufacturing industry comprises aircraft manufacturers, subsystem manufacturers, and end users.
Read Report Overview: https://bisresearch.com/industry-report/supersonic-hypersonic-aircraft-market.html
TOC-Commercial Space Payload Market, 2020-2031.pdfHarsh Singla
The global commercial space payload market is expected to reach $56.32 billion by 2031, with a CAGR of 5.51% during the forecast period 2021-2031.
The commercial space payload market generates revenue by deploying satellites into the Earth's orbit, mostly in Low Earth orbit (LEO) and Geosynchronous Earth orbit (GEO).
The increasing number of satellite constellations for applications such as communication, technology development, Earth observation, and remote sensing is expected to be the major driving factors for the market.
Next-Generation Avionics Market Expected to Expand at a Steady from 2020-2025Harsh Singla
The next-generation avionics industry analysis by BIS Research projects the market to grow at a significant CAGR of 6.53% on the basis of value during the forecast period from 2020 to 2025.
To know more about Next generation avionics and about its market, please follow the link given below:
https://bisresearch.com/industry-report/next-generation-avionics-market.html
To get the detailed report with excessive data on the Next-generation avionics Market please follow the given link:
https://bisresearch.com/requestsample?id=1029&type=requestUpdatedVersion
Next Generation Avionics Market to Grow at a Significant CAGR of 6.53% Betwee...AmanpreetSingh409
The next-generation avionics market research provides detailed market information for segmentation such as aircraft type, system, and region. The purpose of this market analysis is to examine the next-generation avionics market outlook in terms of factors driving the market, trends, technological developments, and competitive benchmarking, among others.
Request for Sample Report: https://bisresearch.com/requestsample?id=1029&type=download
Get Access to Next-Generation Avionics Market - A Market and Regional Analysis from BIS Research Focuses on Region, key player, Total revenue, challenges, and growth opportunities.
The next-generation avionics industry analysis is expected to grow at a CAGR of 6.53% on the basis of value during the forecast period from 2020 to 2025.
Visit: https://bisresearch.com/industry-report/next-generation-avionics-market.html
The global operating room management solutions market was valued at $2,023.5 million in 2021 and is expected to reach $3,699.1 million by 2031. The market is expected to grow at a CAGR of 6.29% during the forecast period from 2022 to 2031.
Table of Content - Electric Vehicle Fast-Charging System Market.pdfHarsh Singla
The global EV fast-charging system market is expected to reach $10.82 billion by 2031, growing with a CAGR of 16.56% during the forecast period 2022-2031.
According to “International Energy Agency” there are around 10 million electric vehicles on the road worldwide. Governing bodies of various countries are rolling out funding and investments to support the EV charging infrastructure development in their countries. Countries such as China, the U.S., and the U.K. are substantially investing in the development of charging infrastructure. A surge in demand for electric vehicles around the world is also pushing the EV fast-charging system market substantially.
View the report that provides the data of Electric Vehicle Fast Charging System Market share, made by Bis Research.
https://bisresearch.com/industry-report/electric-vehicle-fast-charging-system-market-report.html
Download the sample of Electric Vehicle Fast-Charging System Report.
https://bisresearch.com/requestsample?id=1278&type=download
Electric Vehicle Fast-Charging System Market is expected to reach $10.82 billion by 2031, growing with a CAGR of 16.56% during the forecast period 2022-2031. Electric Vehicle Fast-Charging System Industry trends, forecast, share analysis.
Visit: https://bisresearch.com/industry-report/electric-vehicle-fast-charging-system-market-report.html
The Non-invasive prenatal testing (NIPT) market is projected to reach $10,818.4 Million by 2030 from $2,182.3 Million in 2020, at a CAGR of 15.83% during the forecast period, 2020-2030.
Our healthcare experts have found COVID-19 Diagnostic Testing industry to be one of the most rapidly evolving and dynamic markets and the global market for COVID-19 diagnostic testing is predicted to grow at a CQGR of 23.50% over the forecast period of 3Q2020-4Q2021.
Global Electric Farm Tractor Market was valued at $116.5 million in 2020, Electric Farm Tractor Industry is expected to grow with a CAGR of 11.1% and reach $218.9 million by 2026.
View: https://bisresearch.com/industry-report/electric-farm-tractor-market.html
Electric Farm Tractor Market Brief Analysis by Top research companyHarsh Singla
Some of the key players operating in the Electric Tractors Market include Alke, Cummins Inc., Deere & Company, Escorts Limited, Fendt, Kubota Corporation, Motivo Engineering, Solectrac, Inc., Sonalika, Monarch Tractor, Yanmar Holdings Co., Ltd., AutoNxt Automation Pvt. Ltd., Cellestial, Ztractor, and EcoFactor.
The global electric farm tractor market was valued at $116.5 million in 2020, which is expected to grow with a CAGR of 11.1% and reach $218.9 million by 2026.
Leading players in the Battery-Operated Electric Tractors Market are operating in the North America region, which gives a wide range of options to the growers purchasing electric farm tractors.
View the report of Electric Farm Tractor Market, made by the highly qualified research team of Bis Research:
https://bisresearch.com/industry-report/electric-farm-tractor-market.html
Get the free sample of the Electric Farm Tractor report exclusively on Bis Research’s Website:
https://bisresearch.com/requestsample?id=1178&type=download
Bio-LNG Market is anticipated to reach $3,607.2 million by 2032.pdfMohit BISResearch
Bio-LNG Market is anticipated to reach $3,607.2 million by 2032. the high cost of bio-LNG as compared to LNG is anticipated to hinder market growth in the future.
Read Report Overview: https://bisresearch.com/industry-report/bio-lng-market.html
Satellite Imaging for Agriculture Market is expected to reach $785.3 million with a CAGR of 7.50% by 2028. Satellite imagery plays a pivotal role in the monitoring of crop health.
Read Report Overview: https://bisresearch.com/industry-report/satellite-imaging-agriculture-market.html
Supersonic and Hypersonic Aircraft Market Value to Reach $5,400.4 Million by ...BIS Research Inc.
The advent of commercial supersonic and possibly hypersonic passenger aircraft is expected to be fueled by the growing demand for faster and more sustainable aircraft
The competitive landscape of the supersonic and hypersonic aircraft market consists of several organic and inorganic strategies followed by the key players to increase their market share. The strategies include product innovations, contracts, partnerships, acquisitions, and business expansions.
Request for the Sample Report on Supersonic and Hypersonic Aircraft Market at: https://bisresearch.com/requestsample?id=1393&type=download
TOC - Global Automotive V2X Market.pdfHarsh Singla
The impact of COVID-19 on the automotive manufacturing industry and the semiconductor industry is expected to adversely affect the automotive V2X market. The reduced global vehicle sales and shutting down of production facilities have been seriously affecting the supply chains. The semiconductor industry is facing the shortage of materials, components, and finished goods, which is in turn impacting the suppliers.
The automotive V2X market is expected to reach $10.55 billion by 2025. The automotive V2X market valued at $5.78 million and 19.6 thousand units in 2019, in terms of value and volume and is anticipated to grow at CAGRs of 265.87% and 268.49% respectively, during the forecast period, 2020-2025.
View the Exclusive Report of Automotive V2X Industry with accurate data and information curated by Bis Research:
https://bisresearch.com/industry-report/automotive-v2x-market.html
Or first you can download the free sample of Automotive V2X Market Report to know more about it:
https://bisresearch.com/requestsample?id=938&type=download
Similar to Electric Vehicle Fast-Charging System Market - A Global and Regional Analysis (20)
Webinar Presentation Syndromic Testing – A New Take on Diagnosing Infectious ...BIS Research Inc.
The document summarizes a webinar on syndromic testing for diagnosing infectious diseases. The webinar featured several speakers who discussed topics like: how syndromic testing can provide faster results and reduce antibiotic use compared to traditional testing; applications of metagenomics next-generation sequencing (mNGS) in clinical diagnostics and its benefits; key trends in the syndromic testing market like high growth rates and the dominance of respiratory disease testing currently. The global syndromic testing market is expected to grow from $1.28 billion in 2022 to $3.25 billion in 2033, driven by factors like rising infectious disease incidence and the need for early diagnosis.
The global sustainable steel market is projected to reach $795.8 billion by 2031 from $327.3 billion in 2021, growing at a CAGR of 8.97% during the forecast period 2022-2031. The growth in the global sustainable steel market is expected to be driven by stringent government regulations, carbon neutrality targets, energy and cost efficiency owing to the use of recycled steel, and a significant increase in steel demand with the scarcity of raw materials and energy.
Cybersecurity in Automotive Connected Vehicles and Growing Security Vulnerabi...BIS Research Inc.
• Agenda:
o To evaluate various security vulnerabilities in connected vehicles.
o To analyze the initiatives taken and regulations implemented to address security vulnerabilities.
o To analyze the various types of cybersecurity solutions being developed or offered for the security of connected vehicles.
o To evaluate the major players in the ecosystem.
Report Preview is available at: https://bisresearch.com/industry-report/global-automotive-cybersecurity-market.html
BIS Research conducted a webinar on Carbon Neutral Data Center PracticesBIS Research Inc.
Agenda:
To evaluate various emerging trends in Data center industry.
To analyze the initiatives taken and regulations implemented to increase sustainable practices.
To analyze the various types of technologies currently deployed.
To evaluate the major players in the ecosystem.
Speaker Profiles:
Name: JD Enright, Sr.
Designation: Chief Operating Officer
Company: TMGcore Inc.
Experienced and dedicated business professional with 29 years working with DOD, Multinational Private and Public sector organizations. Primary focus on developing and executing Strategic Step-Up Growth initiatives in Emerging Markets, and Technologies. Specialized leadership in developing improved business operations to include Financial and Operational efficiencies. Implementation of next generation HPC Platforms, Global Blockchain Development Strategies, Biotechnology, Viral Cell and Gene Therapies and Market Intelligence Assimilation for public applications.
Webinar by BIS Research on Precision Oncology BiomarkersBIS Research Inc.
Precision oncology biomarkers are essential tools for tailoring cancer treatment to individual patients, as they provide insights into tumor biology and guide the selection of targeted therapies.
BIS conducted a deep intelligence webinar on the state-of-the-art technologies and emerging strategies used through the precision oncology biomarkers.
Direct-to-Customer Wellness | A Webinar on the Growing Need for Personalized ...BIS Research Inc.
Direct-to-consumer (DTC) wellness testing industry witnessed a strong emphasis on consumer health and wellness, instigating industry stakeholders to discover new revenue streams.
As a leading market intelligence firm, BIS Research strives to stay on top of the latest emerging trends in the healthcare sector, among several other industry verticals. In the bid to do the same, BIS is conducting a deep intelligence webinar on the increasing focus of DTC wellness programs in the healthcare sector.
Read Related Reports Overview at:
https://bisresearch.com/industry-report/global-direct-to-consumer-genetic-testing-market.html
https://bisresearch.com/industry-report/us-dtc-wellness-testing-market.html
Emerging Battery Chemistries | Reimagining EVs Beyond Conventional Li-Ion Bat...BIS Research Inc.
The efficiency of the battery system in any electric vehicle (EV) determines its cost and vehicle performance. Challenges, such as range anxiety and charging time, have been a hindrance to increasing EV sales.
As a leading market intelligence firm, BIS Research strives to stay on top of the latest emerging technologies in the mobility sector, among several other industry verticals.
In the bid to do the same, BIS is conducting a deep intelligence webinar on the current paradigm shift happening for battery technologies in electric vehicles.
Here are all the details:
Webinar Topic: Emerging Battery Chemistries | Reimagining EVs Beyond Conventional Li-Ion Batteries
Webinar on AI in Medical Diagnosis with Emerging TechnologiesBIS Research Inc.
Artificial Intelligence (AI) is a rapidly growing field that has the potential to revolutionize the way medical diagnosis is performed. AI systems use advanced algorithms to analyze large amounts of data, such as medical images, patient histories, and lab results, to identify patterns and make predictions about patient outcomes.
In medical diagnosis, AI can be used in a variety of ways, including medical imaging, disease diagnosis, personalized treatment planning, and early disease detection. By leveraging the power of AI, healthcare providers can make faster and more accurate diagnoses, resulting in better patient outcomes.
Agenda:
The main agenda of this webinar is to understand and explore the following:
• Policy implications related to AI and digital transformation in healthcare.
• Initiatives taken and regulations implemented to address cybersecurity concerns.
• Major factors driving and hindering the growth of AI in medical devices diagnosis.
• Major players in the ecosystem
AI-Enabled Imaging Solutions Market - A Global Market Report by BIS ResearchBIS Research Inc.
The global AI-enabled medical imaging solutions market was valued at $1,854.5 million in 2022 and is anticipated to reach $18,356.5 million by 2032, witnessing a CAGR of 25.76% during the forecast period 2022-2032. you can get more info to visit this link..
https://bisresearch.com/industry-report/global-ai-enabled-medical-imaging-solutions-market.html
The global demand for achieving the net zero emission target by 2050 has pushed governments all over to adapt and adopt advanced carbon removal technologies to go carbon negative.
It is, indeed, an important topic of discussion, because a carbon free environment is the need of the hour to save our planet. And, therefore, BIS Research is glad to announce its upcoming webinar on this particular subject.
Agenda:
The main agenda of this webinar is to understand and explore the following:
• Primary sources of carbon emissions and associated environmental issues
• Carbon dioxide removal – key technology and adoption scenario
• Carbon dioxide removal (CDR): trends and key market developments
• Carbon dioxide removal as a credible solution
• Conclusion and future outlook
Webinar on Biomanufacturing 4.0 – A New Era in Cell and Gene Therapy DevelopmentBIS Research Inc.
Agenda of the Webinar:
Cell and Gene Therapy Biomanufacturing Market: Trends and Key Developments
Awaited Technologies in the Cell and Gene Therapy Development
Regulatory Scenario – GMP/cGMP Guidelines
Biomanufacturing 4.0 - Adoption Scenario
Conclusion and Future Outlook
Sub-Orbital Testing Services Market Future Growth and Business Opportunities ...BIS Research Inc.
Sub-orbital platforms are increasing access to the near space-like environment for end users such as government agencies, research institutions, and commercial players.
The competitive landscape of the sub-orbital testing services market consists of several organic and inorganic strategies followed by the key players to increase their market share.
The space industry is continuously innovating and developing advanced technologies with the objective of enhancing space capabilities. The industry is gearing up to develop vehicles that entail a major feature, i.e., reusability.
Request for the sample of the report at: https://bisresearch.com/requestsample?id=1442&type=download
TOC - Global Military Robotic and Autonomous Systems (RAS) Market.pdfBIS Research Inc.
The robotic and autonomous system (RAS) is a multidisciplinary scientific and technological domain for implementing complex systems with cognitive capabilities.
RAS in military is being rigorously introduced and used in combat training. This has boosted the capabilities of armed units and subunits. The advent of artificial intelligence (AI) and its integration with military RAS has the potential to change future warfare.
Growing demand to increase warfighter lethality and remove soldiers from dangerous situations is propelling the global military RAS market.
Request for the sample of the report at: https://bisresearch.com/requestsample?id=1442&type=download
UAV Propulsion System Market Analysis, Statistics, Regional, and Forecast to ...BIS Research Inc.
UAV propulsion system manufacturers have also been inclined to counter the environment and other government regulations by developing sustainable propulsion, i.e., steps toward fossil-free aviation fuels and ion propulsion are a few of such significant innovations.
UAVs can be powered by a variety of different types of engines, including piston engines, turbine engines, Wankel engines, and electric and solar-powered engines.
The global UAV propulsion system market has witnessed a high growth rate in the last five to six years owing to its widespread applications across various industries, which were further bolstered by the COVID-19 pandemic.
Publication of BIS Research on UAV Propulsion System market has some great insights for UAV Propulsion Systems. Get free sample here: https://bisresearch.com/requestsample?id=1443&type=download
Fleet Management Market Trends, Key Players, Industry Analysis and Forecast 2...BIS Research Inc.
A fleet management system, which includes hardware, software and service, has the ability to make decisions for fleet managers and fleet businesses easily.
The ongoing research and development activities in this market are experiencing product launches of fleet management system for fleet owners, fleet managers, or businesses that utilize fleet management on a daily basis.
BIS Research has a new publication on Fleet Management, view free sample here : https://bisresearch.com/requestsample?id=1444&type=download
Agenda:
The main agenda of this webinar is to understand and explore the following:
• LoRaWAN adoption in agricultural applications as well as understanding the trends and key market developments.
• The significance of LoRaWAN in the field of IoT
• A comparative analysis between LoRaWAN and other IoT networks in terms of technology and capabilities.
• The impact of LoRaWAN on the operations of the agriculture industry and common use cases.
• The impact of the implementation of LoRaWAN technology on stakeholders in the agriculture ecosystem.
• The potential challenges that LoRaWAN might face in the future.
• The competitiveness of the market for LoRaWAN technology.
Augmented Reality in Agriculture Analysis and Statistics from 2022-2027BIS Research Inc.
AR depicts superimposing visual, audio, or other sensory data onto the physical world to improve one's experience. It is one of the most popular technological trends in today’s times. AR images can be displayed on a variety of devices, including eyeglasses and goggles, headsets, and heads-up displays such as helmet visors. As more smartphones, tablets, and other handheld devices that support AR are becoming available globally, the most popular way to use AR is on these devices in a variety of apps and games.
Although AR is used to visually communicate information, it is the integration of AR with other technologies that make it possible to adapt to precision farming and visual-based operations. Hence, farmers can utilize AR in combination with other technologies such as artificial intelligence (AI), big data, and the Internet of Things (IoT) to manage the rising food demand.
Get Augmented Reality in Agriculture report overview at: https://bisresearch.com/industry-report/ar-agriculture-market.html
Smart Harvest Market Generated Opportunities, Future Scope 2022-2027BIS Research Inc.
The growth in the global smart harvest market is expected to be driven by increasing smart farming practices among farmers, labor shortage, and growing government support for promoting the use of smart tech in the agriculture industry. Supported by government policies and technological developments, farmers and growers across the globe are expected to increase the implementation of smart harvest technologies. Moreover, the smart harvest market is witnessing several upcoming trends and opportunities, further propelling growth in the industry.
Get the PDF document on the technical aspects of Smart Harvest Market at: https://bisresearch.com/requestsample?id=1386&type=download
Precision Pest Management Market Leading Players, Development and Demand Fore...BIS Research Inc.
While farmers are losing crops due to pests, they have pressure to increase food production to feed the growing world population.
Precision pest management (PPM) is very important to avoid destruction caused by pests and to increase productivity. PPM helps to detect pests early with the help of crop monitoring so they can be controlled early to avoid further losses. The availability of advanced technologies and equipment has made agriculture automation more prevalent in developed countries.
To know more about the in-depth insights on precision pest management market, get PDF document: https://bisresearch.com/requestsample?id=1404&type=download
Agriculture Drones and Robots Market Growth Opportunity, Trends, Demand Analy...BIS Research Inc.
Agriculture drones and robots offer multiple benefits over conventional farming equipment, which is another factor driving the demand for these products in the agriculture industry. The adoption of agriculture drones and robots in commercial farms offers huge cost-saving opportunities.
Request for the Sample of the Report at: https://bisresearch.com/requestsample?id=1425&type=download
Ever been troubled by the blinking sign and didn’t know what to do?
Here’s a handy guide to dashboard symbols so that you’ll never be confused again!
Save them for later and save the trouble!
What Could Be Behind Your Mercedes Sprinter's Power Loss on Uphill RoadsSprinter Gurus
Unlock the secrets behind your Mercedes Sprinter's uphill power loss with our comprehensive presentation. From fuel filter blockages to turbocharger troubles, we uncover the culprits and empower you to reclaim your vehicle's peak performance. Conquer every ascent with confidence and ensure a thrilling journey every time.
EV Charging at MFH Properties by Whitaker JamiesonForth
Whitaker Jamieson, Senior Specialist at Forth, gave this presentation at the Forth Addressing The Challenges of Charging at Multi-Family Housing webinar on June 11, 2024.
Understanding Catalytic Converter Theft:
What is a Catalytic Converter?: Learn about the function of catalytic converters in vehicles and why they are targeted by thieves.
Why are They Stolen?: Discover the valuable metals inside catalytic converters (such as platinum, palladium, and rhodium) that make them attractive to criminals.
Steps to Prevent Catalytic Converter Theft:
Parking Strategies: Tips on where and how to park your vehicle to reduce the risk of theft, such as parking in well-lit areas or secure garages.
Protective Devices: Overview of various anti-theft devices available, including catalytic converter locks, shields, and alarms.
Etching and Marking: The benefits of etching your vehicle’s VIN on the catalytic converter or using a catalytic converter marking kit to make it traceable and less appealing to thieves.
Surveillance and Monitoring: Recommendations for using security cameras and motion-sensor lights to deter thieves.
Statistics and Insights:
Theft Rates by Borough: Analysis of data to determine which borough in NYC experiences the highest rate of catalytic converter thefts.
Recent Trends: Current trends and patterns in catalytic converter thefts to help you stay aware of emerging hotspots and tactics used by thieves.
Benefits of This Presentation:
Awareness: Increase your awareness about catalytic converter theft and its impact on vehicle owners.
Practical Tips: Gain actionable insights and tips to effectively prevent catalytic converter theft.
Local Insights: Understand the specific risks in different NYC boroughs, helping you take targeted preventive measures.
This presentation aims to equip you with the knowledge and tools needed to protect your vehicle from catalytic converter theft, ensuring you are prepared and proactive in safeguarding your property.
Expanding Access to Affordable At-Home EV Charging by Vanessa WarheitForth
Vanessa Warheit, Co-Founder of EV Charging for All, gave this presentation at the Forth Addressing The Challenges of Charging at Multi-Family Housing webinar on June 11, 2024.
Implementing ELDs or Electronic Logging Devices is slowly but surely becoming the norm in fleet management. Why? Well, integrating ELDs and associated connected vehicle solutions like fleet tracking devices lets businesses and their in-house fleet managers reap several benefits. Check out the post below to learn more.
Welcome to ASP Cranes, your trusted partner for crane solutions in Raipur, Chhattisgarh! With years of experience and a commitment to excellence, we offer a comprehensive range of crane services tailored to meet your lifting and material handling needs.
At ASP Cranes, we understand the importance of reliable and efficient crane operations in various industries, from construction and manufacturing to logistics and infrastructure development. That's why we strive to deliver top-notch solutions that enhance productivity, safety, and cost-effectiveness for our clients.
Our services include:
Crane Rental: Whether you need a crawler crane for heavy lifting or a hydraulic crane for versatile operations, we have a diverse fleet of well-maintained cranes available for rent. Our rental options are flexible and can be customized to suit your project requirements.
Crane Sales: Looking to invest in a crane for your business? We offer a wide selection of new and used cranes from leading manufacturers, ensuring you find the perfect equipment to match your needs and budget.
Crane Maintenance and Repair: To ensure optimal performance and safety, regular maintenance and timely repairs are essential for cranes. Our team of skilled technicians provides comprehensive maintenance and repair services to keep your equipment running smoothly and minimize downtime.
Crane Operator Training: Proper training is crucial for safe and efficient crane operation. We offer specialized training programs conducted by certified instructors to equip operators with the skills and knowledge they need to handle cranes effectively.
Custom Solutions: We understand that every project is unique, which is why we offer custom crane solutions tailored to your specific requirements. Whether you need modifications, attachments, or specialized equipment, we can design and implement solutions that meet your needs.
At ASP Cranes, customer satisfaction is our top priority. We are dedicated to delivering reliable, cost-effective, and innovative crane solutions that exceed expectations. Contact us today to learn more about our services and how we can support your project in Raipur, Chhattisgarh, and beyond. Let ASP Cranes be your trusted partner for all your crane needs!
Electric Vehicle Fast-Charging System Market - A Global and Regional Analysis
1. 1
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
Focus on DC Fast Charging (Public & Private),
Connector Type (Combo Charging, GB/T, CHADeMO,
Supercharger), and Power Output of the DC charger
System
Analysis and Forecast: 2020-2025
SEPTEMBER 2020
Electric Vehicle
Fast-Charging
System Market -
A Global and
Regional Analysis
Table of Content
3. 3
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
Table of Content
Executive Summary ........................................................................ 26
Scope of the Study.......................................................................... 31
1 MARKETS................................................................................. 33
1.1 Industry Outlook..............................................................................................34
1.1.1 Supply Chain Network/MAP .......................................................................34
1.1.2 Industry Trends ...........................................................................................35
1.1.2.1 Battery Technology ..........................................................................................35
1.1.2.2 Ride-Hailing Services.......................................................................................35
1.1.2.3 Last Mile Delivery.............................................................................................35
1.1.2.4 Two and Three-Wheeler Vehicles ....................................................................36
1.1.3 Emerging Technologies/Concept for EV Charging ..................................36
1.1.3.1 Solar Charging .................................................................................................36
1.1.3.1.1 Key Companies Leading the Trend ......................................................................... 36
1.1.3.1.2 Impact on EV Fast-Charging Market........................................................................ 36
1.1.3.2 Inductive Charging ...........................................................................................36
1.1.3.2.1 Key Companies Leading the Trend ......................................................................... 36
1.1.3.2.2 Impact on EV Fast-Charging Market........................................................................ 36
1.1.3.3 Vehicle-to-Grid .................................................................................................37
1.1.3.3.1 Key Companies Leading the Trend ......................................................................... 37
1.1.3.3.2 Impact on EV Fast-Charging Market........................................................................ 37
1.1.4 Policies and Government Initiatives..........................................................37
1.1.5 Evolving Business Model: Electric Vehicle Charging..............................38
1.1.5.1 Smart Charging Station....................................................................................38
1.1.5.2 Subscription Model...........................................................................................39
1.1.5.3 Pay-As-You-Go Model .....................................................................................39
1.1.5.4 EV Charging-As-A-Service...............................................................................39
1.2 Business Dynamics.........................................................................................40
1.2.1 Business Drivers .........................................................................................42
1.2.1.1 Demonstration of Environmental Commitment and Supporting Brand
Values..............................................................................................................42
1.2.1.2 Sprouting of New Government Policies and Initiatives......................................42
4. 4
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
1.2.1.3 Ban on ICE Vehicle Production ........................................................................43
1.2.1.4 Technological Advancement Leading to the Demand for Fast Chargers ..........44
1.2.2 Business Challenges ..................................................................................45
1.2.2.1 Strong Grid Access Necessary.........................................................................45
1.2.2.2 Negative Effects on Electric Vehicle’s Battery Lifetime.....................................45
1.2.2.3 High Infrastructure Cost of Fast-Charging System ...........................................45
1.2.3 Business Strategies ....................................................................................46
1.2.3.1 Product Development.......................................................................................47
1.2.3.2 Market Development ........................................................................................47
1.2.4 Corporate Strategies...................................................................................48
1.2.4.1 Mergers and Acquisitions, Partnerships, Joint Ventures, Collaborations,
and Alliances....................................................................................................48
1.2.5 Market Opportunities ..................................................................................48
1.2.5.1 Constantly Evolving Business Models for Promoting EV Adoption Rate...........48
1.2.5.2 Emerging Economies Stimulating the Growth of EV Infrastructure ...................49
2 APPLICATIONS ........................................................................ 50
2.1 EV Fast-Charging System Market: Applications and Specifications ..........51
2.1.1 Public............................................................................................................51
2.1.2 Private ..........................................................................................................51
2.2 Demand Analysis of Electric Vehicle Fast-Charging System Market (by
Application), Volume Data ..............................................................................53
2.2.1 Public............................................................................................................53
2.2.2 Private ..........................................................................................................53
3 PRODUCTS .............................................................................. 54
3.1 Types of Products for Electric Vehicle Fast-Charging System Market.......55
3.1.1 Types of Products for Electric Vehicle Fast-Charging System
Market (by Connector Type) .......................................................................55
3.1.1.1 CHADeMO.......................................................................................................56
3.1.1.2 SAE Combo Charging System .........................................................................56
3.1.1.3 Supercharger ...................................................................................................56
3.1.1.4 GB/T ................................................................................................................57
5. 5
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
3.1.2 Types of Products for Electric Vehicle Fast-Charging System
Market, by Charging Power (KW)...............................................................57
3.1.2.1 Less than 100 KW............................................................................................57
3.1.2.2 100-200 KW.....................................................................................................57
3.1.2.3 Greater than 200 KW .......................................................................................58
3.2 Demand Analysis of Electric Vehicle Fast-Charging System Market,
Volume Data.....................................................................................................59
3.2.1 Demand Analysis of Electric Vehicle Fast-Charging System Market,
Volume Data (by Connector Type).............................................................59
3.2.1.1 CHADeMO.......................................................................................................59
3.2.1.2 SAE Combo Charging System .........................................................................60
3.2.1.3 Supercharger ...................................................................................................60
3.2.1.4 GB/T ................................................................................................................60
3.2.2 Demand Analysis of Electric Vehicle Fast-Charging System Market,
Volume Data (by Charging Power; KW).....................................................61
3.2.2.1 Less than 100 KW............................................................................................61
3.2.2.2 100-200 KW.....................................................................................................61
3.2.2.3 Greater than 200 KW .......................................................................................62
3.3 Product Benchmarking: Growth Rate – Market Share Matrix......................62
3.3.1 Opportunity Matrix, (by Region).................................................................62
3.3.2 Opportunity Matrix (by Product Type).......................................................63
3.4 Technology Roadmap .....................................................................................64
4 REGIONS ................................................................................. 65
4.1 NORTH AMERICA ............................................................................................68
4.1.1 Markets.........................................................................................................68
4.1.1.1 Buyers Attributes..............................................................................................68
4.1.1.2 Key Manufacturers and Suppliers in North America .........................................68
4.1.1.3 Competitive Benchmarking ..............................................................................68
4.1.1.4 Business Challenges........................................................................................69
4.1.1.5 Business Drivers ..............................................................................................69
4.1.1.6 Pricing Analysis................................................................................................69
4.1.2 Applications.................................................................................................70
6. 6
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.1.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ....................................................................................................70
4.1.3 Products.......................................................................................................70
4.1.3.1 EV Fast-Charging System Market (by Connector Type), Volume Data.............70
4.1.3.2 EV Fast-Charging System Market (by Charging Power; KW), Volume Data
.........................................................................................................................70
4.1.4 NORTH AMERICA (BY COUNTRY).............................................................71
4.1.4.1 U.S...................................................................................................................71
4.1.4.1.1 Markets .................................................................................................................... 71
4.1.4.1.1.1 Buyers Attributes .............................................................................................. 71
4.1.4.1.1.2 Key Manufacturers and Suppliers .................................................................... 71
4.1.4.1.1.3 Business Challenges ........................................................................................ 71
4.1.4.1.1.4 Business Drivers............................................................................................... 71
4.1.4.1.2 Applications.............................................................................................................. 71
4.1.4.1.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 71
4.1.4.1.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 72
4.1.4.1.3 Products ................................................................................................................... 72
4.1.4.1.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 72
4.1.4.1.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 72
4.1.4.2 Canada ............................................................................................................72
4.1.4.2.1 Markets .................................................................................................................... 72
4.1.4.2.1.1 Buyers Attributes .............................................................................................. 72
4.1.4.2.1.2 Key Manufacturers and Suppliers .................................................................... 73
4.1.4.2.1.3 Business Challenges ........................................................................................ 73
4.1.4.2.1.4 Business Drivers............................................................................................... 73
4.1.4.2.2 Applications.............................................................................................................. 73
4.1.4.2.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 73
4.1.4.2.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 74
4.1.4.2.3 Products ................................................................................................................... 74
4.1.4.2.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 74
7. 7
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.1.4.2.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 74
4.2 SOUTH AMERICA ............................................................................................76
4.2.1 Markets.........................................................................................................76
4.2.1.1 Buyers Attributes..............................................................................................76
4.2.1.2 Key Manufacturers and Suppliers in South America.........................................76
4.2.1.3 Competitive Benchmarking ..............................................................................76
4.2.1.4 Business Challenges........................................................................................77
4.2.1.5 Business Drivers ..............................................................................................77
4.2.1.6 Pricing Analysis................................................................................................77
4.2.2 Applications.................................................................................................78
4.2.2.1 EV Fast-Charging System Market Demand (by Application), Volume Data ......78
4.2.2.2 Key Commercial and Public Areas with Fast Charger Deployment...................78
4.2.3 Products.......................................................................................................78
4.2.3.1 EV Fast-Charging System Market (by Connector Type), Volume Data.............78
4.2.3.2 EV Fast-Charging System Market (by Charging Power; KW), Volume Data
.........................................................................................................................78
4.2.4 SOUTH AMERICA (BY COUNTRY) .............................................................79
4.2.4.1 Brazil................................................................................................................79
4.2.4.1.1 Markets .................................................................................................................... 79
4.2.4.1.1.1 Buyers Attributes .............................................................................................. 79
4.2.4.1.1.2 Key Manufacturers and Suppliers .................................................................... 79
4.2.4.1.1.3 Business Challenges ........................................................................................ 79
4.2.4.1.1.4 Business Drivers............................................................................................... 79
4.2.4.1.2 Applications.............................................................................................................. 80
4.2.4.1.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 80
4.2.4.1.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 80
4.2.4.1.3 Products ................................................................................................................... 80
4.2.4.1.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 80
4.2.4.1.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 81
4.2.4.2 Rest-of-South America.....................................................................................81
4.2.4.2.1 Markets .................................................................................................................... 81
8. 8
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.2.4.2.1.1 Buyers Attributes .............................................................................................. 81
4.2.4.2.1.2 Key Manufacturers and Suppliers .................................................................... 81
4.2.4.2.1.3 Business Challenges ........................................................................................ 81
4.2.4.2.1.4 Business Drivers............................................................................................... 81
4.2.4.2.2 Applications.............................................................................................................. 82
4.2.4.2.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 82
4.2.4.2.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 82
4.2.4.2.3 Products ................................................................................................................... 82
4.2.4.2.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 82
4.2.4.2.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 83
4.3 EUROPE............................................................................................................85
4.3.1 Markets.........................................................................................................85
4.3.1.1 Buyers Attributes..............................................................................................85
4.3.1.2 Key Manufacturers and Suppliers in Europe ....................................................85
4.3.1.3 Competitive Benchmarking ..............................................................................85
4.3.1.4 Business Challenges........................................................................................86
4.3.1.5 Business Drivers ..............................................................................................86
4.3.1.6 Pricing Analysis................................................................................................86
4.3.2 Applications.................................................................................................87
4.3.2.1 EV Fast-Charging System Market Demand (by Application), Volume Data ......87
4.3.3 Products.......................................................................................................87
4.3.3.1 EV Fast-Charging System Market (by Connector Type), Volume Data.............87
4.3.3.2 EV Fast-Charging System Market (by Charging Power; KW), Volume Data
.........................................................................................................................87
4.3.4 EUROPE (BY COUNTRY) ............................................................................88
4.3.4.1 Norway.............................................................................................................88
4.3.4.1.1 Markets .................................................................................................................... 88
4.3.4.1.1.1 Buyers Attributes .............................................................................................. 88
4.3.4.1.1.2 Key Manufacturers and Suppliers .................................................................... 88
4.3.4.1.1.3 Business Challenges ........................................................................................ 88
4.3.4.1.1.4 Business Drivers............................................................................................... 88
9. 9
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.3.4.1.2 Applications.............................................................................................................. 89
4.3.4.1.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 89
4.3.4.1.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 89
4.3.4.1.3 Products ................................................................................................................... 89
4.3.4.1.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 89
4.3.4.1.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 90
4.3.4.2 Italy ..................................................................................................................90
4.3.4.2.1 Markets .................................................................................................................... 90
4.3.4.2.1.1 Buyers Attributes .............................................................................................. 90
4.3.4.2.1.2 Key Manufacturers and Suppliers .................................................................... 90
4.3.4.2.1.3 Business Challenges ........................................................................................ 90
4.3.4.2.1.4 Business Drivers............................................................................................... 90
4.3.4.2.2 Applications.............................................................................................................. 91
4.3.4.2.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 91
4.3.4.2.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 91
4.3.4.2.3 Products ................................................................................................................... 91
4.3.4.2.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 91
4.3.4.2.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 92
4.3.4.3 France..............................................................................................................92
4.3.4.3.1 Markets .................................................................................................................... 92
4.3.4.3.1.1 Buyers Attributes .............................................................................................. 92
4.3.4.3.1.2 Key Manufacturers and Suppliers .................................................................... 92
4.3.4.3.1.3 Business Challenges ........................................................................................ 92
4.3.4.3.1.4 Business Drivers............................................................................................... 92
4.3.4.3.2 Applications.............................................................................................................. 93
4.3.4.3.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 93
4.3.4.3.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 93
4.3.4.3.3 Products ................................................................................................................... 93
4.3.4.3.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 93
10. 10
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.3.4.3.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 94
4.3.4.4 Germany ..........................................................................................................94
4.3.4.4.1 Markets .................................................................................................................... 94
4.3.4.4.1.1 Buyers Attributes .............................................................................................. 94
4.3.4.4.1.2 Key Manufacturers and Suppliers .................................................................... 94
4.3.4.4.1.3 Business Challenges ........................................................................................ 94
4.3.4.4.1.4 Business Drivers............................................................................................... 95
4.3.4.4.2 Applications.............................................................................................................. 95
4.3.4.4.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 95
4.3.4.4.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 95
4.3.4.4.3 Products ................................................................................................................... 95
4.3.4.4.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 95
4.3.4.4.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 96
4.3.4.5 Spain................................................................................................................96
4.3.4.5.1 Markets .................................................................................................................... 96
4.3.4.5.1.1 Buyers Attributes .............................................................................................. 96
4.3.4.5.1.2 Key Manufacturers and Suppliers .................................................................... 96
4.3.4.5.1.3 Business Challenges ........................................................................................ 96
4.3.4.5.1.4 Business Drivers............................................................................................... 97
4.3.4.5.2 Applications.............................................................................................................. 97
4.3.4.5.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 97
4.3.4.5.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 97
4.3.4.5.3 Products ................................................................................................................... 97
4.3.4.5.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 97
4.3.4.5.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ..................................................................................................... 98
4.3.4.6 Romania...........................................................................................................98
4.3.4.6.1 Markets .................................................................................................................... 98
4.3.4.6.1.1 Buyers Attributes .............................................................................................. 98
4.3.4.6.1.2 Key Manufacturers and Suppliers .................................................................... 98
4.3.4.6.1.3 Business Challenges ........................................................................................ 98
11. 11
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.3.4.6.1.4 Business Drivers............................................................................................... 98
4.3.4.6.2 Applications.............................................................................................................. 99
4.3.4.6.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ..................................................................................................... 99
4.3.4.6.2.2 Key Commercial and Public Areas with Fast Charger Deployment ................. 99
4.3.4.6.3 Products ................................................................................................................... 99
4.3.4.6.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ..................................................................................................... 99
4.3.4.6.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 100
4.3.4.7 Rest-of-Europe...............................................................................................100
4.3.4.7.1 Markets .................................................................................................................. 100
4.3.4.7.1.1 Buyers Attributes ............................................................................................ 100
4.3.4.7.1.2 Key Manufacturers and Suppliers .................................................................. 100
4.3.4.7.1.3 Business Challenges ...................................................................................... 100
4.3.4.7.1.4 Business Drivers............................................................................................. 100
4.3.4.7.2 Applications............................................................................................................ 101
4.3.4.7.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ................................................................................................... 101
4.3.4.7.2.2 Key Commercial and Public Areas with Fast Charger Deployment ............... 101
4.3.4.7.3 Products ................................................................................................................. 101
4.3.4.7.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ................................................................................................... 101
4.3.4.7.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 102
4.4 U.K. .................................................................................................................104
4.4.1 Markets.......................................................................................................104
4.4.1.1 Buyers Attributes............................................................................................104
4.4.1.2 Key Manufacturers and Suppliers in the U.K. .................................................104
4.4.1.3 Competitive Benchmarking ............................................................................104
4.4.1.4 Business Challenges......................................................................................105
4.4.1.5 Business Drivers ............................................................................................105
4.4.1.6 Pricing Analysis..............................................................................................105
4.4.2 Applications...............................................................................................106
4.4.2.1 EV Fast-Charging System Market Demand (by Application), Volume Data ....106
12. 12
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.4.2.2 Key Commercial and Public Areas with Fast Charger Deployment.................106
4.4.3 Products.....................................................................................................106
4.4.3.1 EV Fast-Charging System Market (by Connector Type), Volume Data...........106
4.4.3.2 EV Fast-Charging System Market (by Charging Power; KW), Volume Data
.......................................................................................................................107
4.5 MIDDLE EAST AND AFRICA (MEA)..............................................................109
4.5.1 Markets.......................................................................................................109
4.5.1.1 Buyers Attributes............................................................................................109
4.5.1.2 Key Manufacturers and Suppliers in the Middle East and Africa.....................109
4.5.1.3 Competitive Benchmarking ............................................................................109
4.5.1.4 Business Challenges......................................................................................110
4.5.1.5 Business Drivers ............................................................................................110
4.5.1.6 Pricing Analysis..............................................................................................110
4.5.2 Applications...............................................................................................111
4.5.2.1 EV Fast-Charging System Market Demand (by Application), Volume Data ....111
4.5.3 Products.....................................................................................................111
4.5.3.1 EV Fast-Charging System Market (by Connector Type), Volume Data...........111
4.5.3.2 EV Fast-Charging System Market (by Charging Power; KW), Volume Data
.......................................................................................................................111
4.5.4 MIDDLE EAST AND AFRICA (BY COUNTRY)..........................................112
4.5.4.1 South Africa ...................................................................................................112
4.5.4.1.1 Markets .................................................................................................................. 112
4.5.4.1.1.1 Buyers Attributes ............................................................................................ 112
4.5.4.1.1.2 Key Manufacturers and Suppliers .................................................................. 112
4.5.4.1.1.3 Business Challenges ...................................................................................... 112
4.5.4.1.1.4 Business Drivers............................................................................................. 112
4.5.4.1.2 Applications............................................................................................................ 112
4.5.4.1.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ................................................................................................... 112
4.5.4.1.2.2 Key Commercial and Public Areas with Fast Charger Deployment ............... 113
4.5.4.1.3 Products ................................................................................................................. 113
4.5.4.1.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ................................................................................................... 113
13. 13
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.5.4.1.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 113
4.5.4.2 Rest-of-Middle East and Africa.......................................................................113
4.5.4.2.1 Markets .................................................................................................................. 113
4.5.4.2.1.1 Buyers Attributes ............................................................................................ 113
4.5.4.2.1.2 Key Manufacturers and Suppliers .................................................................. 114
4.5.4.2.1.3 Business Challenges ...................................................................................... 114
4.5.4.2.1.4 Business Drivers............................................................................................. 114
4.5.4.2.2 Applications............................................................................................................ 114
4.5.4.2.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ................................................................................................... 114
4.5.4.2.2.2 Key Commercial and Public Areas with Fast Charger Deployment ............... 114
4.5.4.2.3 Products ................................................................................................................. 115
4.5.4.2.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ................................................................................................... 115
4.5.4.2.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 115
4.6 CHINA .............................................................................................................117
4.6.1 Markets.......................................................................................................117
4.6.1.1 Buyers Attributes............................................................................................117
4.6.1.2 Key Manufacturers and Suppliers in China.....................................................117
4.6.1.3 Competitive Benchmarking ............................................................................117
4.6.1.4 Business Challenges......................................................................................118
4.6.1.5 Business Drivers ............................................................................................118
4.6.1.6 Pricing Analysis..............................................................................................118
4.6.2 Applications...............................................................................................119
4.6.2.1 EV Fast-Charging System Market Demand (by Application), Volume Data ....119
4.6.2.2 Key Commercial and Public Areas with Fast Charger Deployment.................119
4.6.3 Products.....................................................................................................119
4.6.3.1 EV Fast-Charging System Market (by Connector Type), Volume Data...........119
4.6.3.2 EV Fast-Charging System Market (by Charging Power; KW), Volume Data
.......................................................................................................................120
4.7 ASIA-PACIFIC AND JAPAN...........................................................................122
4.7.1 Markets.......................................................................................................122
14. 14
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.7.1.1 Buyers Attributes............................................................................................122
4.7.1.2 Key Manufacturers and Suppliers in Asia-Pacific and Japan..........................122
4.7.1.3 Competitive Benchmarking ............................................................................122
4.7.1.4 Business Challenges......................................................................................123
4.7.1.5 Business Drivers ............................................................................................123
4.7.1.6 Pricing Analysis..............................................................................................123
4.7.2 Applications...............................................................................................124
4.7.2.1 EV Fast-Charging System Market Demand (by Application), Volume Data ....124
4.7.2.2 Key Commercial and Public Areas with Fast Charger Deployment.................124
4.7.3 Products.....................................................................................................124
4.7.3.1 EV Fast-Charging System Market (by Connector Type), Volume Data...........124
4.7.3.2 EV Fast-Charging System Market (by Charging Power; KW), Volume Data
.......................................................................................................................125
4.7.4 ASIA-PACIFIC AND JAPAN (BY COUNTRY) ...........................................125
4.7.4.1 India...............................................................................................................125
4.7.4.1.1 Markets .................................................................................................................. 125
4.7.4.1.1.1 Buyers Attributes ............................................................................................ 125
4.7.4.1.1.2 Key Manufacturers and Suppliers .................................................................. 125
4.7.4.1.1.3 Business Challenges ...................................................................................... 125
4.7.4.1.1.4 Business Drivers............................................................................................. 126
4.7.4.1.2 Applications............................................................................................................ 126
4.7.4.1.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ................................................................................................... 126
4.7.4.1.2.2 Key Commercial and Public Areas with Fast Charger Deployment ............... 126
4.7.4.1.3 Products ................................................................................................................. 126
4.7.4.1.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ................................................................................................... 126
4.7.4.1.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 127
4.7.4.2 Japan.............................................................................................................127
4.7.4.2.1 Markets .................................................................................................................. 127
4.7.4.2.1.1 Buyers Attributes ............................................................................................ 127
4.7.4.2.1.2 Key Manufacturers and Suppliers .................................................................. 127
4.7.4.2.1.3 Business Challenges ...................................................................................... 127
4.7.4.2.1.4 Business Drivers............................................................................................. 127
15. 15
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.7.4.2.2 Applications............................................................................................................ 128
4.7.4.2.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ................................................................................................... 128
4.7.4.2.2.2 Key Commercial and Public Areas with Fast Charger Deployment ............... 128
4.7.4.2.3 Products ................................................................................................................. 128
4.7.4.2.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ................................................................................................... 128
4.7.4.2.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 128
4.7.4.3 South Korea...................................................................................................129
4.7.4.3.1 Markets .................................................................................................................. 129
4.7.4.3.1.1 Buyers Attributes ............................................................................................ 129
4.7.4.3.1.2 Key Manufacturers and Suppliers .................................................................. 129
4.7.4.3.1.3 Business Challenges ...................................................................................... 129
4.7.4.3.1.4 Business Drivers............................................................................................. 129
4.7.4.3.2 Applications............................................................................................................ 129
4.7.4.3.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ................................................................................................... 129
4.7.4.3.2.2 Key Commercial and Public Areas with Fast Charger Deployment ............... 130
4.7.4.3.3 Products ................................................................................................................. 130
4.7.4.3.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ................................................................................................... 130
4.7.4.3.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 130
4.7.4.4 Rest-of-Asia-Pacific and Japan ......................................................................130
4.7.4.4.1 Markets .................................................................................................................. 130
4.7.4.4.1.1 Buyers Attributes ............................................................................................ 130
4.7.4.4.1.2 Key Manufacturers and Suppliers .................................................................. 131
4.7.4.4.1.3 Business Challenges ...................................................................................... 131
4.7.4.4.1.4 Business Drivers............................................................................................. 131
4.7.4.4.2 Applications............................................................................................................ 131
4.7.4.4.2.1 Electric Vehicle Fast-Charging System Market Demand (by Application),
Volume Data ................................................................................................... 131
4.7.4.4.2.2 Key Commercial and Public Areas with Fast Charger Deployment ............... 131
4.7.4.4.3 Products ................................................................................................................. 132
4.7.4.4.3.1 Electric Vehicle Fast-Charging System Market (by Connector Type),
Volume Data ................................................................................................... 132
16. 16
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
4.7.4.4.3.2 Electric Vehicle Fast-Charging System Market (by Charging Power; KW),
Volume Data ................................................................................................... 132
5 MARKETS – Competitive Benchmarking & Company Profiles... 133
5.1 Competitive Benchmarking ..........................................................................134
5.1.1 Competitive Position Matrix .....................................................................134
5.1.2 Market Share Analysis ..............................................................................135
5.2 Company Profiles ..........................................................................................136
5.2.1 Type 1 Companies (by Region) : Key Manufacturers Globally..............136
5.2.1.1 ABB................................................................................................................136
5.2.1.1.1 Company Overview................................................................................................ 136
5.2.1.1.1.1 Product Portfolio ............................................................................................. 136
5.2.1.1.1.2 Number of Charging Stations Deployed......................................................... 137
5.2.1.1.2 Business Strategies ............................................................................................... 137
5.2.1.1.2.1 Product Developments ................................................................................... 137
5.2.1.1.2.2 Market Developments..................................................................................... 137
5.2.1.1.3 Corporate Strategies.............................................................................................. 138
5.2.1.1.3.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 138
5.2.1.1.4 Patent Analysis ...................................................................................................... 138
5.2.1.1.5 Competitive Position .............................................................................................. 138
5.2.1.1.5.1 Strengths of the Company.............................................................................. 138
5.2.1.1.5.2 Weaknesses of the Company......................................................................... 138
5.2.1.2 Blink Charging Co. .........................................................................................139
5.2.1.2.1 Company Overview................................................................................................ 139
5.2.1.2.1.1 Product Portfolio ............................................................................................. 139
5.2.1.2.1.2 Number of Charging Stations Deployed......................................................... 140
5.2.1.2.2 Corporate Strategies.............................................................................................. 140
5.2.1.2.2.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 140
5.2.1.2.3 Competitive Position .............................................................................................. 140
5.2.1.2.3.1 Strengths of the Company.............................................................................. 140
5.2.1.2.3.2 Weaknesses of the Company......................................................................... 140
5.2.1.3 BP Chargemaster Ltd.....................................................................................141
5.2.1.3.1 Company Overview................................................................................................ 141
5.2.1.3.1.1 Product Portfolio ............................................................................................. 141
5.2.1.3.1.2 Number of Charging Stations Deployed......................................................... 142
17. 17
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
5.2.1.3.2 Business Strategies ............................................................................................... 142
5.2.1.3.2.1 Product Developments ................................................................................... 142
5.2.1.3.3 Competitive Position .............................................................................................. 142
5.2.1.3.3.1 Strengths of the Company.............................................................................. 142
5.2.1.3.3.2 Weaknesses of the Company......................................................................... 142
5.2.1.4 Broadband TelCom Power, Inc. .....................................................................143
5.2.1.4.1 Company Overview................................................................................................ 143
5.2.1.4.1.1 Product Portfolio ............................................................................................. 143
5.2.1.4.1.2 Number of Charging Stations Deployed......................................................... 144
5.2.1.4.2 Corporate Strategies.............................................................................................. 144
5.2.1.4.2.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 144
5.2.1.4.3 Competitive Position .............................................................................................. 145
5.2.1.4.3.1 Strengths of the Company.............................................................................. 145
5.2.1.4.3.2 Weaknesses of the Company......................................................................... 145
5.2.1.5 ChargePoint Inc. ............................................................................................146
5.2.1.5.1 Company Overview................................................................................................ 146
5.2.1.5.1.1 Product Portfolio ............................................................................................. 146
5.2.1.5.1.2 Number of Charging Stations Deployed......................................................... 147
5.2.1.5.2 Business Strategies ............................................................................................... 147
5.2.1.5.2.1 Product Developments ................................................................................... 147
5.2.1.5.3 Corporate Strategies.............................................................................................. 147
5.2.1.5.3.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 147
5.2.1.5.4 Competitive Position .............................................................................................. 148
5.2.1.5.4.1 Strengths of the Company.............................................................................. 148
5.2.1.5.4.2 Weaknesses of the Company......................................................................... 148
5.2.1.6 Delta Electronics, Inc......................................................................................149
5.2.1.6.1 Company Overview................................................................................................ 149
5.2.1.6.1.1 Product Portfolio ............................................................................................. 149
5.2.1.6.1.2 Number of Charging Stations Deployed......................................................... 150
5.2.1.6.2 Business Strategies ............................................................................................... 150
5.2.1.6.2.1 Product Developments ................................................................................... 150
5.2.1.6.3 Corporate Strategies.............................................................................................. 150
5.2.1.6.3.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 150
5.2.1.6.4 Competitive Position .............................................................................................. 151
5.2.1.6.4.1 Strengths of the Company.............................................................................. 151
18. 18
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
5.2.1.6.4.2 Weaknesses of the Company......................................................................... 151
5.2.1.7 Efacec Electric Mobility ..................................................................................152
5.2.1.7.1 Company Overview................................................................................................ 152
5.2.1.7.1.1 Product Portfolio ............................................................................................. 152
5.2.1.7.1.2 Number of Charging Stations Deployed......................................................... 153
5.2.1.7.2 Corporate Strategies.............................................................................................. 153
5.2.1.7.2.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 153
5.2.1.7.3 Competitive Position .............................................................................................. 153
5.2.1.7.3.1 Strengths of the Company.............................................................................. 153
5.2.1.7.3.2 Weaknesses of the Company......................................................................... 154
5.2.1.8 EVBox............................................................................................................155
5.2.1.8.1 Company Overview................................................................................................ 155
5.2.1.8.1.1 Product Portfolio ............................................................................................. 155
5.2.1.8.1.2 Number of Charging Stations Deployed......................................................... 156
5.2.1.8.2 Business Strategies ............................................................................................... 156
5.2.1.8.2.1 Product Developments ................................................................................... 156
5.2.1.8.3 Corporate Strategies.............................................................................................. 156
5.2.1.8.3.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 156
5.2.1.8.4 Competitive Position .............................................................................................. 157
5.2.1.8.4.1 Strengths of the Company.............................................................................. 157
5.2.1.8.4.2 Weaknesses of the Company......................................................................... 157
5.2.1.9 Siemens.........................................................................................................158
5.2.1.9.1 Company Overview................................................................................................ 158
5.2.1.9.1.1 Product Portfolio ............................................................................................. 158
5.2.1.9.1.2 Number of Charging Stations Deployed......................................................... 159
5.2.1.9.2 Business Strategies ............................................................................................... 159
5.2.1.9.2.1 Product Developments ................................................................................... 159
5.2.1.9.3 Corporate Strategies.............................................................................................. 159
5.2.1.9.3.1 Partnerships, Joint Ventures, Collaborations & Alliances .............................. 159
5.2.1.9.4 Competitive Position .............................................................................................. 160
5.2.1.9.4.1 Strengths of the Company.............................................................................. 160
5.2.1.9.4.2 Weaknesses of the Company......................................................................... 160
5.2.1.10 Signet EV Inc. ................................................................................................161
5.2.1.10.1 Company Overview................................................................................................ 161
5.2.1.10.1.1Product Portfolio ............................................................................................. 161
19. 19
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
5.2.1.10.1.2Number of Charging Stations Deployed......................................................... 162
5.2.1.10.2 Corporate Strategies.............................................................................................. 162
5.2.1.10.2.1Partnerships, Joint Ventures, Collaborations & Alliances .............................. 162
5.2.1.10.3 Competitive Position .............................................................................................. 162
5.2.1.10.3.1Strengths of the Company.............................................................................. 162
5.2.1.10.3.2Weaknesses of the Company......................................................................... 162
5.2.1.11 Tesla, Inc. ......................................................................................................163
5.2.1.11.1 Company Overview................................................................................................ 163
5.2.1.11.1.1Product Portfolio ............................................................................................. 163
5.2.1.11.1.2Number of Charging Stations Deployed......................................................... 164
5.2.1.11.2 Business Strategies ............................................................................................... 164
5.2.1.11.2.1Product Developments ................................................................................... 164
5.2.1.11.3 Patent Analysis ...................................................................................................... 164
5.2.1.11.4 Competitive Position .............................................................................................. 164
5.2.1.11.4.1Strengths of the Company.............................................................................. 164
5.2.1.11.4.2Weaknesses of the Company......................................................................... 164
5.2.1.12 Tritium Pty Ltd................................................................................................165
5.2.1.12.1 Company Overview................................................................................................ 165
5.2.1.12.1.1Product Portfolio ............................................................................................. 165
5.2.1.12.1.2Number of Charging Stations Deployed......................................................... 166
5.2.1.12.2 Business Strategies ............................................................................................... 166
5.2.1.12.2.1Product Developments ................................................................................... 166
5.2.1.12.2.2Market Developments..................................................................................... 166
5.2.1.12.3 Corporate Strategies.............................................................................................. 166
5.2.1.12.3.1Partnerships, Joint Ventures, Collaborations & Alliances .............................. 166
5.2.1.12.4 Competitive Position .............................................................................................. 167
5.2.1.12.4.1Strengths of the Company.............................................................................. 167
5.2.1.12.4.2Weaknesses of the Company......................................................................... 167
5.2.2 Type 2 Companies (by Regions) : Key Manufacturers China................168
5.2.2.1 ShenZhen SETEC Power Co., Ltd. ................................................................168
5.2.2.1.1 Company Overview................................................................................................ 168
5.2.2.1.1.1 Product Portfolio ............................................................................................. 168
5.2.2.1.1.2 Number of Charging Stations Deployed......................................................... 169
5.2.2.1.2 Competitive Position .............................................................................................. 169
5.2.2.1.2.1 Strengths of the Company.............................................................................. 169
20. 20
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
5.2.2.1.2.2 Weaknesses of the Company......................................................................... 170
5.2.2.2 Star Charge....................................................................................................171
5.2.2.2.1 Company Overview................................................................................................ 171
5.2.2.2.1.1 Product Portfolio ............................................................................................. 171
5.2.2.2.1.2 Number of Charging Stations Deployed......................................................... 172
5.2.2.2.2 Competitive Position .............................................................................................. 172
5.2.2.2.2.1 Strengths of the Company.............................................................................. 172
5.2.2.2.2.2 Weaknesses of the Company......................................................................... 172
5.2.2.3 Xi'an TGOOD Intelligent Charging Technology Co., Ltd. ................................173
5.2.2.3.1 Company Overview................................................................................................ 173
5.2.2.3.1.1 Product Portfolio ............................................................................................. 173
5.2.2.3.1.2 Number of Charging Stations Deployed......................................................... 174
5.2.2.3.2 Patent Analysis ...................................................................................................... 174
5.2.2.3.3 Competitive Position .............................................................................................. 175
5.2.2.3.3.1 Strengths of the Company.............................................................................. 175
5.2.2.3.3.2 Weaknesses of the Company......................................................................... 175
5.3 Other Key Companies ...................................................................................176
6 RESEARCH METHODOLOGY .................................................. 177
6.1 Data Sources..................................................................................................177
6.1.1 Primary Data Sources ...............................................................................177
6.1.2 Secondary Data Sources ..........................................................................177
6.1.3 Data Triangulation.....................................................................................178
6.2 Market Estimation and Forecast...................................................................179
6.2.1 Factors for Data Prediction and Modeling ..............................................179
21. 21
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
List of Figures
Figure 1: Global EV Fast-Charging System Market (by Application Type), Thousand Units, 2019 and
2025
Figure 2: Global EV Fast-Charging System Market (by Product), Thousand Units, 2019, 2020, and 2025
Figure 3: <100 KW Power Range Fast-Charging System Expected to Witness Highest Growth during the
Forecast Period, 2020-2025
Figure 4: Global Electric Vehicle Fast-Charging System Market (by Region), Units, 2019
Figure 5: Global EV Fast-Charging System Market Coverage
Figure 6: EV Fast-Charging System Market Supply Chain
Figure 7: Stakeholders in Global EV Fast-Charging System Market
Figure 8: Smart Charging System
Figure 9: Key Competence of “Charging-As-A-Service” Offered by EV Connect
Figure 10: Business Dynamics for the Electric Vehicle Fast-Charging System Market
Figure 11: Share of Key Market Strategies and Developments (2017-2020)
Figure 12: Global Number of Public Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Figure 13: Global Number of Private Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Figure 14: Global DC Charging System (by Connector Type)
Figure 15: Electric Vehicles and DC Charging Standards
Figure 16: Electric Vehicle Fast-Charging System Opportunity Matrix (by Region), Units
Figure 17: Electric Vehicle Fast-Charging System Opportunity Matrix (by Product Type), Units
Figure 18: Competitive Benchmarking
Figure 19: Pricing Analysis (by Product Type), USD
Figure 20: Competitive Benchmarking
Figure 21: Pricing Analysis (by Product Type), USD
Figure 22: Competitive Benchmarking
Figure 23: Pricing Analysis (by Product Type), USD
Figure 24: Competitive Benchmarking
Figure 25: Pricing Analysis (by Product Type), USD
Figure 26: Competitive Benchmarking
Figure 27: Pricing Analysis (by Product Type), USD
Figure 28: Competitive Benchmarking
Figure 29: Pricing Analysis (by Product Type), USD
Figure 30: Competitive Benchmarking
Figure 31: Pricing Analysis (by Product Type), USD
Figure 32: Competitive Position Matrix
Figure 33: Data Triangulation
22. 22
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
List of Tables
Table 1: Mapping of Key Network Operators with Their Hardware Suppliers
Table 2: Government Investments (by Country), $Million
Table 3: Actions by Countries to Phase-Out ICE Vehicles and Uplift EV Numbers
Table 4: AC Charging vs. DC Charging Benefits
Table 5: Global Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 6: Maximum Charge Rate (KW) of Leading EV Models Across the World
Table 7: Global Number of Electric Vehicle Fast Chargers installed (by Connector Type), Units, 2019-
2025
Table 8: Global Number of Electric Vehicle Fast Chargers installed (by Connector Type), Units, 2019-
2025
Table 9: Global Number of Electric Vehicle Fast Chargers Installed (by Charging Power Type), Units,
2019-2025
Table 10: Global Number of Electric Vehicle Fast Chargers installed (by Region), Units, 2019-2025
Table 11: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 12: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 13: Global Number of Electric Vehicle Fast Chargers Installed (by Charging Power Type), Units,
2019-2025
Table 14: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 15: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 16: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 17: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 18: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 19: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 20: Global Number of Electric Vehicle Fast Chargers Installed (by Charging Power Type), Units,
2019-2025
Table 21: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 22: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 23: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 24: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 25: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 26: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
23. 23
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
Table 27: Global Number of Electric Vehicle Fast Chargers Installed (by Charging Power), Type, Units,
2019-2025
Table 28: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 29: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 30: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 31: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 32: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 33: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 34: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 35: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 36: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 37: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 38: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 39: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 40: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 41: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 42: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 43: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 44: Global Number of Electric Vehicle Fast Chargers Installed (by Charging Power Type), Units,
2019-2025
Table 45: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 46: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 47: Global Number of Electric Vehicle Fast Chargers Installed (by Charging Power Type), Units,
2019-2025
Table 48: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 49: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 50: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 51: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 52: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
24. 24
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
Table 53: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 54: Global Number of Electric Vehicle Fast Charger Installed (by Charging Power Type), Units,
2019-2025
Table 55: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 56: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 57: Global Number of Electric Vehicle Fast Chargers Installed (by Charging Power Type), Units,
2019-2025
Table 58: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 59: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 60: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 61: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 62: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 63: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 64: Number of Electric Vehicle Fast Chargers Installed, Units, 2019-2025
Table 65: Global Number of Electric Vehicle Fast Chargers Installed (by Connector Type), Units, 2019-
2025
Table 66: Market Share Analysis
Table 67: List of Other Key Players Present in the EV Fast-Charging System Market
25. 25
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKET
Disclaimer
BIS Research Inc. provides valuable market intelligence to an exclusive group of customers in response to
orders. The report is licensed for the customer's internal use only and is subject to restrictions set henceforth.
This document and its contents are confidential and may not be further distributed, published or reproduced,
in whole or in part, by any medium or in any form for any purpose, without the express written consent of BIS
Research Inc. Customer will not disclose the contents of the report, whether directly in any media or indirectly
through incorporation in a database, marketing list, report or otherwise, or use or permit the use of Information
to generate any statistical or other information that is or will be provided to third parties; or voluntarily produce
Information in legal proceedings.
Market reports are based on expectations, estimates and projections as of the date such information is
available. Any recommendation contained in this report may not be suitable for all investors or businesses.
The market conclusions drawn are necessarily based upon a number of estimates and assumptions that, while
considered reasonable by BIS Research Inc. as of the date of such statements, are inherently subject to
market fluctuations and business, economic and competitive uncertainties and contingencies.
For more details regarding permission, please contact us:
Email: sales@bisresearch.com
Tel: +1 510 404 8135
26. 26
All rights reserved at BIS Research Inc.
ELECTRICVEHICLEFAST-CHARGINGSYSTEMMARKETBIS RESEARCH INC.
39111 Paseo Padre PKWY, Suite 313 Fremont, CA 94538 -1686
E-mail: hello@bisresearch.com | Call Us: +1-510-404-8135
Global Delivery Center
Tower B First Floor, Tapasya Corporate Heights, Greater Noida Expressway,
Sector 126, Noida, U.P., 201303, India
Tel: +91 120 4261540 / 4261544
www.bisresearch.com