SlideShare a Scribd company logo
1 of 54
Cell
Communication
Cells need to be able to
communicate to other
cells and respond to environment
changes
*For multicellular organisms, cell-
cell communication
is important
*External signals are converted
into responses within the cell
For unicellular organisms, they need to be able to
respond to physical and chemical changes in their
Environment
Unicellular organisms can communicate and
influence one another’s behavior. Many bacteria can
respond to chemical signals that are secreted by
their neighbors and increase in concentration with
increasing population density (quorum
sensing), allowing them to coordinate their behavior,
including their mobility, antibiotic production, spore
formation, and sexual conjugation.
Yeast cells identify their mates by cell signaling
Signal Transduction Pathways
Convert signals on a
cell’s surface into cellular
response
Local and Long-Distance Signaling
• Cells in a multicellular organism communicate by
chemical messengers
• Animal and plant cells have cell junctions that directly
connect the cytoplasm of adjacent cells
• In local signaling, animal cells may communicate by
direct contact, or cell-cell recognition
Animal and Plant Cell
•In local signaling , animal cells
•May communicate via direct contact
Figure 11.3 (b) Cell-cell recognition. Two cells in an animal may communicate by interaction
between molecules protruding from their surfaces.
•In other cases , animal cells
•Communicate using local regulators
Local regulator
diffuses through
extracellular fluid
(a) Paracrine signaling. A secreting cell acts
on nearby target cells by discharging
molecules of a local regulator (a growth
factor, for example) into the extracellular
fluid.
Target cell
Secretory
vesicle
Electrical signal
along nerve cell
triggers release of
neurotransmitter
Neurotransmitter
diffuses across
synapse
Target cell
is stimulated
(b) Synaptic signaling. A nerve cell
releases neurotransmitter molecules
into a synapse, stimulating the
target cell.
Local signaling
Figure 11.4 A B
Long – Distance Signaling
Both plants and animals use hormones
Earl W. Sutherland
- Discovered how the hormones epinephrine acts on cells
- Suggested that cells receiving signals went through three processes
1. Reception
2. Transduction
3. Response
Step 1 of cell signaling: Reception
Usually, two molecules are involved:
- Ligand
- Receptor
Step two of cell signaling Transduction
Step three of cell signaling: Response
A SIGNAL MOLECULE
BINDS TO A
RECEPTOR
PROTEIN,
CAUSING IT TO
CHANGE SHAPE
Reception
• The cell targeted by a particular chemical
signal has a receptor protein on or in the
target cell that recognizes the signal
molecule
• Recognition occurs when the signal binds
to a specific site on the receptor that is the
complementary in shape to the signal.
• Ligand binding causes the receptor protein
to undergo a change in shape that may
activate the receptor so that it can interact
with other molecules
Intracellular Receptors
• Some ligands are small hydrophobic molecules
that can cross cell membranes ( Ex.
Testosterone).
• Receptors that detect such ligand are
intracellular , found in the cytosol or nucleus of
target cells.
• An activated hormone-receptor complex can act
as a transcription factor. Turning on specific
genes
Hydrophobic messengers include the steriod
and thyroid hormones
Receptors in the plasma membrane
• There are three main types of membrane
receptors
1. G-protein-linked
2. Tyrosine kinases
3. Ion channel
G- protein –linked receptors
Receptor tyrosine kinase
Ion Channel Receptors
• CASCADES OF MOLECULAR
INTERACTIONS RELAY
SIGNALS FROM THE
RECEPTORS TO TARGET
MOLECULES IN THE CELL
Transduction
• Thetransduction stageofsignalingisusuallya
multistep pathwayandthesepathwaysamplify
thesignalandprovidemoreopportunitiesfor
coordinationandregulation.
• Ifsomemoleculesinapathwaytransmitasignal
tomultiplemoleculesofthenextcomponentin
theseries,theresultcanbelargenumbersof
activatedmoleculesattheendofthepathway.
• A smallnumberofsignalmoleculescanproduce
alargecellularresponse.
Signal Transduction Pathways
• The molecules that relay a signal from
receptor to response are mostly proteins.
• Like falling dominoes, the receptor activates
another protein, which activates another, and
so on, until the protein producing the
response is activated.
• At each step, the signal is transduced into a
different form, usually a shape change in a
protein.
Protein Phosphorylation and Dephosphorylation
• In many pathways, the signal is transmitted
by a cascade of protein phosphorylation.
• Protein kinases transfer phosphates from
ATP to protein, a process called
phosphorylation (activation) .
• Protein phosphatases remove the
phosphates from proteins, a process called
dephosphorylation
(deactivation) .
 This phosphorylation and dephosphorylation
system acts as a molecular switch, turning
activities on and off or up or down, as required.
Phosphorylation cascade
Small Molecules and Ions as Second Messengers
• The extracellular signal molecule (ligand) that
binds to the receptor is a pathway’s “first
messenger”.
• Second messengers are small, nonprotein,
water-soluble molecules or ions that spread
throughout a cell by diffusion.
• Second messengers participate in pathways
initiated by GPCRs and RTKs.
• Cyclic AMP and calcium ions are common
second messengers.
Cyclic AMP
• Cyclic AMP (cAMP) is one of the most
widely used second messengers
• cAMP is made from ATP by Adenylyl
cyclase
• Adenylyl cyclase, an enzyme in the
plasma membrane, converts ATP to cAMP
in response to an extracellular signal
Adenylyl cyclase Phosphodiesterase
AMP
H2O
ATP
Pyrophosphate
P P i
cAMP
Cyclic AMP – made from ATP
Adenylyl cyclase
ATP
Pyrophosphate
P P i
cAMP
Phosphodiesterase
AMP
H2O
cAMP
2
H O
• Many signal molecules trigger formation of
cAMP
• Other components of cAMP pathways are G
proteins, G protein-coupled receptors, and
protein kinases
• cAMP usually activates protein kinase A, which
phosphorylates various other proteins
• Further regulation of cell metabolism is
provided by G-protein systems that inhibit
adenylyl cyclase
Figure 11.12
G protein
First messenger
(signaling molecule
such as epinephrine)
G protein-coupled
receptor
Adenylyl
cyclase
Second
messenger
Cellular responses
GTP
ATP
cAMP
Protein
kinase A
Calcium ions and Inositol Triphosphate (IP3)
• Calcium ions (Ca2+) act as a second messenger in
many pathways
• Calcium is an important second messenger because
cells can regulate its concentration
Inositol triphosphate and diacyglycerol
• The pathways leading to the release of
calcium involve diacylglycerol (DAG) and
inositol triphosphate (IP3) as second
messengers.
• Can trigger an increase in calcium in the
cytosol.
CELL SIGNALING LEADS TO
CYTOPLASMIC ACTIVITIES OR
TRANSCRIPTION
Response
• Ultimately, a signal-transduction pathway leads to the
regulation of one or more cellular activities.
• The response may occur in the cytoplasm or may
involve action in the nucleus.
• Many pathways regulate the activity of enzymes
Cytoplasmic and Nuclear Responses
Cytoplasmic response
• Many signaling pathways regulate the synthesis of
enzymes or other proteins, usually by turning
genes on or off in the nucleus.
• The final activated molecule in the signaling
pathway may function as a transcription
factor
Other Pathways – Nuclear response
Fine-Tuning of the Response
 Multistep pathways have two important benefits:
I. Amplifying the signal (and thus the response)
II. Contributing to the specificity of the response
Signal Amplification
 Enzyme cascades amplify the cell’s response to
signal.
 At each step, the number of activated products is
much greater than in the preceding step
The Specificity of Cell Signaling
• Different kinds of cells have different
collections of proteins
• These different proteins allow cells to detect
and respond to different signals
• Even the same signal can have different
effects in cells with different proteins and
pathways
• Pathway branching and “cross-talk” further
help the cell coordinate incoming signals.
Signaling Efficiency: Scaffolding Proteins and
Signaling Complexes
 Scaffolding proteins are large relay proteins to
which other relay proteins are attached
 Scaffolding proteins can increase the signal
transduction efficiency by grouping together
different proteins involved in the same pathway
 In some cases, scaffolding proteins may also help
activate some of the relay proteins
Termination of Signal
 Signal response is terminated quickly by reversal of
ligand binding.
 Inactivation mechanisms are an essential aspect of
cell signaling.
 Unbound receptors revert to an inactive state.
References
• Power point lectures for
Biology 7th Edition by Neil
Campbell and Jane Reece.
• Mechanisms of cell
communication.

More Related Content

Similar to Cell Communication.pptx

Chapter 11: Cell Communication
Chapter 11: Cell CommunicationChapter 11: Cell Communication
Chapter 11: Cell CommunicationAngel Vega
 
Chapter11 cellcommunication-151125145000-lva1-app6892
Chapter11 cellcommunication-151125145000-lva1-app6892Chapter11 cellcommunication-151125145000-lva1-app6892
Chapter11 cellcommunication-151125145000-lva1-app6892Cleophas Rwemera
 
Cell signaling
Cell signalingCell signaling
Cell signalingAlen Shaji
 
Lecture 3 cellsignalling
Lecture 3 cellsignallingLecture 3 cellsignalling
Lecture 3 cellsignallinganjali sinha
 
Molecular interaction, Regulation and Signalling receptors and vesicles
Molecular interaction, Regulation and Signalling receptors and vesiclesMolecular interaction, Regulation and Signalling receptors and vesicles
Molecular interaction, Regulation and Signalling receptors and vesiclesAnantha Kumar
 
Cell Signalling Pathway (intra and extra cellular signalling)
Cell Signalling Pathway (intra and extra cellular signalling)Cell Signalling Pathway (intra and extra cellular signalling)
Cell Signalling Pathway (intra and extra cellular signalling)Aneela Rafiq
 
Cell Signaling | Steps Involved | Types | Receptors | Signal Transduction | ...
Cell Signaling | Steps Involved | Types |  Receptors | Signal Transduction | ...Cell Signaling | Steps Involved | Types |  Receptors | Signal Transduction | ...
Cell Signaling | Steps Involved | Types | Receptors | Signal Transduction | ...Chetan Prakash
 
Cell communications in Cell Biology Becker's Textbook
Cell communications in Cell Biology Becker's TextbookCell communications in Cell Biology Becker's Textbook
Cell communications in Cell Biology Becker's Textbookp6315
 
Bio_Cell_Communication for grade 12 students.ppt
Bio_Cell_Communication for grade 12 students.pptBio_Cell_Communication for grade 12 students.ppt
Bio_Cell_Communication for grade 12 students.ppttaskeendaiyan
 
11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitter
11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitter11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitter
11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitterFati Naqvi
 
Cell signaling, cell biology
Cell signaling, cell biologyCell signaling, cell biology
Cell signaling, cell biologykcyaadav
 
intracellular receptors
intracellular receptorsintracellular receptors
intracellular receptorsMinalzahra
 
Cell signaling by Vidan Biology
Cell signaling by Vidan BiologyCell signaling by Vidan Biology
Cell signaling by Vidan Biologyvidan biology
 
Cell signaling Part-1
Cell signaling Part-1Cell signaling Part-1
Cell signaling Part-1vidan biology
 
_Cell Signalling .pptx
_Cell Signalling .pptx_Cell Signalling .pptx
_Cell Signalling .pptxAlisha Shaikh
 

Similar to Cell Communication.pptx (20)

Chapter 11: Cell Communication
Chapter 11: Cell CommunicationChapter 11: Cell Communication
Chapter 11: Cell Communication
 
Chapter11 cellcommunication-151125145000-lva1-app6892
Chapter11 cellcommunication-151125145000-lva1-app6892Chapter11 cellcommunication-151125145000-lva1-app6892
Chapter11 cellcommunication-151125145000-lva1-app6892
 
Cell signaling
Cell signalingCell signaling
Cell signaling
 
Cell signaling
Cell signalingCell signaling
Cell signaling
 
Lecture 3 cellsignalling
Lecture 3 cellsignallingLecture 3 cellsignalling
Lecture 3 cellsignalling
 
Molecular interaction, Regulation and Signalling receptors and vesicles
Molecular interaction, Regulation and Signalling receptors and vesiclesMolecular interaction, Regulation and Signalling receptors and vesicles
Molecular interaction, Regulation and Signalling receptors and vesicles
 
Cell Signalling Pathway (intra and extra cellular signalling)
Cell Signalling Pathway (intra and extra cellular signalling)Cell Signalling Pathway (intra and extra cellular signalling)
Cell Signalling Pathway (intra and extra cellular signalling)
 
Cell Signaling | Steps Involved | Types | Receptors | Signal Transduction | ...
Cell Signaling | Steps Involved | Types |  Receptors | Signal Transduction | ...Cell Signaling | Steps Involved | Types |  Receptors | Signal Transduction | ...
Cell Signaling | Steps Involved | Types | Receptors | Signal Transduction | ...
 
Cell communications in Cell Biology Becker's Textbook
Cell communications in Cell Biology Becker's TextbookCell communications in Cell Biology Becker's Textbook
Cell communications in Cell Biology Becker's Textbook
 
Bio_Cell_Communication for grade 12 students.ppt
Bio_Cell_Communication for grade 12 students.pptBio_Cell_Communication for grade 12 students.ppt
Bio_Cell_Communication for grade 12 students.ppt
 
Introduction to cell signalling
Introduction to cell signallingIntroduction to cell signalling
Introduction to cell signalling
 
11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitter
11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitter11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitter
11.16 (dr. surriya sheikh) cell signalling 1 1 neurotransmitter
 
Cell signalling
Cell signalling Cell signalling
Cell signalling
 
Signal Transduction
Signal TransductionSignal Transduction
Signal Transduction
 
Cell signaling, cell biology
Cell signaling, cell biologyCell signaling, cell biology
Cell signaling, cell biology
 
intracellular receptors
intracellular receptorsintracellular receptors
intracellular receptors
 
Cell signaling by Vidan Biology
Cell signaling by Vidan BiologyCell signaling by Vidan Biology
Cell signaling by Vidan Biology
 
Cell signaling Part-1
Cell signaling Part-1Cell signaling Part-1
Cell signaling Part-1
 
Cell signaLling
Cell signaLling Cell signaLling
Cell signaLling
 
_Cell Signalling .pptx
_Cell Signalling .pptx_Cell Signalling .pptx
_Cell Signalling .pptx
 

More from drn00r

Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...
Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...
Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...drn00r
 
common geriatric conditions overview.ppt
common geriatric conditions overview.pptcommon geriatric conditions overview.ppt
common geriatric conditions overview.pptdrn00r
 
Endocrine Disorders and diseases ppt.pptx
Endocrine Disorders and diseases ppt.pptxEndocrine Disorders and diseases ppt.pptx
Endocrine Disorders and diseases ppt.pptxdrn00r
 
Overview of Epilepsy and types of seizures.ppt
Overview of Epilepsy and types of seizures.pptOverview of Epilepsy and types of seizures.ppt
Overview of Epilepsy and types of seizures.pptdrn00r
 
Human nervous system for allied health students.ppt
Human nervous system for allied health students.pptHuman nervous system for allied health students.ppt
Human nervous system for allied health students.pptdrn00r
 
Cell membrane and Transport.pptx
Cell membrane and Transport.pptxCell membrane and Transport.pptx
Cell membrane and Transport.pptxdrn00r
 
cell physiology.pptx
cell physiology.pptxcell physiology.pptx
cell physiology.pptxdrn00r
 
Cell membrane structure an function.pptx
Cell membrane structure an function.pptxCell membrane structure an function.pptx
Cell membrane structure an function.pptxdrn00r
 
Homeostasis.pptx
Homeostasis.pptxHomeostasis.pptx
Homeostasis.pptxdrn00r
 
Muscle Contraction I.ppt
Muscle Contraction I.pptMuscle Contraction I.ppt
Muscle Contraction I.pptdrn00r
 
LecturePearson GIT.pptx
LecturePearson GIT.pptxLecturePearson GIT.pptx
LecturePearson GIT.pptxdrn00r
 
Cardiovascular System Marieb.ppt
Cardiovascular System Marieb.pptCardiovascular System Marieb.ppt
Cardiovascular System Marieb.pptdrn00r
 
acid_base in Practice.ppt
acid_base in Practice.pptacid_base in Practice.ppt
acid_base in Practice.pptdrn00r
 
Acid and Base.ppt
Acid and Base.pptAcid and Base.ppt
Acid and Base.pptdrn00r
 
Blood Part 1.pptx
Blood Part 1.pptxBlood Part 1.pptx
Blood Part 1.pptxdrn00r
 
Blood components Plasma.ppt
Blood components Plasma.pptBlood components Plasma.ppt
Blood components Plasma.pptdrn00r
 

More from drn00r (16)

Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...
Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...
Coronary Heart Disease, Myocardial Infarction, and Heart Failure, A Review of...
 
common geriatric conditions overview.ppt
common geriatric conditions overview.pptcommon geriatric conditions overview.ppt
common geriatric conditions overview.ppt
 
Endocrine Disorders and diseases ppt.pptx
Endocrine Disorders and diseases ppt.pptxEndocrine Disorders and diseases ppt.pptx
Endocrine Disorders and diseases ppt.pptx
 
Overview of Epilepsy and types of seizures.ppt
Overview of Epilepsy and types of seizures.pptOverview of Epilepsy and types of seizures.ppt
Overview of Epilepsy and types of seizures.ppt
 
Human nervous system for allied health students.ppt
Human nervous system for allied health students.pptHuman nervous system for allied health students.ppt
Human nervous system for allied health students.ppt
 
Cell membrane and Transport.pptx
Cell membrane and Transport.pptxCell membrane and Transport.pptx
Cell membrane and Transport.pptx
 
cell physiology.pptx
cell physiology.pptxcell physiology.pptx
cell physiology.pptx
 
Cell membrane structure an function.pptx
Cell membrane structure an function.pptxCell membrane structure an function.pptx
Cell membrane structure an function.pptx
 
Homeostasis.pptx
Homeostasis.pptxHomeostasis.pptx
Homeostasis.pptx
 
Muscle Contraction I.ppt
Muscle Contraction I.pptMuscle Contraction I.ppt
Muscle Contraction I.ppt
 
LecturePearson GIT.pptx
LecturePearson GIT.pptxLecturePearson GIT.pptx
LecturePearson GIT.pptx
 
Cardiovascular System Marieb.ppt
Cardiovascular System Marieb.pptCardiovascular System Marieb.ppt
Cardiovascular System Marieb.ppt
 
acid_base in Practice.ppt
acid_base in Practice.pptacid_base in Practice.ppt
acid_base in Practice.ppt
 
Acid and Base.ppt
Acid and Base.pptAcid and Base.ppt
Acid and Base.ppt
 
Blood Part 1.pptx
Blood Part 1.pptxBlood Part 1.pptx
Blood Part 1.pptx
 
Blood components Plasma.ppt
Blood components Plasma.pptBlood components Plasma.ppt
Blood components Plasma.ppt
 

Recently uploaded

Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls AvailableVip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls AvailableNehru place Escorts
 
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...Nehru place Escorts
 
Call Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls Service
Call Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls ServiceCall Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls Service
Call Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls Servicenarwatsonia7
 
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Miss joya
 
VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...
VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...
VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...Miss joya
 
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls ServiceKesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Servicemakika9823
 
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service JaipurHigh Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipurparulsinha
 
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...narwatsonia7
 
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original PhotosCall Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photosnarwatsonia7
 
Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...
Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...
Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...Miss joya
 
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls ServiceMiss joya
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...CALL GIRLS
 
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...Miss joya
 
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.MiadAlsulami
 
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service CoimbatoreCall Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatorenarwatsonia7
 
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore EscortsCall Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escortsvidya singh
 
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls ServiceMiss joya
 
Call Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service ChennaiCall Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service ChennaiNehru place Escorts
 
Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...
Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...
Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...Miss joya
 
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service BangaloreCall Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalorenarwatsonia7
 

Recently uploaded (20)

Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls AvailableVip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
 
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
 
Call Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls Service
Call Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls ServiceCall Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls Service
Call Girls Service Bellary Road Just Call 7001305949 Enjoy College Girls Service
 
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
 
VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...
VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...
VIP Call Girls Pune Vani 9907093804 Short 1500 Night 6000 Best call girls Ser...
 
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls ServiceKesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
 
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service JaipurHigh Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
 
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
Russian Call Girl Brookfield - 7001305949 Escorts Service 50% Off with Cash O...
 
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original PhotosCall Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
 
Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...
Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...
Russian Call Girls in Pune Tanvi 9907093804 Short 1500 Night 6000 Best call g...
 
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls Service
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
 
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
 
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
 
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service CoimbatoreCall Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatore
 
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore EscortsCall Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
Call Girls Horamavu WhatsApp Number 7001035870 Meeting With Bangalore Escorts
 
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls Service
 
Call Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service ChennaiCall Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
 
Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...
Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...
Call Girls Service Pune Vaishnavi 9907093804 Short 1500 Night 6000 Best call ...
 
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service BangaloreCall Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
 

Cell Communication.pptx

  • 2. Cells need to be able to communicate to other cells and respond to environment changes *For multicellular organisms, cell- cell communication is important *External signals are converted into responses within the cell
  • 3. For unicellular organisms, they need to be able to respond to physical and chemical changes in their Environment Unicellular organisms can communicate and influence one another’s behavior. Many bacteria can respond to chemical signals that are secreted by their neighbors and increase in concentration with increasing population density (quorum sensing), allowing them to coordinate their behavior, including their mobility, antibiotic production, spore formation, and sexual conjugation.
  • 4.
  • 5.
  • 6. Yeast cells identify their mates by cell signaling
  • 7. Signal Transduction Pathways Convert signals on a cell’s surface into cellular response
  • 8. Local and Long-Distance Signaling • Cells in a multicellular organism communicate by chemical messengers • Animal and plant cells have cell junctions that directly connect the cytoplasm of adjacent cells • In local signaling, animal cells may communicate by direct contact, or cell-cell recognition
  • 10. •In local signaling , animal cells •May communicate via direct contact Figure 11.3 (b) Cell-cell recognition. Two cells in an animal may communicate by interaction between molecules protruding from their surfaces.
  • 11. •In other cases , animal cells •Communicate using local regulators Local regulator diffuses through extracellular fluid (a) Paracrine signaling. A secreting cell acts on nearby target cells by discharging molecules of a local regulator (a growth factor, for example) into the extracellular fluid. Target cell Secretory vesicle Electrical signal along nerve cell triggers release of neurotransmitter Neurotransmitter diffuses across synapse Target cell is stimulated (b) Synaptic signaling. A nerve cell releases neurotransmitter molecules into a synapse, stimulating the target cell. Local signaling Figure 11.4 A B
  • 12. Long – Distance Signaling Both plants and animals use hormones
  • 13. Earl W. Sutherland - Discovered how the hormones epinephrine acts on cells - Suggested that cells receiving signals went through three processes 1. Reception 2. Transduction 3. Response
  • 14. Step 1 of cell signaling: Reception Usually, two molecules are involved: - Ligand - Receptor
  • 15. Step two of cell signaling Transduction
  • 16. Step three of cell signaling: Response
  • 17. A SIGNAL MOLECULE BINDS TO A RECEPTOR PROTEIN, CAUSING IT TO CHANGE SHAPE Reception
  • 18. • The cell targeted by a particular chemical signal has a receptor protein on or in the target cell that recognizes the signal molecule • Recognition occurs when the signal binds to a specific site on the receptor that is the complementary in shape to the signal. • Ligand binding causes the receptor protein to undergo a change in shape that may activate the receptor so that it can interact with other molecules
  • 19. Intracellular Receptors • Some ligands are small hydrophobic molecules that can cross cell membranes ( Ex. Testosterone). • Receptors that detect such ligand are intracellular , found in the cytosol or nucleus of target cells. • An activated hormone-receptor complex can act as a transcription factor. Turning on specific genes
  • 20. Hydrophobic messengers include the steriod and thyroid hormones
  • 21. Receptors in the plasma membrane • There are three main types of membrane receptors 1. G-protein-linked 2. Tyrosine kinases 3. Ion channel
  • 22. G- protein –linked receptors
  • 25. • CASCADES OF MOLECULAR INTERACTIONS RELAY SIGNALS FROM THE RECEPTORS TO TARGET MOLECULES IN THE CELL Transduction
  • 26. • Thetransduction stageofsignalingisusuallya multistep pathwayandthesepathwaysamplify thesignalandprovidemoreopportunitiesfor coordinationandregulation. • Ifsomemoleculesinapathwaytransmitasignal tomultiplemoleculesofthenextcomponentin theseries,theresultcanbelargenumbersof activatedmoleculesattheendofthepathway. • A smallnumberofsignalmoleculescanproduce alargecellularresponse.
  • 27. Signal Transduction Pathways • The molecules that relay a signal from receptor to response are mostly proteins. • Like falling dominoes, the receptor activates another protein, which activates another, and so on, until the protein producing the response is activated. • At each step, the signal is transduced into a different form, usually a shape change in a protein.
  • 28. Protein Phosphorylation and Dephosphorylation • In many pathways, the signal is transmitted by a cascade of protein phosphorylation. • Protein kinases transfer phosphates from ATP to protein, a process called phosphorylation (activation) . • Protein phosphatases remove the phosphates from proteins, a process called dephosphorylation (deactivation) .
  • 29.  This phosphorylation and dephosphorylation system acts as a molecular switch, turning activities on and off or up or down, as required.
  • 31. Small Molecules and Ions as Second Messengers • The extracellular signal molecule (ligand) that binds to the receptor is a pathway’s “first messenger”. • Second messengers are small, nonprotein, water-soluble molecules or ions that spread throughout a cell by diffusion. • Second messengers participate in pathways initiated by GPCRs and RTKs. • Cyclic AMP and calcium ions are common second messengers.
  • 32. Cyclic AMP • Cyclic AMP (cAMP) is one of the most widely used second messengers • cAMP is made from ATP by Adenylyl cyclase • Adenylyl cyclase, an enzyme in the plasma membrane, converts ATP to cAMP in response to an extracellular signal
  • 33. Adenylyl cyclase Phosphodiesterase AMP H2O ATP Pyrophosphate P P i cAMP Cyclic AMP – made from ATP
  • 36. • Many signal molecules trigger formation of cAMP • Other components of cAMP pathways are G proteins, G protein-coupled receptors, and protein kinases • cAMP usually activates protein kinase A, which phosphorylates various other proteins • Further regulation of cell metabolism is provided by G-protein systems that inhibit adenylyl cyclase
  • 37. Figure 11.12 G protein First messenger (signaling molecule such as epinephrine) G protein-coupled receptor Adenylyl cyclase Second messenger Cellular responses GTP ATP cAMP Protein kinase A
  • 38. Calcium ions and Inositol Triphosphate (IP3) • Calcium ions (Ca2+) act as a second messenger in many pathways • Calcium is an important second messenger because cells can regulate its concentration
  • 39. Inositol triphosphate and diacyglycerol • The pathways leading to the release of calcium involve diacylglycerol (DAG) and inositol triphosphate (IP3) as second messengers. • Can trigger an increase in calcium in the cytosol.
  • 40.
  • 41. CELL SIGNALING LEADS TO CYTOPLASMIC ACTIVITIES OR TRANSCRIPTION Response
  • 42. • Ultimately, a signal-transduction pathway leads to the regulation of one or more cellular activities. • The response may occur in the cytoplasm or may involve action in the nucleus. • Many pathways regulate the activity of enzymes Cytoplasmic and Nuclear Responses
  • 44. • Many signaling pathways regulate the synthesis of enzymes or other proteins, usually by turning genes on or off in the nucleus. • The final activated molecule in the signaling pathway may function as a transcription factor Other Pathways – Nuclear response
  • 45.
  • 46. Fine-Tuning of the Response  Multistep pathways have two important benefits: I. Amplifying the signal (and thus the response) II. Contributing to the specificity of the response
  • 47. Signal Amplification  Enzyme cascades amplify the cell’s response to signal.  At each step, the number of activated products is much greater than in the preceding step
  • 48. The Specificity of Cell Signaling • Different kinds of cells have different collections of proteins • These different proteins allow cells to detect and respond to different signals • Even the same signal can have different effects in cells with different proteins and pathways • Pathway branching and “cross-talk” further help the cell coordinate incoming signals.
  • 49.
  • 50. Signaling Efficiency: Scaffolding Proteins and Signaling Complexes  Scaffolding proteins are large relay proteins to which other relay proteins are attached  Scaffolding proteins can increase the signal transduction efficiency by grouping together different proteins involved in the same pathway  In some cases, scaffolding proteins may also help activate some of the relay proteins
  • 51.
  • 52. Termination of Signal  Signal response is terminated quickly by reversal of ligand binding.  Inactivation mechanisms are an essential aspect of cell signaling.  Unbound receptors revert to an inactive state.
  • 53.
  • 54. References • Power point lectures for Biology 7th Edition by Neil Campbell and Jane Reece. • Mechanisms of cell communication.