![20?BD;4
8C1?8=3D2CB!F4=
55824AB8=210C
dbb^^aXT) CWT8]SXP2WX]P
;02VdPaSX]V8]S^CXQTcP]
1^aSTa?^[XRTU^aRT^]Bd]SPh
R^XbbX^]TSXcbUXabccf^
f^T]^UUXRTabU^aR^QPcPUcTa
cWThR^_[TcTScWTXacaPX]X]V
7?45D;8C?0=4;F8;;
C0:4D??460BDB)B70B78
=Tf3T[WX) 2WPXaP]^UcWT
?Pa[XPT]cPah_P]T[^]
X]U^aPcX^]cTRW]^[^VhBWPbWX
CWPa^^a^]Bd]SPhbPXS19?
TQTabSXbad_cTScWT
R^XccTT³bTTcX]V^]9d[h!'
PbcWThSXS]^cfP]ccWT
?TVPbdbP[[TVPcX^]bc^QT
SXbRdbbTSP]ScWT^UUXRXP[bfW^
fTaTc^cTbcXUh°P__TPac^WPeT
QTT]X]bcadRcTS]^cc^PccT]S±
34;78CC0:4 A4HA
CE0228=0C48CB03D;CB
=Tf3T[WX) 8cfX[[cPZTP]^cWTa
hTPac^ePRRX]PcTP[[T[XVXQ[T
QT]TUXRXPaXTbPVTSPQ^eT 'X]
cWT]PcX^]P[2P_XcP[Pc°cWT
_aTbT]caPcT^U2^eXS (ePRRX]T
bd__[h±cWTWTP[cWST_PacT]c
WPbc^[ScWT330
?=BQ =4F34;78
ADelhi-London economy
class air ticket priced at C4
lakh! Yes, that is the price tag
for a Delhi-London British
Airways flight for August 26.
Following an outcry over the
exorbitant hike in airfares by
airlines after the United
Kingdom (UK) allowed Indian
travelers to enter the country,
with certain conditions from
Sunday, the Directorate-
General of Civil Aviation
(DGCA) has asked airlines to
submit details of fares, they
have been charging for India-
UK flights in August.
A round trip between New
Delhi and London by Air India
in general cost somewhere
between C55,000 to C70,000,
but the prices skyrocketed just
before August 8, the day the
UK moved India from the
‘Red List’ to the ‘Amber List’,
thus allowing Indian travellers
to visit London.
On Saturday, Sanjeev
Gupta, Secretary, Inter-State
Council Secretariat, Union
Home Ministry, had com-
plained on Twitter that an
economy class ticket on British
Airways’ Delhi-London flight
for August 26 was priced at
C3.95 lakh. He added that the
economy class ticket on the
Delhi-London flights of Vistara
and Air India for August 26
was also priced between C1.2
lakh and C2.3 lakh amid the
rush for college admissions in
the UK. The relaxation from
UK, too, has come at the time
when huge traffic is expected
on the Delhi-London route
because of the admissions.
Officials of the DGCA said
that it has asked the airlines that
operate India-UK flights cur-
rently to submit details about
their fares.
According to officials, the
data collected by the DGCA on
Sunday shows the minimum
one-way economy class fares
on the Delhi-London nonstop
flights during August. The
fares range from C1,03,191 to
C1,21,356 for Vistara and
C1,28,916 to C1,47,544 for
British Airways on different
days this month. For Air India
and Virgin Atlantic the mini-
mum fare this month is
C1,15,936 and C1,28,916,
respectively.
Vistara, which currently
operates flights on the Delhi-
London as well as the Mumbai-
London route, said on Sunday:
“Pricing is always a function of
supply and demand. There are
only 15 flights a week allowed
currently on the India-UK
route for Indian carriers and
when there is relaxation and
more capacity allowed, it will
automatically bring down
prices.”
While there have been
lower and upper limits on all
domestic airfares in India since
May 25 last year, no such lim-
its have been imposed on inter-
national airfares.
?=BQ =4F34;78
The Indian Council of
Medical Research (ICMR)
has said that a study on mixing
and matching of two Covid-19
vaccines — Covaxin and
Covishield — showed better
immunogenicity than two
doses of the same vaccine.
The study was conducted
on 18 people of Uttar Pradesh’s
Siddharth Nagar who mistak-
enly received doses of two sep-
arate vaccines a few months
ago.
The finding of the study,
which has been uploaded on
medRxiv, but is yet to be peer-
reviewed showed that immu-
nisation with a combination of
an adenovirus vector platform-
based vaccine, followed by
inactivated whole virus vaccine,
was not only safe but also
delivered better immuno-
genicity.
Covishield, manufactured
by Pune’s Serum Institute of
India, is the adenovirus vector
platform-based vaccine, while
Covaxin, developed and man-
ufactured by Bharat Biotech
and the ICMR, is the whole
virus vaccine.
The subject expert com-
mittee of the Central Drugs
Standard Control Organisation
had in July recommended a
trial of mixing Covishield and
Covaxin. The trial will be con-
ducted by the Christian
Medical College in Vellore on
300 healthy volunteers.
While that will be a prop-
er clinical trial to investigate
the effectiveness of the cocktail
of Covishield and Covaxin, the
ICMR’s study titled
‘Serendipitous Covid-19
Vaccine-Mix in Uttar Pradesh,
India: Safety and
Immunogenicity Assessment
of a Heterologous Regime’ was
based on the goof-up that
took place in May. There was
no immediate adverse impact
of the mix-up on the benefi-
ciaries.
Now, a further study has
revealed that the mix-up has
actually worked in their favour
as the beneficiaries have more
protection than those who
have received two shots of the
same vaccine.
“Though India so far has
followed homologous
approaches (two doses of one
vaccine) with Covishield and
Covaxin, eighteen individuals,
under the national programme,
inadvertently received
Covishield as the first jab and
Covaxin as the second,” it said.
“To the best of our knowl-
edge, this is the first study
which reports the effects of het-
erologous prime-boost vacci-
nation with an adenovirus vec-
tored vaccine followed by an
inactivated whole virus vac-
cine,” the researchers said.
The researchers compared
the safety and immunogenici-
ty profile of those people who
received two doses of different
vaccines, against that of indi-
viduals receiving either
Covishield or Covaxin.
?=BQ =4F34;78
The CBI has arrested two
more persons in an on-
going investigation of a case
relating to making derogatory
posts on social media against
judges and the judiciary.
The two arrested accused,
Pattapu Aadarsh and Lavanuru
Samba Siva Reddy, will be pro-
duced before the Competent
Court, Guntur, Andhra
Pradesh, officials said.
Earlier on July 28, the
agency had arrested two
accused — Dhami Reddy
Konda Reddy (currently in
judicial custody) and Pamula
Sudheer (currently in police
custody till August 10).
The first arrest in the case
was made by the CBI on July 9.
The accused Lingareddy
Rajasekhar Reddy, earlier
working in Kuwait, was also
remanded to judicial custody
by the court.
Till now, five people have
been arrested by CBI in the
case. The CBI had registered a
case on November 11 last year
against 16 people and took over
the investigation of 12 FIRs
from the CID, of Andhra
Pradesh. The cases were taken
over by the CBI in pursuance
of the orders of the Andhra
Pradesh High Court in
response to a writ petition.
The original FIRs were
registered on the complaints
from the Registrar General of
the Andhra Pradesh High
Court. The cases were regis-
tered under various sections of
the Indian Penal Code relating
to promoting enmity between
various groups on grounds of
religion, intentional insult and
criminal intimidation besides
relevant provisions of the
Information Technology Act.
A094B7:D0AQ =4F34;78
From pizzas to free air trav-
el, rewards are raining on
the Indian athletes who won
medals for the country at the
Tokyo Olympics. As a token of
appreciation, Go First, previ-
ously known as GoAir, on
Sunday announced free travel
for all six Indian athletes and
the men’s hockey team who
won medals at the Tokyo
Olympics.
Bengaluru-based regional
carrier Star Air, which connects
13 cities in India, offered the
medal winners a lifetime of free
travel. IndiGo airlines had
announced on Saturday that it
would offer unlimited free air
travel to javelin thrower Neeraj
Chopra, who won the only
gold medal for India, for one
year.
5XaTf^aZbPccWTbcPSXdSdaX]VcWTR[^bX]VRTaT^]h^UcWT!!C^Zh^[h_XRb^]Bd]SPhX]C^Zh^ 0?
?=BQ =4F34;78
The National Investigation
Agency (NIA) on Sunday
conducted searches at multiple
locations in 14 districts of
Jammu Kashmir (JK) in
connection with the Jamaat-e-
Islami (JeI) terror funding
case.
The searches were con-
ducted in conjunction with the
Jammu Kashmir Police and
the Central Reserve Police
Force (CRPF) at 56 locations in
Srinagar, Budgam, Ganderbal,
Baramulla, Kupwara,
Bandipora, Anantnag,
Shopian, Pulwama, Kulgam,
Ramban, Doda, Kishtwar and
Rajouri districts of the Valley.
The agency conducted the
searches at the premises of
office-bearers of the banned
association, its members and
also offices of trusts purport-
edly run by the JeI. During the
searches, various incriminating
documents and electronic
devices were seized from the
premises of the suspects. The
case was registered by the NIA
on February 5 this year fol-
lowing an order from the
Union Home Ministry relating
to separatist and secessionist
activities of the JeI, under the
Unlawful Activities
(Prevention) Act, even after its
proscription on February 28,
2019, the agency said. “The
members of the organisation
have been collecting funds
domestically and abroad
through donations particular-
ly in the form of Zakat.
5842deVadZ_e`T]Za
eYVhZ_Xd`WRZc]Z_Vd
$VSULFHVRI
,QGLD8.
WLFNHWVWRXFK
WKHVNLHV
µRYLGYD[FRPER
JLYHVPRUHSURWHFWLRQ¶
ZiZ_X4`gRiZ_
4`gZdYZV]U[RSd
cVdf]edZ_SVeeVc
Z^^f_`XV_ZTZej
dRjd:4C
?:2cRZUd'
a]RTVdZ_;
Z_;V:eVcc`c
Wf_UZ_XTRdV
0cW[TcTbUa^8]SXPcPZTPbT[UXTSdaX]VcWTR[^bX]VRTaT^]hX]cWT[h_XR
BcPSXdPccWT!!BdTa[h_XRb^]Bd]SPhX]C^Zh^ ?C8
652=E2==J
DB0 ( #
DB0 ' ! '
9P_P] ! #
61aXcPX] !! ! !!
A2 ! !' !
0dbcaP[XP !!
=TcWTa[P]Sb ! #
5aP]RT !
6TaP]h %
8cP[h !
8]SXP ! #
2^d]cah 6 B 1
!WT[SU^aPZX]VSTa^VPc^ah
_^bcbPVPX]bcYdSVTbYdSXRXPah
ATfPaSbaPX]^]8]SXP´b[h_XP]b
7c`^ aZkkRd e`
WcVVRZcecRgV]
hZ__VcdXVeZeR]]
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $ 8bbdT !
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D==30H0D6DBC (!! *?064B !C!
DA@CE#
=44A09C0A64CB
(C7AF=F
m
m
H@C=5)
58ABC%=C7B5!!
05B1;384BCB8=24!(
45978D54D?
25?=91D54*
B1C9;14E71
! F9F139DI
@A:?:@?'
8=3800CC74;H?82B
E4AC74342034B](https://image.slidesharecdn.com/pioneer-dehradun-english-edition-2021-08-09-210809021924/85/Pioneer-dehradun-english-edition-2021-08-09-1-320.jpg)
![]PcX^]!
347A03D=k=30H k0D6DBC (!!
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO
$UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH
RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ B78;0
Himachal Chief Minister Jai
Ram Thakur on Sunday
said that the State
Government is committed to
strengthen the panchayati raj
institutions in the state.
The Chief Minister was
addressing the Swaran Jayanti
Panch Parmeshwar Gram
Swaraj Sammelan at
Jogindernagar in Mandi dis-
trict.
Thakur performed inau-
gurations and foundation
stones laying ceremonies of
developmental projects worth
Rs 110 crore at Chauntra in
Jogindernagar Vidhan Sabha
area. He said that this shows
that the pace of development
has been expedited during
the last three and a half years.
The developmental projects
worth crores of rupees were
being implemented in
Jogindernagar constituency.
Despite the COVID-19
pandemic, the State
Government ensured that the
pace of development goes
uninterrupted for which he
laid foundation stones and
inaugurated developmental
projects worth Rs 4000 crore
in about 42 Vidhan Sabha
areas of the State virtually
from Shimla, he said.
The Chief Minister fur-
ther said that the government
would provide all possible
help to ensure that the elect-
ed representatives of PRIs
could function smoothly.
He also urged the elected
members of PRIs to identify
beneficiaries of various wel-
fare schemes launched by the
State Government so that the
benefits of the development
could reach the people living
at the lowest ebb.
Thakur said that the State
Government is providing old
age pensions to over 5 lakh old
age persons in the State.
Almost 3.17 lakh free gas
connections were provided in
the State under the Himachal
Grihini Suvidha Yojna, he
said.
+30GHGLFDWHV
SURMHFWVZRUWKC
FURUHLQ-RJLQGHUQDJDU
=8B7D07090=Q
270=3860A7
As a young athlete Neeraj
Chopra on August 7 hurled
a 800g javelin high and pow-
erfully into the sky, it came
gliding down at a distance of
87.58 m sending 1.3 billion
people into a frenzy and end-
ing the country's wait for over
a century for an Olympic gold
medal in athletics.
Not only did Chopra's (23)
historic feat resulted in India
ending the Tokyo Olympics
2020 on a golden note sur-
passing the 2012 London
Olympics best haul of six
medals but the northern state
of Haryana also scripted anoth-
er Olympics success story.
While India got its
National Anthem moment
with Chopra's top podium fin-
ish, there were two more occa-
sions where Haryana's players
got to the podium and the
Tricolour fluttered with pride
at the Olympics. The country
racked up its best-ever Olympic
medal haul of seven, out of
which three individual medal
winners and two players in
India's men hockey team
belonged to Haryana, known as
a traditional powerhouse in
sports like kabaddi, boxing
and wrestling.
Despite having only two
percent of the country's popu-
lation, 30 sportspersons (about
25 percent) from Haryana
were part of the biggest ever
Indian contingent of 127 at
Olympics this time.
As we look back at the stel-
lar performance of our
sportspersons at the Tokyo
Olympics, the old adage “Sports
run in Haryanvis blood” clear-
ly holds sway.
Ecstatic scenes were wit-
nessed at Chopra's native
Khandra village in Haryana's
Panipat district and the entire
country on August 7 as the
javelin thrower made history in
his Olympic debut becoming
India’s first track and field
medalist, and only the second
individual gold medalist after
Abhinav Bindra’s shooting gold
for India in the 2008 Olympic
Games.
Beginning his journey
from Haryana’s training
grounds, Chopra, an Army
Subedar first came into the
limelight with a stunning gold
medal at the 2016 Junior World
Championships in Poland and
later made strides with gold
medals at the Commonwealth
Games and Asian Games in
2018.
Alongwith Neeraj Chopra,
who has become an overnight
sensation, Haryana's wrestlers
namely Ravi Kumar Dahiya
with his silver medal, Bajrang
Punia with bronze and Indian
men's hockey team players
Surender Kumar and Sumit
Kumar ensured Haryana's
domination at the biggest
sporting event as the nation of
a billion-plus waited for
Olympic medals with bated
breath.
In his Olympic debut, the
Haryanvi lad Ravi Dahiya (23)
ensured that his name is writ-
ten in bold letters in the annals
of Indian sporting history. A
resident of Nahri village in
Sonipat district, Dahiya
became the second Indian
wrestler after Sushil Kumar to
have won an Olympic silver
medal.
Dahiya's native village
Nahri is also home to two other
Olympians Mahavir Singh
(1980 Moscow) and Amit
Kumar Dahiya (2012 London).
Perhaps, this prompted the
Chief Minister Manohar Lal
Khattar to immediately
announce the construction of
a Wrestling Indoor Stadium
with modern world class facil-
ities at village Nahri to encour-
age more youth to take up the
sports.
Another wrestler from the
state, Bajrang Punia (27), who
hails from Khudan village in
Jhajjar district, clinched a
bronze medal on the penulti-
mate day of Olympics. In the
past, Punia has made the coun-
try and the state proud at the
Commonwealth Games and
Asian Games.
Interestingly, all three indi-
vidual Olympic medal winners
from Haryana belong to the
family of farmers.
Two hockey players from
Haryana, Surender Kumar and
Sumit Kumar also brought lau-
rels to the country and the state
as a resolute Indian men's
hockey team managed to
rewrite history clinching the
bronze medal at Olympics after
41-year-long wait.
Not only this, nine women
from Haryana were part of
Indian women's hockey team
that had put in a spirited per-
formance finishing fourth at
the Olympics. Blockbuster
movie Dangal’s gender-
nuanced rhetoric ‘Mhari
chhoriyan chhoron se kam
Hain ke’ could never sound so
truthful as out of Haryana's 30
sportspersons at Olympics this
time, 17 were women.
The Olympic feat is now
new for Haryana, which is
known as a centre of passion
for sports with events especially
wrestling being organized reg-
ularly in rural areas.
Till now, Indian individu-
als have won 23 medals in the
Olympics. These winners are
various states, with Haryana
accounting for highest seven –
Neeraj Chopra (Gold), Ravi
Dahiya (Silver), boxer Vijender
Singh (Bronze), Badminton
player Saina Nehwal (Bronze),
wrestler Yogeshwar Dutt
(Bronze), wrestler Sakshi Malik
(Bronze), Bajrang Punia
(Bronze), all won after the
year 2008.
As the celebration with
sweets, traditional dance and
fireworks continues across the
state over the achievements of
sons of soil at Olympics, it's like
déjà vu all over again in
Haryana.
Three years back also,
Haryana celebrated more than
anyone else in the country
when the Indian contingent
had returned from the Gold
Coast Commonwealth Games
2018 with an impressive tally
of 66 medals, including 26
gold. The state's sportsper-
sons, known for their physical
resilience, had won a total of
22 medals including nine gold,
six silver and seven bronze.
Also, the state, notorious
for female foeticide, has seen
sportswomen taking giant
strides and setting new bench-
marks over the past few
decades. Considerable number
of sportswomen, such as the
Phogat sisters, Sakshi Malik,
Manu Bhaker, Deepa Malik
among others have not only
won laurels at international
sporting events but also broken
barriers to encourage others to
take up sports. Infact,
Haryana's famous Phogat sis-
ters' life and success in
wrestling spawned the
Bollywood biographical block-
buster Dangal.
With Haryana leading in
producing medal winners, the
sports experts say that the
secret of success lies in the
state's sports policy and per-
haps, athletes' focus on a sim-
ple diet, rich in calories.
The famous saying:
Deshon mein desh Haryana,
jahan doodh ghee ka khana
(The land of lands Haryana has
a diet of milk and ghee)
grabbed the media limelight
again after Olympic bronze
medallist Bajrang Punia
recently shared that milk and
dairy products make up a
huge chunk of his diet.
The sports experts also
say that the Army's strong
influence in the state had laid
the foundation for Haryana to
turn into the country’s sport-
ing powerhouse. The early
Olympians from the agrarian
Haryana had an Army back-
ground.
Also, it is no secret that
most of the players in Haryana
come from a humble back-
ground, remaining oblivious to
the trappings of stardom and
focusing to hone their skills.
The sustained effort of
successive State Governments
which give incentives includ-
ing cash rewards, jobs to medal
winners have also drawn more
young people towards sports.
Since the 2008 Beijing
Olympics, when Haryanvi lad
Vijender Singh became the
first India boxer winning an
Olympic medal by clinching a
bronze, the state has been
making headlines for its ath-
letes.
From former Chief
Ministers OP Chautala,
Bhupinder Singh Hooda to
current Chief Minister
Manohar Lal Khattar, everyone
has focussed on promoting
sports in the state.
Under the state's sports
policy, the medallists at inter-
national sporting events are
given high monetary rewards,
a job and a plot at concession-
al rates.
A cash reward of Rs 6 crore
is given to a player who wins
a gold medal in Olympics, Rs
4 crore to a player who wins a
silver medal and Rs 2.5 crore
to those who win a bronze
medal. Haryana also gives
cash awards to winners in
Paralympic Games .
Recently, a cash reward of
Rs 50 lakh to sportspersons of
the state was also announced
for those achieving fourth
position in Olympics. Each
player participating in the
Olympic Games is also given
an incentive amount of Rs 15
lakh including Rs 5 lakh prior
to the games for preparations.
While the journey from
clinching an Olympic berth to
becoming a medal winner has
never been easy for any
sportsperson, many athletes
from Haryana have become
sporting icons in the past
decade, aspiring many young-
sters to follow their dreams and
bring laurels for the country in
the sports arena.
9RcjR_RdTcZaedR_`eYVc@]j^aZTddfTTVddde`cj
?=BQ 9B780C7
Under the aegis of Project
Shivalik, 21 BRTF organ-
ised a felicitation programme at
the Gauchar community hall to
honour gallantry award win-
ners of Chamoli as a part of the
series of events to commem-
orate the 75th anniversary of
India’s Independence and cel-
ebration of Azadi Ka Amrit
Mahotsav.
The Garhwal MP and for-
mer CM Tirath Singh Rawat
was the chief guest at the
function also attended by the
BRTF 21 commander colonel
Manish Kapil. Vijay Singh
(son) on behalf of Late Kedar
Singh-SC(P) and Chandrakala
(daughter in-law) on behalf of
Anand Mani- SC received the
honour. Speaking on the
occasion, Rawat lauded the
efforts of Border Roads
Organisation (BRO) in main-
tenance of the roads in the
State and the efforts of the
BRO in keeping the roads
open even in the high rainy
and peak winter season. He
also praised the efforts made
by BRO for the rehabilitation
work and making road and
bridges for traffic during Reni
and Sumna disaster in a time
bound manner. Rawat further
extolled the heroic, brave and
selfless service rendered by the
gallantry awardees towards
the nation. Similar activity
was also organized on August
7 at Navodaya Vidyalaya,
Pipalkoti to honour gallantry
award winners. The event
attended by Badrinath MLA
Mahendra Bhatt saw three
gallantry award recipients –
nayab subedar Surendra Singh,
lance naik Raghubeer Singh
and major Preetam Singh
Kunwar being felicitated by the
MLA. Heema Devi on behalf
of her husband Surendra
Singh- SC, Rekha Devi on
behalf of her late husband
Raghubeer Singh-SC(P) and
Hon Lt (retd) Narender Singh
Kunwar, father of Maj Preetam
Singh Kunwar- KC attended
the event.
%52IHOLFLWDWHV
JDOODQWUDZDUG
ZLQQHUV
?=BQ 270=3860A7
Punjab Government has
decided to bring nearly 8.5
lakh farmers and their families
under the ambit of the health
insurance cover in line with the
‘Ayushman Bharat Sarbat Sehat
Bima Yojana’ for the year 2021-
22. Besides, all the farmers hav-
ing ‘J’ forms and ‘Sugarcane
Weighment Slips’ would be
eligible for the health scheme.
To facilitate the farmers to
apply for this scheme in the
easiest way, the Mandi Board
has launched a dedicated por-
tal for the first time from this
year. Now, the farmers need not
to visit the market committee
office to apply manually as was
the case earlier.
The interested farmers can
simply apply on Mandi Board’s
portal https://emandikaran-
pb.in with uploading related
documents.
Punjab Mandi Board
chairman Lal Singh said that
the Board would pay the entire
premium for the insurance
cover of all the farmers, who will
get cashless treatment facility up
to Rs five lakh per annum. He
added that all these farmers and
their families will now be cov-
ered with effect from August 20,
2021.
He also informed that the
number of farmers covered
under Health Insurance Scheme
during the last year of the
scheme stood at around 5.01
lakh based on ‘J’ forms and
‘Sugarcane Weighment Slips’.
Now, the number of farmers has
reached nearly 8.5 lakh with
7.91 lakh farmers having ‘J’
forms registered with the Mandi
Board and 55,000 cane growers.
Pointing out further, Lal
Singh also said that these 5.01
lakh farmers, who have already
been registered under Sarbat
Sehat Bima Yojna during last
year, need not to re-apply on
portal as they will be extended
the benefit for next year based
on earlier documents but
remaining nearly 3.5 lakh farm-
ers registered as ‘J’ form hold-
ers and ‘Sugarcane Weighment
Slips’ after October 1, 2020,
would have to apply on portal
for availing Health Insurance.
The Market Committees have
also been directed to facilitate
every farmer, in case he needs
any help to avail this cashless
treatment facility in a seamless
manner, added Lal Singh.
Meanwhile, Mandi Board
secretary Ravi Bhagat informed
that the eligible farmers can
apply online on portal to avail
the health facilities from empan-
elled hospitals from August 20
this year. He further said that
apart from the family head, hus-
band or wife, father or mother,
unmarried children, divorced
daughter and her minor chil-
dren, widowed daughter-in-law
and her minor children would
be considered eligible to derive
benefit under the scheme. Any
further information can be
sought from the toll free no. 104
or visit Mandi Board’s website
www.mandiboard.nic.in. These
farmers can approach any of the
642 empanelled private hospi-
tals and 208 government hos-
pitals for treatment facility of up
to Rs five lakh for 1,579 diseases,
including major surgical treat-
ments such as heart surgery,
cancer treatment, joint replace-
ment and accident cases under
the health insurance scheme.
?d]YPQc^R^eTa'$[PZWUPaX]VUPX[XTbd]STaWTP[cWX]bdaP]RTbRWTT
?=BQ 270=3860A7
Shiromani Akali Dal (SAD)
president Sukhbir Singh
Badal on Sunday announced
the constituency in-charges
for 12 Assembly seats, includ-
ing seven new faces.
Sukhbir, who also met all
the 12 in-charges separately
and later even took their joint
meeting, urged them to pan
out in their respective con-
stituencies and spread aware-
ness about the 13-point pro-
gramme announced by the
SAD-BSP alliance which it
was committed to fulfil once it
formed the Government in
the State.
He also requested them to
work with vigour in conjunc-
tion with the district and cir-
cle organizations to ensure
optimum coordination with all
party members.
Assuring them that he
would be visiting each and
every constituency in the next
three months and would
address the specific concerns of
each constituency, Sukhbir
said: “While we will come out
with an election manifesto for
the entire State, we will also
take into account the problems
of individual constituencies
and address them also.”
The in-charges while giv-
ing feedback to the president
said the Congress party was
collapsing due to its failure to
implement any of the promis-
es made to the people includ-
ing farmers, youth and the
weaker sections besides wide-
spread corruption and com-
plete collapse of the law and
order situation in the State.
BdZWQXaP]]^d]RTbR^]bcXcdT]Rh
X]RWPaVTbU^a !bTPcb
?=BQ 270=3860A7
Haryana Chief Minister
Manohar Lal Khattar on
Sunday said that young profes-
sional associates in Chief
Minister's Good Governance
Associates Programme
(CMGGA) will make efforts to
improve governance as per the
priorities of the State
Government.
Besides this, the associates
will help the government to
deliver the benefits of welfare
policies up to the very last per-
son in the queue in the society,
the Chief Minister while
addressing the sixth cohort of
CMGGA here.
Citing Parivar Pehchan
Patra (PPP) as one of the
important schemes run by the
State Government, Khattar said
that main target of the State
Government is to ensure Rs
10,000 per family monthly
income of one lakh poor fam-
ilies under this scheme. In this
scheme, 6 Departments includ-
ing Local Bodies, Labour, Skill
Development and Industrial
Training, Health and MSME are
working jointly. He said that it
is the priority of the State
Government that every family
across the State should get
employment and self-employ-
ment opportunities by the year
2024 which will bring financial
stability in the families of the
state.
He said that Nuh district in
the State needs a positive trans-
formation in the field of edu-
cation, health and employment
as compared to other districts.
The good governance asso-
ciates should make efforts to
implement constructive
thoughts for the welfare of the
society. Overcoming the chal-
lenges that prevail while fol-
lowing the right path should be
the main focus of life, he added.
The Chief Minister fur-
ther said that as per the inspi-
rational ideology of Swami
Vivekananda, a person should
have courage to rise up against
all adversities in life.
He also expressed the
importance of genuineness,
discipline and to focus on right
utilization of time.
He informed that earlier
young associates of previous
batch contributed in pro-
grammes like Beti Bachao Beti
Padhao, improving of sex ratio,
CM Window, Saksham
Haryana, e-Office, Swachh
Bharat Abhiyan etc. In the pre-
sent batch, Good Governance
Associates will prioritise their
efforts on schemes like
Governance, Security, Health,
Education, Meri Fasal Mera
Byora, Mera Pani Meri Virasat,
Model Sanskriti Schools,
Parivar Pehchan Patra,
Mukhyamantri Parivar
Samridhi Yojana etc, he
added.
?=BQ 270=3860A7
Punjab Industries and
Commerce Minister Sunder
Sham Arora on Sunday assert-
ed that with Hi-Tech Cycle
Valley, coming up on 378.77
acres of land in Ludhiana, will
be on the world map as cycle
industry titans are establishing
their units there which would
in turn generate employment
opportunities for the young-
sters of the State.
Layout plan, change of
land use (CLU),
Environmental Clearance
under EIA notification, RERA
have also been accorded
approval for the entire chunk
of 378.77 acres land. The pro-
ject would entail the cost of Rs
365 crore.
He said that the Chief
Minister Capt Amarinder
Singh led State Government is
working diligently towards
setting up such industrial pro-
jects in the State which would
serve the twin purpose of
being environmental friendly
and providing employment
avenues to the youth.
A 100-acre plot had been
allotted to Hero Cycles
Limited, Ludhiana, in
December 2018 for setting
up of anchor unit on which
Hero Cycles Limited has
already commenced produc-
tion from April 2021 after
constructing requisite manu-
facturing infrastructure.
Further, 61.38 acre plot
has been allotted to the Aditya
Birla Group and 17 acre plot
allotted to the JK Paper
Industry.
The Industries and
Commerce Minister added
that the cycle valley has been
connected with the
Chandigarh-Ludhiana nation-
al highway by constructing a
100 feet wide four-lane and
8.3 Km long, external concrete
road, and handed over to the
public on 14 April, 2021.
/XGKLDQDWREHRQZRUOG
PDSZLWK+L7HFKFOH
YDOOHRQDFUHV
?=BQ 270=3860A7
Haryana Police has arrest-
ed four candidates, who
appeared in the recruitment
examination for the post of
male constable of the state
Police held on August 7 as they
were found red-handed with
the answer key of the question
paper.
An official spokesperson of
the Haryana Police said that
the Kaithal Police has caught
the four candidates and the
police is further investigating
the matter.
The Haryana Staff
Selection Commission had
cancelled the examination on
Saturday and a notice in this
regard was also issued.
In a cancellation notice,
HSSC had said, “It is notified
for the information of all the
candidates that the examina-
tion which was held on August
7 (morning and evening shifts)
and scheduled for August 8
(morning and evening shifts)
is hereby cancelled. Fresh
schedule will be issued later.
Inconvenience is regretted.”
Over 10000 candidates
were scheduled to appear for
the exam.
7BB2R^]bcPQ[TaTRadXcT]c
TgP[TPZ)7PahP]P?^[XRT
PaaTbcbU^daRP]SXSPcTb
:WPccPaPSSaTbbTb]TfQPcRW
^U2b6^^S6^eTa]P]RT
0bb^RXPcTb?a^VaPT
:WPccPabPXScWPc
PX]cPaVTc^UcWT
BcPcT6^eTa]T]cXb
c^T]bdaTAb
_TaUPX[h^]cW[h
X]R^T^U^]T[PZW
_^^aUPX[XTbd]STa
cWXbbRWTT](data:image/gif;base64,R0lGODlhAQABAIAAAAAAAP///yH5BAEAAAAALAAAAAABAAEAAAIBRAA7)
Recommended
Recommended
More Related Content
What's hot
What's hot (20)
Similar to Pioneer dehradun-english-edition-2021-08-09
Similar to Pioneer dehradun-english-edition-2021-08-09 (20)
More from DunEditorial
More from DunEditorial (20)
Recently uploaded
Recently uploaded (20)
Pioneer dehradun-english-edition-2021-08-09
- 1. 20?BD;4 8C1?8=3D2CB!F4= 55824AB8=210C dbb^^aXT) CWT8]SXP2WX]P ;02VdPaSX]V8]S^CXQTcP] 1^aSTa?^[XRTU^aRT^]Bd]SPh R^XbbX^]TSXcbUXabccf^ f^T]^UUXRTabU^aR^QPcPUcTa cWThR^_[TcTScWTXacaPX]X]V 7?45D;8C?0=4;F8;; C0:4D??460BDB)B70B78 =Tf3T[WX) 2WPXaP]^UcWT ?Pa[XPT]cPah_P]T[^] X]U^aPcX^]cTRW]^[^VhBWPbWX CWPa^^a^]Bd]SPhbPXS19? TQTabSXbad_cTScWT R^XccTT³bTTcX]V^]9d[h!' PbcWThSXS]^cfP]ccWT ?TVPbdbP[[TVPcX^]bc^QT SXbRdbbTSP]ScWT^UUXRXP[bfW^ fTaTc^cTbcXUh°P__TPac^WPeT QTT]X]bcadRcTS]^cc^PccT]S± 34;78CC0:4 A4HA CE0228=0C48CB03D;CB =Tf3T[WX) 8cfX[[cPZTP]^cWTa hTPac^ePRRX]PcTP[[T[XVXQ[T QT]TUXRXPaXTbPVTSPQ^eT 'X] cWT]PcX^]P[2P_XcP[Pc°cWT _aTbT]caPcT^U2^eXS (ePRRX]T bd__[h±cWTWTP[cWST_PacT]c WPbc^[ScWT330 ?=BQ =4F34;78 ADelhi-London economy class air ticket priced at C4 lakh! Yes, that is the price tag for a Delhi-London British Airways flight for August 26. Following an outcry over the exorbitant hike in airfares by airlines after the United Kingdom (UK) allowed Indian travelers to enter the country, with certain conditions from Sunday, the Directorate- General of Civil Aviation (DGCA) has asked airlines to submit details of fares, they have been charging for India- UK flights in August. A round trip between New Delhi and London by Air India in general cost somewhere between C55,000 to C70,000, but the prices skyrocketed just before August 8, the day the UK moved India from the ‘Red List’ to the ‘Amber List’, thus allowing Indian travellers to visit London. On Saturday, Sanjeev Gupta, Secretary, Inter-State Council Secretariat, Union Home Ministry, had com- plained on Twitter that an economy class ticket on British Airways’ Delhi-London flight for August 26 was priced at C3.95 lakh. He added that the economy class ticket on the Delhi-London flights of Vistara and Air India for August 26 was also priced between C1.2 lakh and C2.3 lakh amid the rush for college admissions in the UK. The relaxation from UK, too, has come at the time when huge traffic is expected on the Delhi-London route because of the admissions. Officials of the DGCA said that it has asked the airlines that operate India-UK flights cur- rently to submit details about their fares. According to officials, the data collected by the DGCA on Sunday shows the minimum one-way economy class fares on the Delhi-London nonstop flights during August. The fares range from C1,03,191 to C1,21,356 for Vistara and C1,28,916 to C1,47,544 for British Airways on different days this month. For Air India and Virgin Atlantic the mini- mum fare this month is C1,15,936 and C1,28,916, respectively. Vistara, which currently operates flights on the Delhi- London as well as the Mumbai- London route, said on Sunday: “Pricing is always a function of supply and demand. There are only 15 flights a week allowed currently on the India-UK route for Indian carriers and when there is relaxation and more capacity allowed, it will automatically bring down prices.” While there have been lower and upper limits on all domestic airfares in India since May 25 last year, no such lim- its have been imposed on inter- national airfares. ?=BQ =4F34;78 The Indian Council of Medical Research (ICMR) has said that a study on mixing and matching of two Covid-19 vaccines — Covaxin and Covishield — showed better immunogenicity than two doses of the same vaccine. The study was conducted on 18 people of Uttar Pradesh’s Siddharth Nagar who mistak- enly received doses of two sep- arate vaccines a few months ago. The finding of the study, which has been uploaded on medRxiv, but is yet to be peer- reviewed showed that immu- nisation with a combination of an adenovirus vector platform- based vaccine, followed by inactivated whole virus vaccine, was not only safe but also delivered better immuno- genicity. Covishield, manufactured by Pune’s Serum Institute of India, is the adenovirus vector platform-based vaccine, while Covaxin, developed and man- ufactured by Bharat Biotech and the ICMR, is the whole virus vaccine. The subject expert com- mittee of the Central Drugs Standard Control Organisation had in July recommended a trial of mixing Covishield and Covaxin. The trial will be con- ducted by the Christian Medical College in Vellore on 300 healthy volunteers. While that will be a prop- er clinical trial to investigate the effectiveness of the cocktail of Covishield and Covaxin, the ICMR’s study titled ‘Serendipitous Covid-19 Vaccine-Mix in Uttar Pradesh, India: Safety and Immunogenicity Assessment of a Heterologous Regime’ was based on the goof-up that took place in May. There was no immediate adverse impact of the mix-up on the benefi- ciaries. Now, a further study has revealed that the mix-up has actually worked in their favour as the beneficiaries have more protection than those who have received two shots of the same vaccine. “Though India so far has followed homologous approaches (two doses of one vaccine) with Covishield and Covaxin, eighteen individuals, under the national programme, inadvertently received Covishield as the first jab and Covaxin as the second,” it said. “To the best of our knowl- edge, this is the first study which reports the effects of het- erologous prime-boost vacci- nation with an adenovirus vec- tored vaccine followed by an inactivated whole virus vac- cine,” the researchers said. The researchers compared the safety and immunogenici- ty profile of those people who received two doses of different vaccines, against that of indi- viduals receiving either Covishield or Covaxin. ?=BQ =4F34;78 The CBI has arrested two more persons in an on- going investigation of a case relating to making derogatory posts on social media against judges and the judiciary. The two arrested accused, Pattapu Aadarsh and Lavanuru Samba Siva Reddy, will be pro- duced before the Competent Court, Guntur, Andhra Pradesh, officials said. Earlier on July 28, the agency had arrested two accused — Dhami Reddy Konda Reddy (currently in judicial custody) and Pamula Sudheer (currently in police custody till August 10). The first arrest in the case was made by the CBI on July 9. The accused Lingareddy Rajasekhar Reddy, earlier working in Kuwait, was also remanded to judicial custody by the court. Till now, five people have been arrested by CBI in the case. The CBI had registered a case on November 11 last year against 16 people and took over the investigation of 12 FIRs from the CID, of Andhra Pradesh. The cases were taken over by the CBI in pursuance of the orders of the Andhra Pradesh High Court in response to a writ petition. The original FIRs were registered on the complaints from the Registrar General of the Andhra Pradesh High Court. The cases were regis- tered under various sections of the Indian Penal Code relating to promoting enmity between various groups on grounds of religion, intentional insult and criminal intimidation besides relevant provisions of the Information Technology Act. A094B7:D0AQ =4F34;78 From pizzas to free air trav- el, rewards are raining on the Indian athletes who won medals for the country at the Tokyo Olympics. As a token of appreciation, Go First, previ- ously known as GoAir, on Sunday announced free travel for all six Indian athletes and the men’s hockey team who won medals at the Tokyo Olympics. Bengaluru-based regional carrier Star Air, which connects 13 cities in India, offered the medal winners a lifetime of free travel. IndiGo airlines had announced on Saturday that it would offer unlimited free air travel to javelin thrower Neeraj Chopra, who won the only gold medal for India, for one year. 5XaTf^aZbPccWTbcPSXdSdaX]VcWTR[^bX]VRTaT^]h^UcWT!!C^Zh^[h_XRb^]Bd]SPhX]C^Zh^ 0? ?=BQ =4F34;78 The National Investigation Agency (NIA) on Sunday conducted searches at multiple locations in 14 districts of Jammu Kashmir (JK) in connection with the Jamaat-e- Islami (JeI) terror funding case. The searches were con- ducted in conjunction with the Jammu Kashmir Police and the Central Reserve Police Force (CRPF) at 56 locations in Srinagar, Budgam, Ganderbal, Baramulla, Kupwara, Bandipora, Anantnag, Shopian, Pulwama, Kulgam, Ramban, Doda, Kishtwar and Rajouri districts of the Valley. The agency conducted the searches at the premises of office-bearers of the banned association, its members and also offices of trusts purport- edly run by the JeI. During the searches, various incriminating documents and electronic devices were seized from the premises of the suspects. The case was registered by the NIA on February 5 this year fol- lowing an order from the Union Home Ministry relating to separatist and secessionist activities of the JeI, under the Unlawful Activities (Prevention) Act, even after its proscription on February 28, 2019, the agency said. “The members of the organisation have been collecting funds domestically and abroad through donations particular- ly in the form of Zakat. 5842deVadZ_e`T]Za eYVhZ_Xd`WRZc]Z_Vd $VSULFHVRI ,QGLD8. WLFNHWVWRXFK WKHVNLHV µRYLGYD[FRPER JLYHVPRUHSURWHFWLRQ¶ ZiZ_X4`gRiZ_ 4`gZdYZV]U[RSd cVdf]edZ_SVeeVc Z^^f_`XV_ZTZej dRjd:4C ?:2cRZUd' a]RTVdZ_; Z_;V:eVcc`c Wf_UZ_XTRdV 0cW[TcTbUa^8]SXPcPZTPbT[UXTSdaX]VcWTR[^bX]VRTaT^]hX]cWT[h_XR BcPSXdPccWT!!BdTa[h_XRb^]Bd]SPhX]C^Zh^ ?C8 652=E2==J DB0 ( # DB0 ' ! ' 9P_P] ! # 61aXcPX] !! ! !! A2 ! !' ! 0dbcaP[XP !! =TcWTa[P]Sb ! # 5aP]RT ! 6TaP]h % 8cP[h ! 8]SXP ! # 2^d]cah 6 B 1 !WT[SU^aPZX]VSTa^VPc^ah _^bcbPVPX]bcYdSVTbYdSXRXPah ATfPaSbaPX]^]8]SXP´b[h_XP]b 7c`^ aZkkRd e` WcVVRZcecRgV] hZ__VcdXVeZeR]] /CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa 7`]]`hfd`_+ fffSPX[h_X^]TTaR^ X]bcPVaPR^SPX[h_X^]TTa ;PcT2Xch E^[ $ 8bbdT ! 0XaBdaRWPaVT4gcaPXU0__[XRPQ[T ?dQ[XbWTS5a^ 34;78;D2:=F 17?0;17D10=4BF0A A0=278A08?DA 270=3860A7 347A03D= 7H34A0103E890HF030 4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1 347A03D==30H0D6DBC (!! *?064B !C! DA@CE# =44A09C0A64CB (C7AF=F m m H@C=5) 58ABC%=C7B5!! 05B1;384BCB8=24!( 45978D54D? 25?=91D54* B1C9;14E71 ! F9F139DI @A:?:@?' 8=3800CC74;H?82B E4AC74342034B
- 2. ]PcX^]! 347A03D=k=30H k0D6DBC (!! 3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO $UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83 3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV $OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV ?=BQ B78;0 Himachal Chief Minister Jai Ram Thakur on Sunday said that the State Government is committed to strengthen the panchayati raj institutions in the state. The Chief Minister was addressing the Swaran Jayanti Panch Parmeshwar Gram Swaraj Sammelan at Jogindernagar in Mandi dis- trict. Thakur performed inau- gurations and foundation stones laying ceremonies of developmental projects worth Rs 110 crore at Chauntra in Jogindernagar Vidhan Sabha area. He said that this shows that the pace of development has been expedited during the last three and a half years. The developmental projects worth crores of rupees were being implemented in Jogindernagar constituency. Despite the COVID-19 pandemic, the State Government ensured that the pace of development goes uninterrupted for which he laid foundation stones and inaugurated developmental projects worth Rs 4000 crore in about 42 Vidhan Sabha areas of the State virtually from Shimla, he said. The Chief Minister fur- ther said that the government would provide all possible help to ensure that the elect- ed representatives of PRIs could function smoothly. He also urged the elected members of PRIs to identify beneficiaries of various wel- fare schemes launched by the State Government so that the benefits of the development could reach the people living at the lowest ebb. Thakur said that the State Government is providing old age pensions to over 5 lakh old age persons in the State. Almost 3.17 lakh free gas connections were provided in the State under the Himachal Grihini Suvidha Yojna, he said. +30GHGLFDWHV SURMHFWVZRUWKC FURUHLQ-RJLQGHUQDJDU =8B7D07090=Q 270=3860A7 As a young athlete Neeraj Chopra on August 7 hurled a 800g javelin high and pow- erfully into the sky, it came gliding down at a distance of 87.58 m sending 1.3 billion people into a frenzy and end- ing the country's wait for over a century for an Olympic gold medal in athletics. Not only did Chopra's (23) historic feat resulted in India ending the Tokyo Olympics 2020 on a golden note sur- passing the 2012 London Olympics best haul of six medals but the northern state of Haryana also scripted anoth- er Olympics success story. While India got its National Anthem moment with Chopra's top podium fin- ish, there were two more occa- sions where Haryana's players got to the podium and the Tricolour fluttered with pride at the Olympics. The country racked up its best-ever Olympic medal haul of seven, out of which three individual medal winners and two players in India's men hockey team belonged to Haryana, known as a traditional powerhouse in sports like kabaddi, boxing and wrestling. Despite having only two percent of the country's popu- lation, 30 sportspersons (about 25 percent) from Haryana were part of the biggest ever Indian contingent of 127 at Olympics this time. As we look back at the stel- lar performance of our sportspersons at the Tokyo Olympics, the old adage “Sports run in Haryanvis blood” clear- ly holds sway. Ecstatic scenes were wit- nessed at Chopra's native Khandra village in Haryana's Panipat district and the entire country on August 7 as the javelin thrower made history in his Olympic debut becoming India’s first track and field medalist, and only the second individual gold medalist after Abhinav Bindra’s shooting gold for India in the 2008 Olympic Games. Beginning his journey from Haryana’s training grounds, Chopra, an Army Subedar first came into the limelight with a stunning gold medal at the 2016 Junior World Championships in Poland and later made strides with gold medals at the Commonwealth Games and Asian Games in 2018. Alongwith Neeraj Chopra, who has become an overnight sensation, Haryana's wrestlers namely Ravi Kumar Dahiya with his silver medal, Bajrang Punia with bronze and Indian men's hockey team players Surender Kumar and Sumit Kumar ensured Haryana's domination at the biggest sporting event as the nation of a billion-plus waited for Olympic medals with bated breath. In his Olympic debut, the Haryanvi lad Ravi Dahiya (23) ensured that his name is writ- ten in bold letters in the annals of Indian sporting history. A resident of Nahri village in Sonipat district, Dahiya became the second Indian wrestler after Sushil Kumar to have won an Olympic silver medal. Dahiya's native village Nahri is also home to two other Olympians Mahavir Singh (1980 Moscow) and Amit Kumar Dahiya (2012 London). Perhaps, this prompted the Chief Minister Manohar Lal Khattar to immediately announce the construction of a Wrestling Indoor Stadium with modern world class facil- ities at village Nahri to encour- age more youth to take up the sports. Another wrestler from the state, Bajrang Punia (27), who hails from Khudan village in Jhajjar district, clinched a bronze medal on the penulti- mate day of Olympics. In the past, Punia has made the coun- try and the state proud at the Commonwealth Games and Asian Games. Interestingly, all three indi- vidual Olympic medal winners from Haryana belong to the family of farmers. Two hockey players from Haryana, Surender Kumar and Sumit Kumar also brought lau- rels to the country and the state as a resolute Indian men's hockey team managed to rewrite history clinching the bronze medal at Olympics after 41-year-long wait. Not only this, nine women from Haryana were part of Indian women's hockey team that had put in a spirited per- formance finishing fourth at the Olympics. Blockbuster movie Dangal’s gender- nuanced rhetoric ‘Mhari chhoriyan chhoron se kam Hain ke’ could never sound so truthful as out of Haryana's 30 sportspersons at Olympics this time, 17 were women. The Olympic feat is now new for Haryana, which is known as a centre of passion for sports with events especially wrestling being organized reg- ularly in rural areas. Till now, Indian individu- als have won 23 medals in the Olympics. These winners are various states, with Haryana accounting for highest seven – Neeraj Chopra (Gold), Ravi Dahiya (Silver), boxer Vijender Singh (Bronze), Badminton player Saina Nehwal (Bronze), wrestler Yogeshwar Dutt (Bronze), wrestler Sakshi Malik (Bronze), Bajrang Punia (Bronze), all won after the year 2008. As the celebration with sweets, traditional dance and fireworks continues across the state over the achievements of sons of soil at Olympics, it's like déjà vu all over again in Haryana. Three years back also, Haryana celebrated more than anyone else in the country when the Indian contingent had returned from the Gold Coast Commonwealth Games 2018 with an impressive tally of 66 medals, including 26 gold. The state's sportsper- sons, known for their physical resilience, had won a total of 22 medals including nine gold, six silver and seven bronze. Also, the state, notorious for female foeticide, has seen sportswomen taking giant strides and setting new bench- marks over the past few decades. Considerable number of sportswomen, such as the Phogat sisters, Sakshi Malik, Manu Bhaker, Deepa Malik among others have not only won laurels at international sporting events but also broken barriers to encourage others to take up sports. Infact, Haryana's famous Phogat sis- ters' life and success in wrestling spawned the Bollywood biographical block- buster Dangal. With Haryana leading in producing medal winners, the sports experts say that the secret of success lies in the state's sports policy and per- haps, athletes' focus on a sim- ple diet, rich in calories. The famous saying: Deshon mein desh Haryana, jahan doodh ghee ka khana (The land of lands Haryana has a diet of milk and ghee) grabbed the media limelight again after Olympic bronze medallist Bajrang Punia recently shared that milk and dairy products make up a huge chunk of his diet. The sports experts also say that the Army's strong influence in the state had laid the foundation for Haryana to turn into the country’s sport- ing powerhouse. The early Olympians from the agrarian Haryana had an Army back- ground. Also, it is no secret that most of the players in Haryana come from a humble back- ground, remaining oblivious to the trappings of stardom and focusing to hone their skills. The sustained effort of successive State Governments which give incentives includ- ing cash rewards, jobs to medal winners have also drawn more young people towards sports. Since the 2008 Beijing Olympics, when Haryanvi lad Vijender Singh became the first India boxer winning an Olympic medal by clinching a bronze, the state has been making headlines for its ath- letes. From former Chief Ministers OP Chautala, Bhupinder Singh Hooda to current Chief Minister Manohar Lal Khattar, everyone has focussed on promoting sports in the state. Under the state's sports policy, the medallists at inter- national sporting events are given high monetary rewards, a job and a plot at concession- al rates. A cash reward of Rs 6 crore is given to a player who wins a gold medal in Olympics, Rs 4 crore to a player who wins a silver medal and Rs 2.5 crore to those who win a bronze medal. Haryana also gives cash awards to winners in Paralympic Games . Recently, a cash reward of Rs 50 lakh to sportspersons of the state was also announced for those achieving fourth position in Olympics. Each player participating in the Olympic Games is also given an incentive amount of Rs 15 lakh including Rs 5 lakh prior to the games for preparations. While the journey from clinching an Olympic berth to becoming a medal winner has never been easy for any sportsperson, many athletes from Haryana have become sporting icons in the past decade, aspiring many young- sters to follow their dreams and bring laurels for the country in the sports arena. 9RcjR_RdTcZaedR_`eYVc@]j^aZTddfTTVddde`cj ?=BQ 9B780C7 Under the aegis of Project Shivalik, 21 BRTF organ- ised a felicitation programme at the Gauchar community hall to honour gallantry award win- ners of Chamoli as a part of the series of events to commem- orate the 75th anniversary of India’s Independence and cel- ebration of Azadi Ka Amrit Mahotsav. The Garhwal MP and for- mer CM Tirath Singh Rawat was the chief guest at the function also attended by the BRTF 21 commander colonel Manish Kapil. Vijay Singh (son) on behalf of Late Kedar Singh-SC(P) and Chandrakala (daughter in-law) on behalf of Anand Mani- SC received the honour. Speaking on the occasion, Rawat lauded the efforts of Border Roads Organisation (BRO) in main- tenance of the roads in the State and the efforts of the BRO in keeping the roads open even in the high rainy and peak winter season. He also praised the efforts made by BRO for the rehabilitation work and making road and bridges for traffic during Reni and Sumna disaster in a time bound manner. Rawat further extolled the heroic, brave and selfless service rendered by the gallantry awardees towards the nation. Similar activity was also organized on August 7 at Navodaya Vidyalaya, Pipalkoti to honour gallantry award winners. The event attended by Badrinath MLA Mahendra Bhatt saw three gallantry award recipients – nayab subedar Surendra Singh, lance naik Raghubeer Singh and major Preetam Singh Kunwar being felicitated by the MLA. Heema Devi on behalf of her husband Surendra Singh- SC, Rekha Devi on behalf of her late husband Raghubeer Singh-SC(P) and Hon Lt (retd) Narender Singh Kunwar, father of Maj Preetam Singh Kunwar- KC attended the event. %52IHOLFLWDWHV JDOODQWUDZDUG ZLQQHUV ?=BQ 270=3860A7 Punjab Government has decided to bring nearly 8.5 lakh farmers and their families under the ambit of the health insurance cover in line with the ‘Ayushman Bharat Sarbat Sehat Bima Yojana’ for the year 2021- 22. Besides, all the farmers hav- ing ‘J’ forms and ‘Sugarcane Weighment Slips’ would be eligible for the health scheme. To facilitate the farmers to apply for this scheme in the easiest way, the Mandi Board has launched a dedicated por- tal for the first time from this year. Now, the farmers need not to visit the market committee office to apply manually as was the case earlier. The interested farmers can simply apply on Mandi Board’s portal https://emandikaran- pb.in with uploading related documents. Punjab Mandi Board chairman Lal Singh said that the Board would pay the entire premium for the insurance cover of all the farmers, who will get cashless treatment facility up to Rs five lakh per annum. He added that all these farmers and their families will now be cov- ered with effect from August 20, 2021. He also informed that the number of farmers covered under Health Insurance Scheme during the last year of the scheme stood at around 5.01 lakh based on ‘J’ forms and ‘Sugarcane Weighment Slips’. Now, the number of farmers has reached nearly 8.5 lakh with 7.91 lakh farmers having ‘J’ forms registered with the Mandi Board and 55,000 cane growers. Pointing out further, Lal Singh also said that these 5.01 lakh farmers, who have already been registered under Sarbat Sehat Bima Yojna during last year, need not to re-apply on portal as they will be extended the benefit for next year based on earlier documents but remaining nearly 3.5 lakh farm- ers registered as ‘J’ form hold- ers and ‘Sugarcane Weighment Slips’ after October 1, 2020, would have to apply on portal for availing Health Insurance. The Market Committees have also been directed to facilitate every farmer, in case he needs any help to avail this cashless treatment facility in a seamless manner, added Lal Singh. Meanwhile, Mandi Board secretary Ravi Bhagat informed that the eligible farmers can apply online on portal to avail the health facilities from empan- elled hospitals from August 20 this year. He further said that apart from the family head, hus- band or wife, father or mother, unmarried children, divorced daughter and her minor chil- dren, widowed daughter-in-law and her minor children would be considered eligible to derive benefit under the scheme. Any further information can be sought from the toll free no. 104 or visit Mandi Board’s website www.mandiboard.nic.in. These farmers can approach any of the 642 empanelled private hospi- tals and 208 government hos- pitals for treatment facility of up to Rs five lakh for 1,579 diseases, including major surgical treat- ments such as heart surgery, cancer treatment, joint replace- ment and accident cases under the health insurance scheme. ?d]YPQc^R^eTa'$[PZWUPaX]VUPX[XTbd]STaWTP[cWX]bdaP]RTbRWTT ?=BQ 270=3860A7 Shiromani Akali Dal (SAD) president Sukhbir Singh Badal on Sunday announced the constituency in-charges for 12 Assembly seats, includ- ing seven new faces. Sukhbir, who also met all the 12 in-charges separately and later even took their joint meeting, urged them to pan out in their respective con- stituencies and spread aware- ness about the 13-point pro- gramme announced by the SAD-BSP alliance which it was committed to fulfil once it formed the Government in the State. He also requested them to work with vigour in conjunc- tion with the district and cir- cle organizations to ensure optimum coordination with all party members. Assuring them that he would be visiting each and every constituency in the next three months and would address the specific concerns of each constituency, Sukhbir said: “While we will come out with an election manifesto for the entire State, we will also take into account the problems of individual constituencies and address them also.” The in-charges while giv- ing feedback to the president said the Congress party was collapsing due to its failure to implement any of the promis- es made to the people includ- ing farmers, youth and the weaker sections besides wide- spread corruption and com- plete collapse of the law and order situation in the State. BdZWQXaP]]^d]RTbR^]bcXcdT]Rh X]RWPaVTbU^a !bTPcb ?=BQ 270=3860A7 Haryana Chief Minister Manohar Lal Khattar on Sunday said that young profes- sional associates in Chief Minister's Good Governance Associates Programme (CMGGA) will make efforts to improve governance as per the priorities of the State Government. Besides this, the associates will help the government to deliver the benefits of welfare policies up to the very last per- son in the queue in the society, the Chief Minister while addressing the sixth cohort of CMGGA here. Citing Parivar Pehchan Patra (PPP) as one of the important schemes run by the State Government, Khattar said that main target of the State Government is to ensure Rs 10,000 per family monthly income of one lakh poor fam- ilies under this scheme. In this scheme, 6 Departments includ- ing Local Bodies, Labour, Skill Development and Industrial Training, Health and MSME are working jointly. He said that it is the priority of the State Government that every family across the State should get employment and self-employ- ment opportunities by the year 2024 which will bring financial stability in the families of the state. He said that Nuh district in the State needs a positive trans- formation in the field of edu- cation, health and employment as compared to other districts. The good governance asso- ciates should make efforts to implement constructive thoughts for the welfare of the society. Overcoming the chal- lenges that prevail while fol- lowing the right path should be the main focus of life, he added. The Chief Minister fur- ther said that as per the inspi- rational ideology of Swami Vivekananda, a person should have courage to rise up against all adversities in life. He also expressed the importance of genuineness, discipline and to focus on right utilization of time. He informed that earlier young associates of previous batch contributed in pro- grammes like Beti Bachao Beti Padhao, improving of sex ratio, CM Window, Saksham Haryana, e-Office, Swachh Bharat Abhiyan etc. In the pre- sent batch, Good Governance Associates will prioritise their efforts on schemes like Governance, Security, Health, Education, Meri Fasal Mera Byora, Mera Pani Meri Virasat, Model Sanskriti Schools, Parivar Pehchan Patra, Mukhyamantri Parivar Samridhi Yojana etc, he added. ?=BQ 270=3860A7 Punjab Industries and Commerce Minister Sunder Sham Arora on Sunday assert- ed that with Hi-Tech Cycle Valley, coming up on 378.77 acres of land in Ludhiana, will be on the world map as cycle industry titans are establishing their units there which would in turn generate employment opportunities for the young- sters of the State. Layout plan, change of land use (CLU), Environmental Clearance under EIA notification, RERA have also been accorded approval for the entire chunk of 378.77 acres land. The pro- ject would entail the cost of Rs 365 crore. He said that the Chief Minister Capt Amarinder Singh led State Government is working diligently towards setting up such industrial pro- jects in the State which would serve the twin purpose of being environmental friendly and providing employment avenues to the youth. A 100-acre plot had been allotted to Hero Cycles Limited, Ludhiana, in December 2018 for setting up of anchor unit on which Hero Cycles Limited has already commenced produc- tion from April 2021 after constructing requisite manu- facturing infrastructure. Further, 61.38 acre plot has been allotted to the Aditya Birla Group and 17 acre plot allotted to the JK Paper Industry. The Industries and Commerce Minister added that the cycle valley has been connected with the Chandigarh-Ludhiana nation- al highway by constructing a 100 feet wide four-lane and 8.3 Km long, external concrete road, and handed over to the public on 14 April, 2021. /XGKLDQDWREHRQZRUOG PDSZLWK+L7HFKFOH YDOOHRQDFUHV ?=BQ 270=3860A7 Haryana Police has arrest- ed four candidates, who appeared in the recruitment examination for the post of male constable of the state Police held on August 7 as they were found red-handed with the answer key of the question paper. An official spokesperson of the Haryana Police said that the Kaithal Police has caught the four candidates and the police is further investigating the matter. The Haryana Staff Selection Commission had cancelled the examination on Saturday and a notice in this regard was also issued. In a cancellation notice, HSSC had said, “It is notified for the information of all the candidates that the examina- tion which was held on August 7 (morning and evening shifts) and scheduled for August 8 (morning and evening shifts) is hereby cancelled. Fresh schedule will be issued later. Inconvenience is regretted.” Over 10000 candidates were scheduled to appear for the exam. 7BB2R^]bcPQ[TaTRadXcT]c TgP[TPZ)7PahP]P?^[XRT PaaTbcbU^daRP]SXSPcTb :WPccPaPSSaTbbTb]TfQPcRW ^U2b6^^S6^eTa]P]RT 0bb^RXPcTb?a^VaPT :WPccPabPXScWPc PX]cPaVTc^UcWT BcPcT6^eTa]T]cXb c^T]bdaTAb _TaUPX[h^]cW[h X]R^T^U^]T[PZW _^^aUPX[XTbd]STa cWXbbRWTT
- 3. dccPaPZWP]S 347A03D=k=30H k0D6DBC (!! 3A60DA0EB0=90H As the nation is growing so is our life expectancy and with it so is osteoporosis. This disease causes bones to become porous and thereby become weak and brittle. Even a trivial fall or even mild stress such as bending, coughing, sneezing and laughing can cause a frac- ture.Bone is living dynamic tis- sue that is constantly being bro- ken down and replaced all the time. In a healthy bone, the rate of bone breakdown is propor- tional to the rate of bone for- mation, so the bone strength is maintained. Osteoporosis occurs when the formation of new bone does not keep up with the pace of loss of bone. The bone mass increases up to 30-35 years of age, it remains almost constant from 35-45 years and then it starts decreas- ing after 45 years in female and 50 years in male. Osteoporosis affects both men and women of all races but Asian women especially, post menopausal are at high risk. Certain medications like steroid and anti-epileptic drugs and certain diseases like hyper- thyroidism, diabetes, unhealthy diet, and sedentary work increase the chance of osteo- porosis. Osteoporosis can be diagnosed by taking medical history, physical examination along with blood, urine and x- rays. But the gold standard test nowadays, is to measure the Bone Mineral Density, which can be measured by DEXA Scan and can help to confirm the diagnosis of osteoporosis. Osteoporosis is such a seri- ous health issue that being an orthopaedic surgeon I see at least one new or old fracture in a day in my clinical practice. It maybe by chance or it may also be the true picture of osteo- porosis that some time I have seen three different patients of osteoporosis having fractures of spine, hip and wrist which are the common osteoporotic frac- tures. I had three successive patients, one a 91 year old male- have gradual onset of back pain. He had fracture of D 12 vertebra without any obvious injury in the back. Another patient, 97 year old female sustained left hip frac- ture due to slip from bed at night. And the third patient came with right wrist fracture who was 50 year old post menopausal female. I would like to mention here that this is the common scenario of osteo- porotic fracture not only in my OPD but in all orthopaedic OPDs. The fracture alone is itself a problem but because of their increased age they are having co-morbidities like diabetes, hypertension, cardiac ailments and asthma which further increase their morbidity and make the anesthesia and sur- gical procedure more risky. Surgical complication which often needs to be dealt in spite of using good quality implants, is loosening and breakage of implants along with cut through of the implant through the bone like a knife through soft butter. There post opera- tive recovery is often unpre- dictable when they have a bag of co-morbidities with them. Hence these patients and atten- dants need good understand- ing about osteoporotic fracture and its rehabilitation which is often long. Here I would like to mention that in spite of the best treatment, even in developed nations, one-third of hip frac- ture patients die within a year despite receiving the best sur- gical procedure. Osteoporosis is more com- mon in people who have deranged hormone levels in their bodies. The reduction of estrogen level in women at menopause is one of the strongest risk factor for devel- oping osteoporosis. Similarly in men, the gradual reduction in testosterone level, increases the chance of osteoporosis which usually occurs after 70 years. In males, prostate cancer reduces the testosterone level. Hyper activity of thyroid gland or over prescription of thyroxin med- ication can enhance the osteo- porosis. Over activities of other glands like parathyroid and adrenal glands can induce pre- mature osteoporosis. Uterus removal (hysterec- tomy) is a common procedure in gynecological practice done in women for abnormal uter- ine bleeding. The pre- menopausal uterus removal is associated with subsequent long term reduction of prog- esterone secretion. If it is accompanied with removal of ovaries as well then estrogen levels are also bound to decrease. Therefore, after hys- terectomy, these women expe- rience greater, gradual bone marrow density reduction and more bone density loss than women with an intact uterus. The patients are more prone for developing osteoporosis and subsequent osteoporotic frac- tures too. These patients need the hormone supplementation. It is suggested that women should retain the uterus until unless they have developed the disabling or life threatening problems. A scientific study reported a two fold increase of osteoarthritis also in these patients. Hysterectomy not only induces bone osteopenia and osteoporosis which weak- en the bones, these patients subsequently also develop pre- mature osteoarthritis along with knee deformity, which further progresses to osteoarthritis. It is also noticed that these women developed pre mature senile changes which are more prominently seen as skin changes. Prevention is better than cure.This proverb is more rel- evant in osteoporotic fracture. Hence, efforts should be made to prevent thesefractureswith a balanced and a nutritious diet which is rich in calcium and vitamin D. Routine physical activities should be undertak- en to maintain bone health and achieve peak bone mass density by 35 years. Consumption of alcohol and smoking should be avoided in all ages. There are medications which are available in the mar- ket, which reduce the pace of resorption of the bone. However, these medications should be taken after physi- cian’s consultation only. The most common drugs used to treat osteoporosis are called bis- phosphonate like alendronate and injectable zolidronic acid and teriparatide. Calcitonin is available as a nasal spray, which reduces the bone resorption. Certain suggestions are made to the general public like keeping the floor dry, particu- larly of the bathroom. They should have the good visibili- ty at night and not only a night bulb.Provision of handrailing support at public places and even at home around toilet seat must be there to assist the old and frail patients as they often slip in wet bathrooms during the night due to poor vision and poor balance which is a physiological problem at this age. These old patients should be advised to avoid sudden twisting and turning because both these movements are pre- cipitating factors for fracture of hips.In case of a fracture, then it should be treated by early treatment and fixation should be secure so as to mobilize the patient early. The mobilisa- tion of these patients often requires some sort of support in the form of a walking aid. (The author is an orthopaedic surgeon based in Dehradun. Views expressed are personal) @deV`a`c`dZd²RdVcZ`fd`ceY`aRVUZTUZdVRdV *XHVWFROXPQ ?=BQ 347A03D= The Dehradun visit of Aam Aadmi Party’s national convener and Delhi Chief Minister Arvind Kejriwal which was scheduled for today has been postponed. According to the party members, the visit has been post- poned due to some unforeseen circum- stances but Kejriwal will visit Dehradun by the end of this week. However, when the state in charge of the party, Dinesh Mohaniya was asked about Kejriwal's visit, he said the party's head will visit Dehradun soon but the day and time is yet to be con- firmed. This will be the second visit of the AAP chief to the State within two months. It is being speculated that after Delhi deputy Chief Minister Manish Sisodia's recent visit to Roorkee where he questioned people of Uttarakhand whether a CM should be a corrupt leader or a patriot like colonel (retd) Ajay Kothiyal, Kejriwal may officially announce the latter as the party's chief min- isterial candidate in the State. During his last visit in July, Kejriwal made four announcements related to elec- tricity which he termed as guarantees and promised to fulfil them if the party is voted to office in Uttarakhand next year. In his announcements, he guaranteed to provide free electricity up to 300 units and no electricity bills to farmers of Uttarakhand. Besides this, he guaranteed waiving off old electricity bills too. He also assured working towards pro- viding 24 hours electricity which, as he mentioned, will take three to four years to change the electricity system across the State. He had said his party is not just making blind promises to lure voters, everything is being announced on the basis of plans. Kejriwal has also assert- ed in his last visit that he will visit Uttarakhand every month to make such announcements in other major spheres too like education, health, unem- ployment among others with a well sorted plan rather than making random and tall claims like other parties. For the last two years, AAP has been making consistent efforts to emerge as the third prominent player in state pol- itics. Senior leaders of AAP like Kejriwal and Sisodia have con- sistently targeted the Bharatiya Janata Party (BJP) and Congress for successively run- ning corrupt governments and ruining Uttarakhand for the last 20 years. They have claimed only AAP can reform Uttarakhand and the party is already work- ing on preparing concrete plans. ?=BQ 347A03D= The Aam Aadmi Party (AAP) in Dehradun raised objections on the selection process for the Tilu Rauteli awards alleging that the Uttarakhand government pre- sented awards mostly to those women who are associated with the Bharatiya Janata Party (BJP). The AAP members called it an insult to warrior Tilu Rauteli. Except for a few names of award winners, most of the winners are either BJP workers or the daughters and wives of BJP leaders, averred one of the spokesmen of AAP, Sanjay Bhatt. This award is given to women for their exem- plary contribution in their fields but Chief Minister Pushkar Singh Dhami has started an extremely wrong tradition by politicising the awards. He must answer the public for such actions that vio- late the sanctity of a heroic icon of Uttarakhand, stated Bhatt. 11@QSSecUcEµ[XQ^T 3=_V`_YdYSYcY^WDYe BQedUYQgQbTc ?=BQ 347A03D= The State Health depart- ment reported only 18 new cases of the novel Coronavirus (Covid-19) and 46 recoveries from the disease in Uttarakhand on Sunday. No death from the disease was reported in the state on the day. The cumulative count of Covid-19 patients in the state is now at 3,42,392 while a total of 3,28,522 patients have recov- ered from the disease so far. In the state 7367 people have lost their lives to Covid -19 till date. The recovery percentage from the disease is now at 95.95. The State Health depart- ment reported six new patients of Covid -19 each from Dehradun, two each from Haridwar, Nainital and Rudraprayag and one each from Almora, Champawat, Pauri, Tehri, Udham Singh Nagar and Uttarkashi districts on Sunday. No new patient was found in Bageshwar, Chamoli and Pithoragarh districts on the day. The State now has 463 active cases of Covid 19. Dehradun with 191 cases is at top of the table of active cases while Pithoragarh is at second spot with 58 active cases. Chamoli has 52, Rudraprayag 32, Udham Singh Nagar 31, Champawat 26, Uttarkashi 18, Pauri 15, Bageshwar 13, Haridwar 10, Almora and Nainital six each and Tehri five active cases each of the disease. The State reported two new cases of Mucormycosis (Black fungus) on Sunday. A total of 570 patients of the dis- ease have so far been reported. In the ongoing vaccination drive 32,955 people were vac- cinated on Sunday in 220 ses- sions held in different parts of the State. 2QOQHZ FDVHVRIRYLG UHSRUWHGLQ 8WWDUDNKDQG ?=BQ 347A03D= The regional transport office (RTO) of Dehradun has removed the condition of reserving the time to arrive in RTO through online appoint- ments for the new applicants of learner license (LL). When the RTO resumed its services in June, the public was asked to take appointments for services like vehicles permits, challan, LLs and permanent driving licenses (DLs) etc to reserve the timings to limit the number of visitors in the RTO premises as a precautionary measure against Covid-19. The RTO removed this condition of prior appoint- ment in other services due to the considerable decline in Covid cases except for LLs due to the backlog of over 10,000 applications. The regional transport officer (administration) Dinesh Chandra Pathoi recently increased new slots of LLs from 25 to 50 due to which RTO is currently processing 100 applications daily includ- ing 50 old applications. Now the RTO has also removed the condition of taking a prior online appointment to reserve the timings for the new appli- cants of LLs. According to officials, the new applicants of LLs can now book the slots like before but the old applicants will have to take prior appointments to reserve the timings due to heavy backlog. Also, the offi- cials informed that the limit to daily slots for DL is still 75 slots per day which might increase in the next two weeks. .HMULZDO VYLVLWWR'RRQ SRVWSRQHGOLNHOWR DUULYHWKLVZHHN 0]TfPbcTR^[[TRcX^]QX]_a^eXSTSQhcWTBcPcT_^[[dcX^]R^]ca^[Q^PaSPcAPX_daA^PSX]3TWaPSd]bcdUUTSfXcWVT]TaP[fPbcT fXcWVPaQPVTbdaa^d]SX]VXcTeT]PbPeTVTcPQ[TRaTT_TadbTbcWTQX]U^abd__^ac ?X^]TTa_W^c^ ?=BQ 347A03D= Indian hockey player and Haridwar resident Vandana Katariya who scored a hat trick in an Olympics match recently has been declared as the ambas- sador of the State’s Women Empowerment and Child Development Department (WECD). Chief Minister Pushkar Singh Dhami made this announcement here at a programme held on Sunday to present the Tilu Rauteli award and Anganwadi worker award to selected personalities. Dhami also announced that from next year, the cash amount with both the awards will be raised to Rs 51,000. This year a total of 22 women have been given the Tilu Rauteli award while 22 women have been given the Anganwadi worker award. The Tilu Rauteli award comprises Rs 31,000 cash and a citation while the Anganwadi worker award comprises Rs 21,000 cash and a citation. Speaking on the occasion, the chief minister said that women have always played an important role in the move- ment for the separate state of Uttarakhand and in various other aspects in the state. He said that the State Government is undertaking various efforts for women empowerment. Stressing on the importance of good condition of Anganwadi centres, the CM said that these centres play an important role in the development of children in the initial stages. Dhami said that those who achieve big despite limited resources earn a different level of fame. He said that Prime Minister Narendra Modi spent his earlier life in normal circumstances but due to his style of functioning, the nation is fast advancing on the path of development. Dhami also recalled his own child- hood, using lime solution to write on a slate in school. Referring to the Governmental schemes for women empowerment, he said that the state government wants the women to benefit from these schemes. He spoke about the Mukhyamantri Mahalakshmi Yojana in which kits are provided for pregnant women and newly born girl child. Woman Empowerment and Child Development min- ister Rekha Arya recalled the brave exploits of Tilu Rauteli, on whose birth anniversary the state government had felicitat- ed women from various fields and Anganwadi workers. Jumping into the battlefield at the age of 15 years, Rauteli had fought seven battles at a small age. Referring to Anganwadi workers, she said that they had done commendable work during the Covid-19 pandem- ic. The minister recalled that CM Dhami’s father had donat- ed his land for an Anganwadi centre. GR_UR_R^RUVH645ScR_UR^SRddRU`c Vandana Katariya, Dr Rajkumari Bhandari Chauhan, Shyama Devi, Anuradha Walia, Reena Rawat, Chandrakala Tiwari, Namita Gupta, Binduvasini, Ruchi Kalakoti, Kanchan Negi, Mamta Mehta, Anjana Rawat, Parvati Kiraula, Kanishka Bhandari, Bhawana Sharma, Geeta Joshi, Babita Punetha, Deepika Bohra, Deepika Chufal, Rekha Joshi, Renu Gadkoti, Punam Dobal. C8;DA0DC4;80F0A3 F8==4AB Gaura Kohli, Pushpa Prahri, Pushpa Patni, Geeta Chand, Galista, Anjana, Sanju Balodi, Meenu, Jyotika Pandey, Suman Panwar, Rakhi, Sushma Gusain, Asha Devi, Durga Bisht, Sohani Sharma, Vrinda, Pronnati Vishwas, Hansi Dhapola, Gayatri Danu, Heera Bhatt, Sushma Panchpuri, Seema Devi. 0=60=F0380F0A3 F8==4AB 1RSULRUDSSRLQWPHQW QHHGHGIRUQHZ DSSOLFDQWVRI//V ?=BQ 347A03D= Congress election campaign committee head and for- mer chief minister Harish Rawat and the leader of oppo- sition, Pritam Singh partici- pated in the protest rally of statehood activists towards the chief minister’s residence here on Sunday. The two leaders extended their support to the nine demands being raised by the statehood activists. Pradesh Congress Committee vice president and Chinhit Rajya Andolankari Sanyukt Samiti patron, Dhirendra Pratap said that the two leaders assured the protest- ing statehood activists that if the Congress is elected to gov- ern Uttarakhand in the 2022 Assembly elections, it will work on the demands of the state- hood activists. They supported their demand for reservation for statehood activists, identifica- tion of remaining activists, making Gairsain the perma- nent state capital and bringing about changes in the land law to make it more suitable to the requirements of Uttarakhand. Stating that the demands of the statehood activists will be ful- filled if the Congress is voted to office, Rawat said that the pensions of statehood activists should be increased and that this will be ensured by the Congress government. In his address, Singh said that this and other relevant issues of the State will be raised strongly by the Congress in the Vidhan Sabha which has been called to session from August 23. Meanwhile, cabinet minis- ter Ganesh Joshi sought time till 7 PM on Monday, stating that he will try to facilitate a meeting of the statehood activists with the chief minis- ter. Earlier, the statehood activists gathered at Dilaram Chowk and marched towards the CM’s residence while rais- ing anti-government slogans. They were stopped by the police at the barricading in Hathibadkala. 3_^Wce``_bdcQWYdQdY^W cdQdUX__TQSdYfYcdc 8]cWTbcPcT% _T^_[TWPeT[^bc cWTXa[XeTbc^ 2^eXS (cX[[SPcT
- 4. ]PcX^]# 347A03D=k=30H k0D6DBC (!! ?=BQ =4F34;78 The Opposition relentlessly demanding a debate on the Pegasus snooping row and farm laws during discussions of Bills in the Rajya Sabha was “deliberate” as part of a joint strategy. The demands on the two issues, even during dis- cussions on Bills, have now been compiled in a three- minute video in what the Opposition said was an attempt to make the Government listen to them. Admitting as much, TMC MP Derek O’Brien on Sunday said that their “strategy was deliberate”. “When the official chan- nels are being denied, this is a new way to reach the masses,” said O’Brien, who is also the leader of the TMC in the Rajya Sabha and from whose Twitter handle the video was released. With this being the last week of the Parliament Session, the video urges “Mr Modi come listen to us”. The video, which has been compiled using clips from RSTV, comprises statements made by the Opposition MPs in the Upper House, with the words “farmer” and “Pegasus” in the opening lines. “You are not allowing the discussion we have been asking for the past 14 days and the dis- cussions we can do later. You are passing that Bill now. If you have courage, begin the dis- cussions on Pegasus now,” Congress’s Mallikarjun Kharge is heard saying in the video on the floor of the House. The compilation includes Opposition speakers like Vandana Chavan of the NCP who raised the Pegasus issue, accusing the Government of “not listening to the people”. RJD’s Manoj Jha too is seen speaking on the spyware issue. “Pegasus has reached everyone’s house. We have to discuss this,” says Jha. Congress’s Deepinder Hooda raised the issue of farm- ers stating that he would talk about the matter if his “micro- phone is not switched off”. The CPI(M) accused the government of “stealing” par- liamentary democracy, while TMC’s Sukhendu Shekar Roy raised the issue of “freedom of speech in Parliament”. The other parties which have rep- resentation in the video include Samajwadi Party, TRS, DMK and AAP. One of the leaders in the video, Shiv Sena MP in Rajya Sabha Priyanka Chaturvedi said in a democracy if the government of the day has a responsibility, so does the opposition. CPI(M) leader and RS MP Elamaram Kareem said that speaking during the discussion on bills was the only way to make the Government listen. Senior Congress leader and party spokesperson Manish Tewari said that what is hap- pening in the House is a “com- plete murder of democracy”. “The institution of Parliament is being trifled with by the NDA-BJP government,” said Tewari, slamming the govern- ment for getting bills passed when the House is not in order. Since the start of the Monsoon Session on July 19, parliamentary proceedings have been continuously wit- nessing disruptions due to protests by opposition parties and a logjam has persisted over their demand for a dis- cussion on the Pegasus snoop- ing row. The Opposition has also been strongly protesting against the price rise issue and demanding the repeal of the farm laws. ?=BQ =4F34;78 The first indigenously designed and built aircraft carrier INS Vikrant on Sunday successfully completed its maiden sea trials which start- ed on August 4. The warship weighing more than 40,000 tonnes will continue to under- go more sea trials and is likely to be inducted into the Navy by the end of next year. India has now joined the elite group of nations building aircraft carrier. The other nations are US, Russia, France and UK. The public sector Cochin Shipyard Limited built the INS Vikrant at a cost of more than C24,000 crores. Giving details of the sea tri- als, navy officials said here the warship successfully accom- plished its maiden sea voyage on Sunday. Trials progressed as planned and system parameters proved satisfactory. The carri- er will continue to undergo series of sea trials to prove all equipment and systems prior handing over the vessel to the Indian Navy. The Indigenous Aircraft Carrier is 262 m long, 62 m at the widest part and height of 59 m including the superstructure. There are 14 decks in all, including five in the super- structure. The ship has over 2,300 compartments, designed for a crew of around 1700 people, having gender-sensitive accom- modation spaces for women officers. The ship with high degree of automation for machinery operation, ship nav- igation and survivability, has been designed to accommodate an assortment of fixed wing and rotary aircraft. During the maiden sailing, ship’s performance, including hull, main propulsion, Power Generation and Distribution (PGD) and auxiliary equip- ment were tested. Trials, which were reviewed by Vice Admiral AK Chawla, Flag Officer C ommanding-in-Chief Southern Naval Command on the last day, have progressed as planned and system parameters have been proved satisfactory. The successful completion of maiden trials sorties, despite challenges faced due to Covid- 19 pandemic and Covid pro- tocols in place, is testimony to the dedicated efforts of large number of stakeholders for over a decade. This is a major milestone activity and histori- cal event. The delivery of Vikrant is being targeted to coincide with celebrations to commemorate 75th anniversary of India’s independence ‘Azadi Ka Amrit Mahotsav’. Moreover, its induc- tion will also strengthen India’s position in the Indian Ocean Region (IOR) and its quest for a blue-water Navy. At present, India has only one aircraft car- rier INS Vikramaditya. INS Vikrant will accom- modate up to 30 fighter jets and helicopters. The warship will have a fleet of Mig-29K fight- er jets and Ka-31 helicopters. The ship is designed with a very high degree of automa- tion for machinery operation, ship navigation and surviv- ability, ‘Vikrant’ has a top speed of around 28 knots and cruis- ing speed of 18 knots with an endurance of about 7,500 nau- tical miles. The Indian Navy has been focusing on significantly bol- stering its overall capabilities in view of China’s growing efforts to increase its military presence in the Indian Ocean Region. The Indian Ocean, considered the backyard of the Indian Navy, is critical to the country’s strategic interests. In order to achieve self- reliance in shipbuilding, the Navy’s programme is rightly poised to provide requisite ‘Economic Stimulus’, with 44 ships and submarines on order being built indigenously. 8=BEXZaP]cbdRRTbbUd[[hR^_[TcTbPXST]bTPe^hPVT @aaReeV^aed_VhhRje` cRZdVAVXRdfd7Rc^3Z]] ?=BQ =4F34;78 Parliamentary Standing Committee on Information Technology Chairman Shashi Tharoor on Sunday alleged that BJP mem- bers “disrupted” the commit- tee’s meeting on July 28 as they did not want the Pegasus alle- gations to be discussed and the bureaucrats who were to tes- tify “appear to have been instructed not to attend”. He, however, expressed hope the snooping issue would be taken up by the panel in the days to come. Tharoor has already writ- ten to Lok Sabha Speaker Om Birla to take action against the Ministry officials who skipped the meeting. He said that the actions of the three officials making “last-minute excuses” to skip the meeting were a “grievous assault” on such panels’ prerogatives to sum- mon witnesses. On Prime Minister Narendra Modi’s remarks that the Opposition was insulting Parliament, Tharoor told PTI that the government’s refusal to be answerable in any way, shape, or form on an issue of national and international importance, has made a “mockery of democracy and of the ordinary Indians the gov- ernment claims to represent”. Tharoor said for two years now the IT committee has been conducting discussions on “Citizens’ data privacy and security and “cyber security, topics that also featured in its agenda under the previous chairman, BJP’s Anurag Thakur. The Pegasus issue there- fore clearly falls under the purview of the IT committee and so it is only expected that its members will ask questions about it when these topics arise, he said. “It is no secret that the Committee’s meeting on its established agenda was dis- rupted by members who did not want Pegasus to be dis- cussed. It was unprecedented for 10 members to attend and to refuse to sign the register in order to deny the Committee a quorum,” Tharoor said. The panel was to hold a meeting on July 28 during which several issues including the Pegasus snooping allega- tions were expected to be dis- cussed. It had also summoned officials from the Ministry of Electronics and Information Technology (MeitY), the Ministry of Home Affairs and the Ministry of C o m m u n i c a t i o n s (Department of Telecommunications) on the subject ”Citizens data securi- ty and privacy”. However, the meeting could not take place as the BJP members of the panel did not sign the atten- dance register, even though they were present in the meet- ing room, leading to a lack of quorum. %-3GLGQ¶WZDQWWRGLVFXVV 3HJDVXVDOOHJHV7KDURRU ?=BQ =4F34;78 Scientists have discovered human antibodies that can neutralise several different coronaviruses and pave the way for a pan-coronavirus vac- cine. These antibodies have been detected in some people who have recovered from Covid-19, said the team at the University of Washington in a study published in the journal Science. The study describes research on five such human monoclonal antibodies that can cross-react with a number of beta-coronaviruses. The team examined certain mem- ory B cells from Covid-19 con- valescent donors. Memory B cells are white blood cells that recognise and respond to pathogens that have tried to attack the body during a pre- vious encounter. Out of five promising anti- bodies that they isolated, the scientists decided to concen- trate on one designated S2P6. Molecular structure analysis and functional studies showed that this human monoclonal antibody had impressive breadth: it was able to neutral- ize three different subgenera of beta-coronaviruses. The scien- tists observed that it did so by inhibiting the virus’ ability to fuse with cell membranes.These antibodies target a structure, called stem helix, in the spike protein of these viruses. The spike protein is critical to the virus’ ability to overtake host cells. The stem helix in the spike protein has remained con- served during the evolution of certain coronaviruses. That means it is much less prone to genetic changes and is similar in various coronaviruses, explained lead author Dora Pinto, from varsity’s School of Medicine in Seattle. These include those origi- nating in bats that have become dangerous pathogens in people, and another subgenus that causes a serious human lung disease transmitted by drome- dary camels, as well as a few other subgenera that cause simple common cold symp- toms. The team went on to test if the S2P6 stem helix antibody could protect against SARS- CoV-2 by administering it to hamsters 24 hours before expo- sure. They found that this anti- body reduced the viral load of SARS-CoV-2 by inhibiting entry of the virus and by enhancing additional anti-viral and virus-clearing cellular immune responses. Studies of the plasma from pre-pandemic human samples, as well as from Covid-vacci- nated and Covid-recovered individuals, were also analysed to see how frequently the stem- helix targeting antibodies appeared. The highest frequencies occurred in people who had recovered from Covid-19, then were later vaccinated. Overall, however, the data from this study shows that, while it does occur, it is relatively rare for SARS-CoV-2 to elicit plasma stem-helix antibody responses. CSYU^dYcdcTYcS_fUb Q^dYR_TYUcd_TUfU_` `Q^S_b_^QfYbecfQh ?=BQ =4F34;78 People now no longer have to log in into the CoWin por- tal to download their vaccina- tion certificate. Those who have been vac- cinated against Covid-19 can now also get their vaccination certificate through WhatsApp within seconds, Union Health Minister Mansukh Mandaviya’s office said on Sunday. Revolutionising the com- mon man’s life using technol- ogy! Now get Covid-19 vacci- nation certificate through MyGov Corona Helpdesk in 3 easy steps. Save contact num- ber: +91 9013151515. Type send ‘covid certificate’ on WhatsApp. Enter OTP. Get your certificate in seconds, Mandaviya’s office tweeted. Cumulatively, 50,68,10,492 Covid vaccine doses have been administered in the country through 58,51,292 sessions, according to a provisional report till 7 am on Sunday, with 55,91,657 doses being given in a day. Five states — Madhya Pradesh, Gujarat, Rajasthan, Maharashtra and Uttar Pradesh — have administered more than one crore cumulative doses of the Covid-19 vaccine each to beneficiaries in the 18- 44 age group, the ministry said. India has reported 39,070 daily new cases in the last 24 hours. 2^eXS (ePRRX]PcX^] RTacXUXRPcT]^fPePX[PQ[T cWa^dVWFWPcb0__)X]) ?=BQ =4F34;78 With India presiding over the United Nations Security Council (UNSC) for this month, Prime Minister Narendra Modi on Monday will chair a high-level open debate on “Enhancing Maritime Security - A Case for International Cooperation.” The meet will be held virtually. It is the first time an Indian prime minis- ter is chairing a UNSC session. The high profile will be attended by heads of several states and member states of the UNSC, officials said here on Sunday. “Modi would be the first Indian prime minis- ter to preside over a UN Security Council Open Debate,” the Prime Minister’s Office(PMO) said. As regards the meeting, officials said the debate will focus on ways to effectively counter maritime crime and insecurity, and strengthen coordination in the maritime domain. The UNSC has discussed and passed resolutions on dif- ferent aspects of maritime security and maritime crime, the PMO noted. However, this is the first time that mar- itime security will be dis- cussed in a holistic manner as an exclusive agenda item in such a high level open debate, it added. “Given that no country alone can address the diverse aspects of maritime security, it is important to consider this subject in a holistic manner in the United Nations Security Council. A comprehensive approach to maritime securi- ty should protect and support legitimate maritime activities, while countering traditional and non-traditional threats in the maritime domain,” it said. The oceans have played an important part in India’s his- tory right from the time of the Indus Valley civilisation, it noted, adding that based on the country’s civilisational ethos that see the seas as an enabler of shared peace and prosperity, the Prime Minister had put forward the vision of SAGAR - an acronym for “Security and Growth for all in the Region” in 2015. This vision focuses on cooperative measures for sus- tainable use of the oceans, and provides a framework for a safe, secure, and stable mar- itime domain in the region. In 2019, at the East Asia Summit, this initiative was further elaborated through the Indo-Pacific Oceans’ Initiative (IPOI) with a focus on seven pillars of maritime security including Maritime Ecology; Maritime Resources; Capacity Building and Resource Sharing; Disaster Risk Reduction and Management; Science, Technology and Academic Cooperation; and Trade Connectivity and Maritime Transport, it said. ?^SXc^RWPXa D=B2STQPcT^] PaXcXTbTRdaXch ?=BQ =4F34;78 Congress on Sunday dared Twitter India to lock its accounts, a day after the social media company locked party leader Rahul Gandhi’s handle over a post of his meeting the family of a nine-year-old Dalit girl, who died after an alleged sexual assault. @TwitterIndia lock our accounts, we challenge you. Nothing will stop us from fight- ing for justice exposing the truth, the opposition party posted along with hashtag all party members calling them- selves Rahul. The opposition party also tweeted the photo- graph of Rahul Gandhi meeting the family of the nine-year-old Dalit girl, who died after being raped by a priest and three other men at a crematorium near Delhi Cantonment. We are highly enraged with what has happened, because this is extremely selec- tive. I can write of 10 accounts, 10 handles, that have pictures, but, that is not the point, the point is that a Dalit girl, a very poor child, a 9 year old child has been gang raped, burnt alive, all that the parents have got her parts of her legs. Can you imagine how trauma- tizing that must be and some- body who want to stand with that family and ensure justice, you drop his tweet and block his account, so to Twitter I will say, ‘Daro Mat, Ye Dara Nahin Sakte Humein’, said Congress leaders Supriya Shrinate, Alka Lamba and Ragini Nayak at AICC Press conference. Shrinate regretted the fact that New India is counting more on crime against women and dalit, death tolls due to cal- lousness of government, unem- ployment and many more unfortunate things. The Congress women leaders said that Congress and their leaders will continue to fight against the incumbent rotten system. 2^]VRWP[[T]VTb CfXccTa8]SXPPUcTa APWd[´bPRR^d]c Xb[^RZTS ?=BQ =4F34;78 The National Investigation Agency (NIA) has con- ducted searches in Karnataka in connection with a human trafficking case. The searches were con- ducted on Saturday at two locations in Bengaluru City, Karnataka at the premises of a suspect, who is suspected to be involved in making fake ID proof documents for the Bangladeshi traffickers and the trafficked victims. During the searches, vari- ous incriminating documents, six digital devices including hard disks and mobile phones used for making the forged documents were seized, the agency said. “The women were traf- ficked from Bangladesh to India by accused persons on the pretext of providing jobs in India but were forced into prostitution instead,” the agency said in a statement. The case was originally registered on June 8, 2021 at Ramamurthy Nagar Police Station, Bengaluru City against 13 accused persons relating to a raid conducted by Karnataka Police at a rented house where seven Bangladeshi women and one child were rescued from the custody of human traffick- ers. The NIA had re-registered the case July 13 under various Sections of the Indian Penal Code, Foreigners Act, 1946 and relevant provisions of the Immoral Traffic (Prevention) Act, 1956. =80R^]SdRcbbTPaRWTbX]:´cPZP X]WdP]caPUUXRZX]VRPbT ?=BQ =4F34;78 The intensity of rainfall over sub-Himalayan West Bengal and Sikkim is likely to increase from August 11-12 as the monsoon trough has shift- ed close to the foothills, the India Meteorological Department (IMD) said on Sunday. IMD Director General Mrutunjay Mohapatra said the monsoon trough is moving towards the western foothills of the Himalayas. He said rainfall is likely to decrease over north Indian plains and increase over the hills. The entire monsoon trough is likely to shift close to the foothills of the Himalayas during the next 24 to 48- hours, the IMD said. A cyclonic circulation lies over northeast Madhya Pradesh, it added. Under the influence of these systems, widespread rain- fall activity with isolated heavy falls is very likely over north- east and sub-Himalayan West Bengal and Sikkim during the next five days, the IMD said. Due to stronger south- westerly or southerly winds from the Bay of Bengal, the intensity of rainfall is very likely to increase over these areas from August 11.Isolated heavy to very heavy falls are likely in the region on August 11 and 12, the IMD said. Fairly widespread rainfall over Uttarakhand, northern parts of Uttar Pradesh, Bihar, Jharkhand and gangetic West Bengal is likely during the next four-five days, Mohapatra said. Rainfall with isolated heavy falls is very likely over Madhya Pradesh and east Rajasthan during next two days with sig- nificant reduction in intensity and distribution thereafter, he added. Subdued rainfall is very likely over peninsular India, including Maharashtra and Gujarat, and excluding Kerala, Mahe and Tamil Nadu, where isolated heavy falls are very likely during the next four-five days, the IMD added. 0RUHUDLQOLNHOIRU%HQJDO6LNNLP IURP$XJXVWIRUHFDVWV,0' 7ZHHWVYLGHRRILWV PHPEHUVVHHNLQJ GLVFXVVLRQVLQ56
- 5. ]PcX^]$ 347A03D=k=30H k0D6DBC (!! C=A067D=0C70Q D108 In a big relief to Mumbaikars, the Maharashtra Government on Sunday announced that fully vac- cinated people could travel by suburban local trains in Mumbai from August 15, with a rider that a gap of 14 days was mandatory after taking the second dose of vac- cine to the board train. After weeks of speculation, the Maharashtra Government relaxed the norms to allow Mumbaikars and their counter- parts in the satellite towns in Mumbai Metropolitan Region (MMR) – who have taken two doses of vaccine --to travel by sub- urban trains on a condition that the 14 days’ gap was mandatory for the people to board trains after taking the second dose of vaccine. Interacting with the people across the state through a webcast, Maharashtra chief minister Uddhav Thackeray said: “From August 15, people who have taken two doses of vaccine can travel by suburban local trains. But, the people will have to wait for 14 days after taking the second dose of vac- cine to board the train”. The chief minister said that the fully vaccinated people could get their train passes that will be avail- able on smart phones, ward offices and suburban railway stations. Passengers can download train passes through the mobile app. Those who do not have smart phones can take photo passes from municipal ward offices in the city as well as suburban railway sta- tions,” Uddhav said. The chief minister said that the state government might announce more relaxations for shops, malls, restaurants and places of religious worship after the state disaster management task force reviews the situation on Monday. The chief minister said that the second wave of Covid-19 was still not over. “If we have to arrest the spread of virus, then the people will have to follow the pandemic pro- tocols strictly. Though the pace of vaccination has increased, but it is not sufficient. 5d[[hePRRX]PcTSRP]caPeT[X] dQPXcaPX]bUa^0dV $ Guwahati: Raijor Dal chief Akhil Gogoi on Sunday said that an alliance of regional parties under the leadership of West Bengal Chief Minister Mamata Banerjee is in the making to oust the BJP from power at the Centre in 2024. The Independent MLA from Assam also claimed that Banerjee has invited him to merge Raijor Dal with the Trinamool Congress (TMC), and a decision in this regard is likely to be taken at his party's executive meeting during the day. We aim to form a confederation of regional forces and project Mamata Banerjee as its leader to remove the Narendra Modi government from power in 2024, he told reporters. Gogoi claimed that Banerjee has assured him of the TMC Assam unit president's post if Raijor Dal is merged with the ruling party in West Bengal. He said that three rounds of talks between the TMC and Raijor Dal over the issue have already taken place, with the legis- lator visiting Kolkata for discussions. Assam TMC president Gopinath Das said that the talks were held in the West Bengal capi- tal. There were no talks with Raijor Dal in Assam. Madam (Mamata Banerjee) is pursuing it, he said. The TMC does not have any MLA in the Assam assembly at present. Gogoi said that Raijor Dal's efforts to form a confederation of region- al parties is in keeping with its belief in the federal structure and the need to strengthen it. The Sibsagar MLA scripted his- tory this year by becoming the first person in Assam to win an assem- bly election from behind the bars. Jailed since December 2019 for his alleged role in violent anti-CAA stir in the Assam, Gogoi walked out free on July 1 this year after a special NIA court cleared him of all charges. PTI B0D60AB4=6D?C0Q :;:0C0 The Trinamool Congress on Sunday launched a fierce attack on the BJP for unleashing a reign of terror in Tripura and vowed to uproot the Biplab Deb Government from the north-east- ern State in 2023 Assembly elections. The TMC’s reaction came a day after alleged BJP men attacked Trinamool youth wing lead- ers from Bengal who were visiting Tripura’s Dhalai district to attend a party programme in pursuance of Bengal Chief Minister Mamata Banerjee’s bid to expand her party’s base in the North East and elsewhere in the country. “Tripura is a big sample of Narendra Modi’s double-engine government … where the oppo- sition men are attacked every day … there is no law and order in this State … the Biplab Deb Government is running reign of terror in Tripura and the Trinamool Congress has come to liberate the local people from the BJP’s oppression,” Trinamool Congress national gen- eral secretary Abhishek Banerjee who rushed to the north-eastern State on Sunday said. A cavalcade of TMC youth leaders includ- ing Jaya Dutta, Sudip Raha and Debangshu Bhattacharya were on Saturday attacked and their vehicles’ were damaged by BJP men, the Trinamool leadership alleged adding the police stood a silent spectator. Subsequent to the attack 14 TMC men including the Bengal leaders were arrested by the police under National Disaster Management laws. They were granted bail on Sunday by local court. Banerjee rushed to Agartala on Sunday along with fellow MP Dola Banerjee and Bengal min- ister Batya Basu. “Instead of reaching them to the hospital or providing them with basic medical help the injured leaders were arrested by the police,” Banerjee who is also the nephew of the Bengal Chief Minister said wondering “is Tripura out- side India? … does the Indian laws not apply in this region? … in every street corner the BJP men are standing armed with weapons and wherev- er our leaders are going they are attacking them with rods, lathis, brickbats … is this the sample ofModi’s double-engine Government.” Earlier Banerjee tweeted “the GOONS of BJP have shown their TRUE COLOURS! This bar- baric attack on Trinamool workers reveals the ''GOONDA RAJ'' in Tripura under Biplab''s Govt! Your threats and attacks only prove your inhu- manity. DO WHAT YOU CAN~CHECK~Trinamoolwill not budge an INCH!” :LOOXSURRW0RGL'HEGRXEOH HQJLQH*RYWVDV$EKLVKHN 7X]SdSTe^cTTbcPZTPSX_X]cWTU[^^STS6P]VPaXeTa^]cWT^RRPbX^]^U³7PaXhP]X0PePbWhPUTbcXeP[X]?aPhPVaPY^]Bd]SPh ?C8 Mumbai: Shiv Sena MP Sanjay Raut on Sunday said unless the 50 per cent cap on reservations is relaxed, the constitutional amendment on allowing states to prepare their own OBC list will not help and the Maratha quota cannot be restored. Talking to reporters here after meeting Shiv Sena presi- dent and Maharashtra Chief Minister Uddhav Thackeray, Raut said he discussed the issue and developments regard- ing it in Parliament with the CM. He said state Public Works Department Minister Ashok Chavan will hold a virtual meeting to inform leaders of all political parties about the sta- tus of the issue of Maratha quota, which was quashed by the Supreme Court earlier this year. The demand for a debate will be raised when the consti- tutional amendment issue comes up in Parliament, the Rajya Sabha member said. Unless the 50 per cent cap is relaxed, the Maratha quota cannot be restored, he said. The Union Cabinet is learnt to have cleared a Constitution amendment bill that seeks to give power to states and UTs to make their own OBC lists. The bill will now be intro- ducedinParliamentforpassage, sources said in Delhi on Wednesday. PTI Chennai: Vaccine hesitancy was prevalent among 27.6 per cent of people aged above 60 years while the same was pre- sent in 16.9 per cent between the age group of 18 and 44 years, a study by the Tamil Nadu government revealed on Sunday. As many as 18.2 per cent of people between the age group of 45 and 59 years were also hesitant to receive the jabs, the survey conducted by the Directorate of Public Health and Preventive Medicine, in July across Tamil Nadu, said. According to the study, vaccine hesitancy was observed in 19.7 per cent men and 18.4 per cent women, while 17.5 per cent people living in urban and 20.3 per cent in rural areas expressed unwillingness to get inoculated. Some of the reasons for the vaccine hesitancy was fear of injections (48.4 per cent), fear of complications after receiving the jabs (57.6 per cent), long queue to get the jabs (22.5 per cent), no person to accompany (21 per cent). About 59.9 per cent peo- ple faced difficulty in collect- ing details on where to receive the vaccines, while 24.5 per cent doubted the efficacy of the vaccines. The sample size was 1,596 people between 18-45 years, 771 between 45 and 59 years and 488 above the age of 60 years. As many as 1,401 men and 1,453 women were covered in the survey conducted in the state. Vaccine acceptance was prevalent among 83.1 per cent people between 18-44 years , while it was 81.8 per cent between 45-59 years and 72.4 per cent above the age of 60 years. Nearly 82.5 per cent of those residing in urban areas and 79.7 per cent in rural areas were willing to get vaccinated, while 82.8 per cent people said the reason to get vaccinated was to prevent dis- ease while 23.7 people said it prevents spread to others. Following the results from the study, the department of public health said it would focus on awareness activities to address the mis- conceptions. PTI #)`W'!aV`a]VdY`h gRTTZ_VYVdZeR_Tj+DefUj APdc)D][Tbb$RP_ aT[PgTSPaPcWP`d^cP RP]³cQTaTbc^aTS C=A067D=0C70Q D108 The daily Covid-19 deaths dropped to 151 and infections came down to 5,508 in Maharashtra on Sunday, even as 4,895 patients were discharged after full recov- ery from various hospitals across the state. After the fatalities remained static at 187 for two consecutive days, the daily deaths came down to 151, while the infections came down from 6,061 on Saturday to 5,508 on Sunday. With 151 fresh fatalities, the total number of deaths in the state increased from 1,33,845 to 1,33,996, while the infec- tions -- with 4,895 new cases – climbed from 63,47,820 to 63,53,328. As 4895 patients were discharged from the hospitals across the state after full recovery, the total number of people dis- charged from the hospitals since the sec- ond week of March last year increased from 61,39,493 to 61,44,388. The recov- ery rate in the state dropped from 96.72 per cent to 96.71 per cent. The total “active cases” in the state increased from 71,050 to 71,510. The fatal- ity rate in the state stood static at 2.1 per cent. 78C:0=370A8Q 90D The iconic 'Clock tower' located in the heart of Srinagar at Lal Chowk, which mostly remained out of bounds especially for those interested in unfurling the national flag during Republic day and Independence day celebrations during trouble-torn years, has now been illuminated with 'Colors of India' by the Srinagar Municipal Corporation (SMC) in the run up to the 75th Independence day celebrations. The Mayor of Srinagar Municipal Corporation Junaid Azim Mattu was the first to post images of the illuminated clock tower on his twitter time- line. “We have illuminated the Clock Tower (‘Ghanta Ghar’) at Lal Chowk in colors of the Tricolour ahead of Independence Day. New clocks fitted”, tweeted Mattu. Netizens celebrated the decision to illuminate and con- gratulated the Mayor of Srinagar. The same has now become the hot-spot for tourists and local visitors as they can be seen posing for a selfie and family pix in front of the illuminated clock tower during late evening stroll in the area. Another tourist landmark in the capital city, popularly known as ' Zero bridge', has also been lit up in the same color scheme to attract visitors during the week-long celebra- tions marking the I-day cele- brations. The historic Lal Chowk has witnessed many historic events and political gatherings in the past. Top leaders of the country including former Prime Minister Jawahar Lal Nehru, founding president of the National Conference Sheikh Mohd Abdullah have made historic speeches in front of thousands of local residents. ORFNWRZHUDW/DOKRZN LOOXPLQDWHGLQ,QGLDQFRORXUV 0DKDWROO GLSVWR ?=BQ ;D2:=F Giving an indication that many sitting legislators, including Ministers, could be denied ticket in the coming assembly elections, Bharatiya Janata Party's national presi- dent Jagat Prakash Nadda said that performance would be the criterion for ticket distrib- ution. “Non-performing minis- ters and MLAs will not get tick- ets this time,” Nadda said dur- ing the organisational meeting of Braj region held in Agra on Sunday. In the meeting, which was attended by Uttar Pradesh Chief Minister Yogi Adityanath, BJP state leaders and ministers, Nadda said that performance would be the only yardstick to decide tickets and people (legislators and minis- ters) still had time to pull up their socks. He added that the road to forming a government in UP in 2022 passed through the Braj region. The BJP national presi- dent instructed all the MLAs and party’s state office-bearers to improve coordination between the organisation and the government. Along with this, he directed senior party leaders to spend the night at a booth. Now the workers should start strengthening the party at the booth level. Educate people about the schemes of the state and Central governments. Strengthen the booth and increase the number of work- ers. The programmes of the organisation have to be imple- mented cent per cent at the ground, he said and asked leaders to think how to make the organisation strong. Chief Minister Yogi Adityanath, in his speech, elab- orated on the development works being done in the Braj region. He said SN Medical College would have a super specialty hospital and pro- posed the Chhatrapati Shivaji Maharaj museum along with medical colleges in Firozabad and Etah. The chief minister said that during the COVID-19 pandemic when the opposition was sleeping the government was working to extend help to the people. He asked party workers to take the achieve- ments of the government to the people. “The opposition will try to defame us. Defeat their nefar- ious designs,” he said. BJP state president Swatantra Dev Singh instruct- ed the leaders to strengthen the party at booth level and carry out the proposed programmes of the organisation with enthu- siasm. “The party’s identity is from the organisation itself. Organisation should be every- thing for you,” he added. Party’s national general secretary (organisation) BL Santosh, state in-charge Radha Mohan Singh, state general secretary (organisation) Sunil Bansal and Deputy Chief Ministers Dr Dinesh Sharma and Keshav Prasad Maurya also attended the meeting. Over 50 MLAs, seven min- isters and five MLCs from the Braj region attended the meet- ing. Among the state ministers, Chaudhary Laxmi Narayan, Shrikant Sharma, Ramnaresh Agnihotri, Sandeep Singh, Mahesh Gupta, Chaudhary Udaybhan Singh and Dr GS Dharmesh attended the meet- ing. 3HUIRUPDQFHWREHFULWHULRQ IRUWLFNHWGLVWULEXWLRQ1DGGD New Delhi: Assam Chief Minister Himanta Biswa Sarma will meet Prime Minister Narendra Modi on Monday to discuss the Assam-Mizoram border issue and the restoration of peace in the entire north-east. The Chief Minister, accompanied by BJP MPs from Assam, will also meet other Union Ministers including Home Minister Amit Shah. According to sources, the ongoing unrest on the Assam-Mizoram border, as well as restoration of peace in the entire north-east will be the center of discussions during these meetings. Sarma, who is in New Delhi since Saturday, was unable to meet Shah earlier due to some reasons. Sources also said that the Assam Chief Minister also held one-on-one meetings with the state's BJP MPs on Sunday. Last month, tensions heightened between Mizoram and Assam over the boundary dispute after six Assam policemen and one civilian were killed in a fierce gun battle between two states on July 26. However, the two states in a joint state- ment agreed to take forward the Centre's ini- tiative of letting neutral forces patrol the dis- puted areas of the inter-state border for maintaining peace. Agencies 7XP]cPc^TTc? ^eTa0bbPXi^aP Q^aSTaSXb_dcT PPcP[TSP[[XP]RT^UaTVX^]P[ _PacXTbX]PZX]Vc^d]bTPc19? X]!!#bPhb0ZWX[6^V^X Aizawl/Silchar/Hailakandi/G uwahati: Long lines of trucks from the rest of the country rumbled into Mizoram across a disputed border with neigh- bouring Assam on Sunday, some 13 days after a bloody clash between the police forces of the two States. After assurances of police escorts given on Saturday, truckers in ones and twos start- ed moving out of Dholai near the tense border. where they had parked their trucks, ever since violence broke out. What was a trickle on Saturday night became a flood of vehicles moving in convoys, guarded by police escorts, fer- rying essential supplies includ- ing medicines, diesel and cook- ing gas to landlocked Mizoram, which had been complaining of shortages of medicines and gasoline. Truckers had kept their trucks parked and refused to move even after an informal blockade enforced by locals in Assam soon after violence broke out was lifted more than a week back. They started moving after two Assam Ministers Ashok Singhal and Parimal Suklabaidya on Saturday con- vinced them it was safe to trav- el across the border to Mizoram. Suklabaidya said move- ment of essential commodities from Hailakandi district to Mizoram, which had been hit since the violent face-off between the two states, too resumed from Sunday. Transportation through rail would begin once tracks, which were damaged during demonstrations following the July 26 flare-up, are repaired, he added. Kolasib Superintendent of Police (SP), Vanlalfaka Ralte said more than 50 vehicles have entered Mizoram since Saturday night till Sunday morning. “Traffic movement between the two neighbouring states as of now is quite smooth…However, we are still on alert as untoward incident can happen at any time,” Ralte, who is camping at Vairengte, told PTI over the phone. Cachar Superintendent of Police Ramandeep Kaur also confirmed to PTI that vehicles “have been moving under heavy police escorts. PTI CadRZX]VaTbdTb^eTa0bbP Xi^aP³bSXb_dcTSQ^aSTa* aPX[fPh[X]Tc^QTaTbc^aTSb^^] ?C8 Q 14=60;DAD Former Karnataka Chief Minister B S Yediyurappa on Sunday urged Chief Minister Basavaraj Bommai to withdraw his order to give him cabinet rank status. I request you to provide me only those facilities which are given to an immediate for- mer chief minister and with- draw the order giving me a cab- inet rank, Yediyurappa said in his letter to Bommai, which was made available to the media. Bommai on Saturday had ordered giving facilities similar to a minister to Yediyurappa. Yediyurappa had resigned on July 26, which coincided with the completion of his two years'' term in the office. A day after his resignation, Yediyurappa had proposed Bommai''s name as the leader at the BJP legislature party meet and was accordingly accepted by all and on July 28 Bommai took oath as the new Chief Minister. PTI ?C8 Q =060= Assam Government has acquired the land and house that once belonged to Bhupen Hazarika at Kuthori near the Kaziranga National Park to set up a cultural centre, an official said on Sunday. Kaliabor Sub-divisional Officer P K Das had hand- ed over the seven bighas of land to the cultural depart- ment last month.The Assam government proposes to set up a cultural project at the site in Nagaon district, which will include a museum, a cinema hall and a library to preserve Hazarika''s creations, including his songs and literary works, he said. The Bharat Ratna awardee had bought the land under the Kaliabor sub-division in 1974 and built a house, naming it ''Apun Ghar'' (home of one''s own). He also had plans to set up a cultural centre there, fam- ily members said. Hazarika had created several ever- green songs and written many literary pieces at this house. Due to some unavoidable circumstances, howev- er, he had to sell both the land and the house, but his fans and intellectuals had urged the state government to acquire those and set up a cultural centre in his memory. PTI 0bbP6^ec_[P]bc^bTcd_ Rd[cdaP[RT]caTPc1Wd_T] 7PiPaXZPb:dcW^aXW^dbT ?T^_[TRPaahcWTXaTbbT]cXP[QT[^]VX]VbPbP]=3A5cTPTePRdPcTb_T^_[TSdaX]VPaTbRdT^_TaPcX^]PccWTU[^^STSPadcWX =PVPaR^[^]hX]EPaP]PbX^]Bd]SPh ?C8 1BHPbZb:cPZP2c^fXcWSaPf^aSTa VXeX]VWX2PQX]TcX]XbcTabcPcdb