SlideShare a Scribd company logo
1 of 51
1
Rationale and Uses For a Public HIV DrugRationale and Uses For a Public HIV Drug
Resistance DatabaseResistance Database
Bob Shafer, MDBob Shafer, MD
Professor of Medicine and by Courtesy PathologyProfessor of Medicine and by Courtesy Pathology
(Infectious Diseases)(Infectious Diseases)
2
OutlineOutline
• HIV drug therapy essentials
• HIVDB
• Examples of public health applications
• Surveillance of transmitted drug resistance
• Genetic mechanisms of acquired drug resistance
HIV-1 Genome
HIV Replication and Targets of Therapy
5
AAntintirretroetrovviral Inhibitors (ARVs)iral Inhibitors (ARVs)
AZT
1990 1995 2000 2005
ddI
d4TddC
3TC
SQV
RTV
IDV
NVP
TDFABC
NFV
APV
DLV
EFV
LPV ATV
T20
TPV DRV RAL
MVC
FTC ETR
Nucleoside
RT Inhibitor
Nonnucleoside
RT inhibitor
Protease
Inhibitor
Fusion
Inhibitor
CCR5
Inhibitor
Integrase
Inhibitor
6
HIV Genetic VariationHIV Genetic Variation
• Generation of variation
• High mutation rate
• Recombination
• Proviral DNA “archive”
• Selective evolutionary pressures
• Immunological
• Antiretroviral drugs (ARVs)
Tebit DM, Arts EJ. Tracking a century of global expansion and evolution of HIV. Lancet Infect Dis 2011
8
HIV-1 RT: Active Site, Template, Primer, and dNTP
Incoming nucleotide
Active site
9
NNRTI Resistance Mutations
Etravirine
NNRTI resistance mutations
Active site
HIV-1 Protease Drug Resistance Mutations
Active site & substrate cleft
Lopinavir Major resistance mutations
Minor resistance mutations
Models Relating HIV Drug Resistance to Treatment
Response
12
10 Million Patients on Antiretroviral Therapy
2013 Global AIDS Response Progress Reporting (WHO/UNICEF/UNAIDS)
13
OutlineOutline
• HIV drug therapy essentials
• HIVDB
• Examples of public health applications
• Surveillance for transmitted drug resistance
• Genetic mechanisms of acquired drug resistance
14
Database RationaleDatabase Rationale
• Drug resistance knowledge important for

Interpreting genotypic resistance tests

Designing surveillance studies and public health decisions

Assisting drug development.
15
How we know what we know about HIVHow we know what we know about HIV
drug resistance mutationsdrug resistance mutations
• Genotype-treatment correlations – 1998
• Genotype-phenotype correlations – 2002
• Genotype-outcome correlations – 2005
16
Database RationaleDatabase Rationale
• Large amounts of drug resistance data are important for
generating drug-resistance knowledge.
• Uniform representation of 3 main data correlations
facilitates meta-analyses.
Genotype-Rx
Genotype-Phenotype
Genotype-Outcome
Clinical management
Epidemiologic studies
Drug development
http://hivdb.stanford.edu
Genotypic HIV Resistance Testing
CCTCAGATCACTCTTTGGCAACGACCCATAGTCACAATAAAGATAGCGGGACAACTAAAGGAAGCTCTATTAGATACAGGAGCAGATGATACAGT
ATTAGAAGAAATGAATTTGCCAGGAAAATGGAAACCAAAAATAATAGTGGGAATTGGAGGGTTTACCAAAGTAAGACAGTATGATCATGTACAAAT
AGAAATCTGTGGACATAAAGTTATAGGTGCAGTATTAATAGGACCTACACCTGCCAATATAATTGGAAGAAATCTGTTGACTCAGCTTGGCTGTAC
TTTAAATTTT
PQITLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMNLPGKWKPKIIVGIGGFTKVRQYDHVQIEICGHKVIGAVLIGPTPANIIGR
NLLTQLGCTLNF
Differences from Consensus B:
L10I, G17R, K20I, E35D, N37S, M46I, I62V, L63P, A71I, G73S, I84V, L90M, I93L
HIV-1 Genotypic Resistance Testing: Online Interpretation
Meaningful Results
(1) Quality control
(2) Sequence Interpretation
(3) Literature references
(4) Clinical education / advice
Shafer RW et al. HIV-1 RT and Protease Search Engine for Queries. Nat Med 2000
HIVdb: Genotypic Resistance Interpretation
http://hivdb.stanford.edu
HIVdb: Genotypic Resistance Interpretation
HIVdb: Genotypic Resistance Interpretation
HIVdb: Genotypic Resistance Interpretation
24
Surveillance for Transmitted Drug
Resistance
25
OutlineOutline
• HIV drug therapy essentials
• HIVDB
• Examples of public health applications
• Surveillance for transmitted drug resistance
• Genetic mechanisms of acquired drug resistance
26
Rationale for Surveillance for Drug ResistanceRationale for Surveillance for Drug Resistance
in ARV-Naive Populationsin ARV-Naive Populations
• Assess extent of transmitted drug resistance (TDR).
• Monitor the expected efficacy of first-line therapies.
27
Challenges to ARV-Resistance SurveillanceChallenges to ARV-Resistance Surveillance
• There is no perfect definition of genotypic resistance.
• There are many different drug-resistance mutations (DRMs).
• Drug resistance mutations occasionally occur in the absence
of selective drug pressure. Therefore, not all drug-resistance
mutations are evidence for transmitted drug resistance
(TDR).
28
Challenges to ARV-Resistance SurveillanceChallenges to ARV-Resistance Surveillance
• More than 300 studies of genotypic resistance in ARV-
naïve patients have been published.
• Findings differ by region, time, study population, and
potentially study methods.
29
Surveillance Drug Resistance Mutations (SDRMs)Surveillance Drug Resistance Mutations (SDRMs)
• Drug-resistance mutations with a high sensitivity and specificity
for detecting selective ARV pressure.
• Nonpolymorphic.
• Applicable to all HIV-1 subtypes.
Shafer RW, et al. HIV drug resistance mutations for
drug resistance surveillance. AIDS 2007
30
HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations:
Analysis of Published RT and PR SequencesAnalysis of Published RT and PR Sequences
• Well-characterized representative population of ARV-
naïve persons.
• Country and year of virus isolation known.
• HIV-1 RT ± PR sequence is publicly available.
31
Calibrated Population Resistance Analysis ToolCalibrated Population Resistance Analysis Tool
Gifford, RJ et al. The calibrated population resistance tool: standardized
genotypic estimation of transmitted HIV-1 drug resistance. AIDS 2008
• Standardized approach
to handling missing data
and poor sequence
quality.
• Applies SDRM list to a
set of sequences
• Backward-compatibility
HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations:
Prevalence by RegionPrevalence by Region
Region No.
Studies
No.
Persons
% Resistance
Median
% Resistance
IQR
North America 24 11,038 11.4 8.8 – 14.0
Europe 44 11,419 9.3 6.0 – 15.1
Latin America 39 5,802 7.6 4.0 – 10.1
High-income Asia 11 3,190 5.5 3.5 – 9.0
Former Soviet Union 11 1,124 3.4 0.0 – 6.4
South/Southeast Asia 49 4,181 3.3 2.0 – 5.3
Sub-Saharan Africa 86 9,904 2.8 1.1 – 5.7
264 46,660
33
887 1529
<=1
1538
<=3
1343
4
1803
<=6
1200
7
1449
<=14
Years Since AR
0
4
8
Overall
0
4
8
NRTI
0
4
8
NNRTI
%Resistance
0
4
8
PI
Sub-Saharan Africa
HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations:
Sub-Saharan AfricaSub-Saharan Africa
http://hivdb.stanford.edu/surveillance/map/
34
South/Southeast Asia
495 512
<=2
858
3
556
4
877
<=6
811
<=9
Years Since AR
0
4
8
Overall
0
4
8
NRTI
0
4
8
NNRTI
%Resistance
0
4
8
PI
HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations:
South / Southeast AsiaSouth / Southeast Asia
http://hivdb.stanford.edu/surveillance/map/
35
HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations:
Most Common SDRMs by Region and ARV ClassMost Common SDRMs by Region and ARV Class
36
• Significant differences in prevalence of resistance in ARV-
naïve patients by region and year.
• Transmitted NNRTI resistance is increasing in Sub-
Saharan Africa and South/Southeast Asia.
• Analysis of data from many studies is required to obtain
meaningful estimates of transmitted drug resistance.
HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations:
ConclusionsConclusions
37
OutlineOutline
• HIV drug therapy essentials
• HIVDB
• Examples of public health applications
• Surveillance for transmitted drug resistance
• Genetic mechanisms of acquired drug resistance
38
RationaleRationale
• In resource-limited regions, ~25% of patients receiving
first-line ART develop virological failure within 1 year.
• Drug-resistance mutations are detected in 50% to 90%
of patients with virological failure.
• Regimens used in resource-limited countries differ from
those used in well-resourced countries.
• Patients in resource-limited countries are monitored
infrequently and second-line therapy is chosen without
genotypic resistance testing.
39
Genetic Mechanisms of Resistance in PatientsGenetic Mechanisms of Resistance in Patients
with Virological Failurewith Virological Failure
• Choosing second-line therapy.
• Developing point-of-care (POC) diagnostic tests.
40
WHO-Recommended First-Line ARV RegimensWHO-Recommended First-Line ARV Regimens
WHO-Recommended Regimens, 2016 to 2013
NRTI NRTI NNRTI / PI
d4T (being phased out) 3TC (or FTC) EFV
AZT NVP
TDF LPV (PI, 2nd
line)
ABC (children)
41
Number of Patients by Regimen and SubtypeNumber of Patients by Regimen and Subtype
A B C AE AG D G Misc Total
d4T/3TC/NVP 50 55 121 430 123 27 122 40 1121
AZT/3TC/NVP 45 99 394 45 50 42 46 21 469
d4T/3TC/EFV 13 92 188 16 9 2 3 11 540
AZT/3TC/EFV 25 244 274 45 20 17 26 11 576
133 490 977 536 202 88 197 83 2706
Data summary from mid 2012
42
Sources of Patient Data and SequencesSources of Patient Data and Sequences
Number Studies Number Patients %
10 largest 1,409 51%
20 largest 1,981 72%
50 largest 2,640 98%
Data summary from mid 2012
43
Question From WHO: Which NRTI should beQuestion From WHO: Which NRTI should be
substituted in patients stopping d4T?substituted in patients stopping d4T?
• Patients with virological failure on d4T can develop resistance by
two mutually exclusive mutational pathways:
• Thymidine analog mutations: cross-resistance to AZT
• Non-thymidine analog mutations particularly K65R: cross-resistance to
TDF and increased susceptibility to AZT
• In vitro studies have shown that viruses belonging to subtype C
are at increased risk for developing K65R.
44
Impact of NNRTI, Subtype, and Years on NRTI-Impact of NNRTI, Subtype, and Years on NRTI-
Resistance Mutations in 1,840 Patients Receiving d4TResistance Mutations in 1,840 Patients Receiving d4T
45
Impact of Subtype on AZT and TDF Cross-Resistance inImpact of Subtype on AZT and TDF Cross-Resistance in
1,840 Patients Receiving d4T1,840 Patients Receiving d4T
46
Rationale for Point-Of-Care (POC) Resistance TestingRationale for Point-Of-Care (POC) Resistance Testing
in Low/Middle-Income Countries?in Low/Middle-Income Countries?
• POC test for detecting virological failure have been
developed.
• A POC resistance test for a limited number of the most
important mutations could be used:
• To confirm virological failure
• To suggest among second-line therapy options
• Be used prior to therapy in regions with elevated TDR or in
patients with uncertain treatment history.
47
Sensitivity for Detecting Resistance after 1st-LineSensitivity for Detecting Resistance after 1st-Line
Failure: 4 NNRTI and 6 NRTI-Resistance MutationsFailure: 4 NNRTI and 6 NRTI-Resistance Mutations
48
Sensitivity for Detecting Resistance in UntreatedSensitivity for Detecting Resistance in Untreated
Patients: 4 NNRTI and 6 NRTI-Resistance MutationsPatients: 4 NNRTI and 6 NRTI-Resistance Mutations
49
ConclusionsConclusions
• Drug resistance knowledge is important for interpreting genotypic
resistance tests, designing surveillance studies, and drug
development.
• Large amounts of drug resistance data are important for
generating drug-resistance knowledge.
• Drug-resistance data consists mostly of correlations between
genotype-treatment, genotype-phenotype, and genotype-
virological outcome.
50
Acknowledgements
Funding
NIAID – Division of AIDS
Bill and Melinda Gates Foundation
Database / Data analysis
Soo-Yon Rhee, M.S.
Tommy Liu, B.S.
Michele Tang, M.D.
Vici Varghese, Ph.D.
51
5.0
6.0
4.0
3.0
2.0
1.0
-4 0 4 8 12 16 20 24 28 32 36 40 44
PlasmaHIV-1RNAlogcopies/ml
Ibalizumab Infusions
Accompanying antiretrovirals: etravirine + enfuvirtide
1997 2009
97 98 99 00 01 02 03 04 05 06 07 08 09
April 2010June 2009
Below the level of quantification Below the level of quantification
HIV-1 levels prior to TMB-202 HIV-1 levels during and following TMB-202
EFV
ENF
DRV + RAL
A B
HIV-1 Evolution and Drug Resistance:
An Example
Fessel WJ, et al. The efficacy of an anti-CD4 monoclonal
antibody for HIV-1 treatment. Antivir Res 2011

More Related Content

What's hot

Recent Advances in Antiretroviral Therapy
Recent Advances in Antiretroviral TherapyRecent Advances in Antiretroviral Therapy
Recent Advances in Antiretroviral TherapyHtet Wai Moe
 
Pawlotzky du hepatites-resistance
Pawlotzky  du hepatites-resistancePawlotzky  du hepatites-resistance
Pawlotzky du hepatites-resistanceodeckmyn
 
Antiretroviral therapy failure
Antiretroviral therapy failureAntiretroviral therapy failure
Antiretroviral therapy failureParvez Pathan
 
Antiretroviral therapy switch
Antiretroviral therapy switchAntiretroviral therapy switch
Antiretroviral therapy switchParvez Pathan
 
Mechanism of resistance to target therapy
Mechanism of resistance to target therapyMechanism of resistance to target therapy
Mechanism of resistance to target therapyVito Lorusso
 
D3 Retroviral Review Duffus
D3 Retroviral Review DuffusD3 Retroviral Review Duffus
D3 Retroviral Review DuffusDSHS
 
Preventing and managing sexually transmitted diseases in hiv infected patient...
Preventing and managing sexually transmitted diseases in hiv infected patient...Preventing and managing sexually transmitted diseases in hiv infected patient...
Preventing and managing sexually transmitted diseases in hiv infected patient...Hivlife Info
 
A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...
A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...
A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...spa718
 
Research Paper presentation on " Antiviral activity of Acacia nilotica agains...
Research Paper presentation on "Antiviral activity of Acacia nilotica agains...Research Paper presentation on "Antiviral activity of Acacia nilotica agains...
Research Paper presentation on " Antiviral activity of Acacia nilotica agains...Zohaib HUSSAIN
 
Galena presentation
Galena presentationGalena presentation
Galena presentationGalenabio
 
Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...
Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...
Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...hivlifeinfo
 
Final Thesis!
Final Thesis!Final Thesis!
Final Thesis!BJ Miller
 
Antiretroviral therapy what a general practitioner must know
Antiretroviral therapy what a general practitioner must knowAntiretroviral therapy what a general practitioner must know
Antiretroviral therapy what a general practitioner must knowParvez Pathan
 

What's hot (20)

Recent Advances in Antiretroviral Therapy
Recent Advances in Antiretroviral TherapyRecent Advances in Antiretroviral Therapy
Recent Advances in Antiretroviral Therapy
 
Chapter 35 HIV Presentation
Chapter 35 HIV PresentationChapter 35 HIV Presentation
Chapter 35 HIV Presentation
 
Osu lesko 6 oct final
Osu lesko 6 oct finalOsu lesko 6 oct final
Osu lesko 6 oct final
 
Pawlotzky du hepatites-resistance
Pawlotzky  du hepatites-resistancePawlotzky  du hepatites-resistance
Pawlotzky du hepatites-resistance
 
Treatment of hiv
Treatment of hivTreatment of hiv
Treatment of hiv
 
Antiretroviral therapy failure
Antiretroviral therapy failureAntiretroviral therapy failure
Antiretroviral therapy failure
 
Antiretroviral therapy switch
Antiretroviral therapy switchAntiretroviral therapy switch
Antiretroviral therapy switch
 
HIV DNA Genotyping
HIV DNA GenotypingHIV DNA Genotyping
HIV DNA Genotyping
 
Mechanism of resistance to target therapy
Mechanism of resistance to target therapyMechanism of resistance to target therapy
Mechanism of resistance to target therapy
 
D3 Retroviral Review Duffus
D3 Retroviral Review DuffusD3 Retroviral Review Duffus
D3 Retroviral Review Duffus
 
Tenofovir Alafenamide: To Switch or Not To Switch
Tenofovir Alafenamide: To Switch or Not To SwitchTenofovir Alafenamide: To Switch or Not To Switch
Tenofovir Alafenamide: To Switch or Not To Switch
 
Preventing and managing sexually transmitted diseases in hiv infected patient...
Preventing and managing sexually transmitted diseases in hiv infected patient...Preventing and managing sexually transmitted diseases in hiv infected patient...
Preventing and managing sexually transmitted diseases in hiv infected patient...
 
A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...
A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...
A Randomized, Multicenter, Phase 3 Study Comparing Carfilzomib, Lenalidomide,...
 
Research Paper presentation on " Antiviral activity of Acacia nilotica agains...
Research Paper presentation on "Antiviral activity of Acacia nilotica agains...Research Paper presentation on "Antiviral activity of Acacia nilotica agains...
Research Paper presentation on " Antiviral activity of Acacia nilotica agains...
 
Galena presentation
Galena presentationGalena presentation
Galena presentation
 
Mdr tb seminar
Mdr tb seminarMdr tb seminar
Mdr tb seminar
 
Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...
Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...
Современное лечение ВИЧ: модификация АРТ у пациентов с вирусологической супре...
 
Final Thesis!
Final Thesis!Final Thesis!
Final Thesis!
 
Biomarkers in sepsis
Biomarkers in sepsisBiomarkers in sepsis
Biomarkers in sepsis
 
Antiretroviral therapy what a general practitioner must know
Antiretroviral therapy what a general practitioner must knowAntiretroviral therapy what a general practitioner must know
Antiretroviral therapy what a general practitioner must know
 

Similar to Rationale and Uses For a Public HIV Drug Resistance Database

RECENT RETROVIRAL DISEAAE GUIDELINES
RECENT RETROVIRAL DISEAAE GUIDELINESRECENT RETROVIRAL DISEAAE GUIDELINES
RECENT RETROVIRAL DISEAAE GUIDELINESAshutosh Pakale
 
nynj-nurse-mod1-09.ppt
nynj-nurse-mod1-09.pptnynj-nurse-mod1-09.ppt
nynj-nurse-mod1-09.pptdavipharm
 
Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020
Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020
Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020hivlifeinfo
 
Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...
Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...
Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...hivlifeinfo
 
Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...
Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...
Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...hivlifeinfo
 
The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...hivlifeinfo
 
The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...Hivlife Info
 
Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...
Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...
Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...Hivlife Info
 
Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...
Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...
Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...Hivlife Info
 
Human Immunodeficiency Virus Presentation
Human Immunodeficiency Virus PresentationHuman Immunodeficiency Virus Presentation
Human Immunodeficiency Virus Presentationbrinkwar
 
Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...
Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...
Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...hivlifeinfo
 
SSHC Journal Club presentation on the The Journal of Infectious Disease Volu...
SSHC Journal Club presentation on the The  Journal of Infectious Disease Volu...SSHC Journal Club presentation on the The  Journal of Infectious Disease Volu...
SSHC Journal Club presentation on the The Journal of Infectious Disease Volu...Sydney Sexual Health Centre
 
Presentation: What's trending in medicines regulation? A January 2017 reflection
Presentation: What's trending in medicines regulation? A January 2017 reflectionPresentation: What's trending in medicines regulation? A January 2017 reflection
Presentation: What's trending in medicines regulation? A January 2017 reflectionTGA Australia
 
NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...
NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...
NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...HIV Clinical Guidelines Program
 
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityPharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityGolden Helix
 

Similar to Rationale and Uses For a Public HIV Drug Resistance Database (20)

RECENT RETROVIRAL DISEAAE GUIDELINES
RECENT RETROVIRAL DISEAAE GUIDELINESRECENT RETROVIRAL DISEAAE GUIDELINES
RECENT RETROVIRAL DISEAAE GUIDELINES
 
nynj-nurse-mod1-09.ppt
nynj-nurse-mod1-09.pptnynj-nurse-mod1-09.ppt
nynj-nurse-mod1-09.ppt
 
Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020
Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020
Key Slides on ART for HIV : Evolving Concepts and Innovative Strategies.2020
 
Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...
Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...
Managing Treatment-Experienced Patients With Multidrug Resistance-Emerging Op...
 
Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...
Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...
Современное лечение ВИЧ: лечение многократно леченных пациентов с резистентно...
 
International AIDS Conference 2014: A Moderately Rapid Review
International AIDS Conference 2014: A Moderately Rapid ReviewInternational AIDS Conference 2014: A Moderately Rapid Review
International AIDS Conference 2014: A Moderately Rapid Review
 
journal.pone.0006828.PDF
journal.pone.0006828.PDFjournal.pone.0006828.PDF
journal.pone.0006828.PDF
 
The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...
 
The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...The role of integrase inhibitors in first line and later antiretroviral thera...
The role of integrase inhibitors in first line and later antiretroviral thera...
 
Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...
Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...
Highlights of AIDS 2014 .CCO Official Conference Coverage of the 20th Interna...
 
Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...
Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...
Evolving Switch Strategies for Virologically Suppressed HIV-Infected Patients...
 
Human Immunodeficiency Virus Presentation
Human Immunodeficiency Virus PresentationHuman Immunodeficiency Virus Presentation
Human Immunodeficiency Virus Presentation
 
Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...
Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...
Современное лечение и профилактика ВИЧ : передовые стратегии лечения у пациен...
 
SSHC Journal Club presentation on the The Journal of Infectious Disease Volu...
SSHC Journal Club presentation on the The  Journal of Infectious Disease Volu...SSHC Journal Club presentation on the The  Journal of Infectious Disease Volu...
SSHC Journal Club presentation on the The Journal of Infectious Disease Volu...
 
02. hiv dr di indonesia
02. hiv dr di indonesia02. hiv dr di indonesia
02. hiv dr di indonesia
 
Presentation: What's trending in medicines regulation? A January 2017 reflection
Presentation: What's trending in medicines regulation? A January 2017 reflectionPresentation: What's trending in medicines regulation? A January 2017 reflection
Presentation: What's trending in medicines regulation? A January 2017 reflection
 
Wesat2003
Wesat2003Wesat2003
Wesat2003
 
Clin Infect Dis.-2007-Hoen-381-90
Clin Infect Dis.-2007-Hoen-381-90Clin Infect Dis.-2007-Hoen-381-90
Clin Infect Dis.-2007-Hoen-381-90
 
NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...
NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...
NYSDOH AI Virologic and Immunologic Monitoring & HIV Resistance Assays Pocket...
 
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced CardiotoxicityPharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
Pharmacogenomic Prediction of Antracycline-induced Cardiotoxicity
 

More from hivlifeinfo

Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022
Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022
Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022hivlifeinfo
 
Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...
Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...
Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...hivlifeinfo
 
Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...
Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...
Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...hivlifeinfo
 
Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...
Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...
Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...hivlifeinfo
 
Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...
Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...
Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...hivlifeinfo
 
Современное лечение ВИЧ: индивидуализация стартовой АРТ /Contemporary Manage...
Современное лечение ВИЧ:  индивидуализация стартовой АРТ /Contemporary Manage...Современное лечение ВИЧ:  индивидуализация стартовой АРТ /Contemporary Manage...
Современное лечение ВИЧ: индивидуализация стартовой АРТ /Contemporary Manage...hivlifeinfo
 
Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...
Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...
Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...hivlifeinfo
 
Clinical Impact of New Data From AIDS 2020
Clinical Impact of New Data From AIDS 2020Clinical Impact of New Data From AIDS 2020
Clinical Impact of New Data From AIDS 2020hivlifeinfo
 
Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020
Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020 Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020
Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020 hivlifeinfo
 
Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...
Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...
Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...hivlifeinfo
 
Физическая активность и физические тренировки как метод профилактики сердечно...
Физическая активность и физические тренировки как метод профилактики сердечно...Физическая активность и физические тренировки как метод профилактики сердечно...
Физическая активность и физические тренировки как метод профилактики сердечно...hivlifeinfo
 
Общие принципы ведения пациентов с ХБП
Общие принципы ведения пациентов с ХБПОбщие принципы ведения пациентов с ХБП
Общие принципы ведения пациентов с ХБПhivlifeinfo
 
Симптомы заболеваний почек (краткий клинический анализ)
Симптомы заболеваний почек (краткий клинический анализ)Симптомы заболеваний почек (краткий клинический анализ)
Симптомы заболеваний почек (краткий клинический анализ)hivlifeinfo
 
Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...
Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...
Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...hivlifeinfo
 
Key Slides on Individualizing ART Management Based on Treatment Safety and To...
Key Slides on Individualizing ART Management Based on Treatment Safety and To...Key Slides on Individualizing ART Management Based on Treatment Safety and To...
Key Slides on Individualizing ART Management Based on Treatment Safety and To...hivlifeinfo
 
Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...
Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...
Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...hivlifeinfo
 
Incorporating New ART Options Into First-line and Switch Strategies for HIV C...
Incorporating New ART Options Into First-line and Switch Strategies for HIV C...Incorporating New ART Options Into First-line and Switch Strategies for HIV C...
Incorporating New ART Options Into First-line and Switch Strategies for HIV C...hivlifeinfo
 
Determining Candidacy and Strategies for ART Modification.2019
Determining Candidacy and Strategies for ART Modification.2019Determining Candidacy and Strategies for ART Modification.2019
Determining Candidacy and Strategies for ART Modification.2019hivlifeinfo
 
Innovative Paradigms for ART.2019
Innovative Paradigms for ART.2019Innovative Paradigms for ART.2019
Innovative Paradigms for ART.2019hivlifeinfo
 
Свобода интернета 2018: делегирование репрессий.Доклад Международной Агоры
Свобода интернета 2018: делегирование репрессий.Доклад Международной АгорыСвобода интернета 2018: делегирование репрессий.Доклад Международной Агоры
Свобода интернета 2018: делегирование репрессий.Доклад Международной Агорыhivlifeinfo
 

More from hivlifeinfo (20)

Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022
Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022
Дискуссии о здоровом старении с ВИЧ /Key Slides on Healthy Aging With HIV.2022
 
Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...
Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...
Основы ведения АРТ у многократно леченных пациентов 2022 / Foundations of ART...
 
Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...
Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...
Ключевые слайды по индивидуальному выбору АРТ / Key Slides on Individualized ...
 
Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...
Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...
Ключевые решения в лечении ВИЧ: оптимизация стратегии лечения для пациентов с...
 
Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...
Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...
Современное лечение ВИЧ: новые парадигмы в АРТ / Contemporary Management of H...
 
Современное лечение ВИЧ: индивидуализация стартовой АРТ /Contemporary Manage...
Современное лечение ВИЧ:  индивидуализация стартовой АРТ /Contemporary Manage...Современное лечение ВИЧ:  индивидуализация стартовой АРТ /Contemporary Manage...
Современное лечение ВИЧ: индивидуализация стартовой АРТ /Contemporary Manage...
 
Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...
Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...
Современное лечение ВИЧ: новые подходы к оптимизации АРТ/Contemporary Managem...
 
Clinical Impact of New Data From AIDS 2020
Clinical Impact of New Data From AIDS 2020Clinical Impact of New Data From AIDS 2020
Clinical Impact of New Data From AIDS 2020
 
Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020
Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020 Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020
Слайдсет о новом в лечении ВИЧ.Key Slides on What’s Hot in HIV Treatment.2020
 
Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...
Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...
Гиперлипопротеидемия(а) как опасное генетически обусловленное нарушение липид...
 
Физическая активность и физические тренировки как метод профилактики сердечно...
Физическая активность и физические тренировки как метод профилактики сердечно...Физическая активность и физические тренировки как метод профилактики сердечно...
Физическая активность и физические тренировки как метод профилактики сердечно...
 
Общие принципы ведения пациентов с ХБП
Общие принципы ведения пациентов с ХБПОбщие принципы ведения пациентов с ХБП
Общие принципы ведения пациентов с ХБП
 
Симптомы заболеваний почек (краткий клинический анализ)
Симптомы заболеваний почек (краткий клинический анализ)Симптомы заболеваний почек (краткий клинический анализ)
Симптомы заболеваний почек (краткий клинический анализ)
 
Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...
Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...
Клинические рекомендации «Алгоритмы специализированной медицинской помощи бол...
 
Key Slides on Individualizing ART Management Based on Treatment Safety and To...
Key Slides on Individualizing ART Management Based on Treatment Safety and To...Key Slides on Individualizing ART Management Based on Treatment Safety and To...
Key Slides on Individualizing ART Management Based on Treatment Safety and To...
 
Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...
Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...
Современное лечение ВИЧ.Обобщённые данные с конференции CROI 2020 / Contempor...
 
Incorporating New ART Options Into First-line and Switch Strategies for HIV C...
Incorporating New ART Options Into First-line and Switch Strategies for HIV C...Incorporating New ART Options Into First-line and Switch Strategies for HIV C...
Incorporating New ART Options Into First-line and Switch Strategies for HIV C...
 
Determining Candidacy and Strategies for ART Modification.2019
Determining Candidacy and Strategies for ART Modification.2019Determining Candidacy and Strategies for ART Modification.2019
Determining Candidacy and Strategies for ART Modification.2019
 
Innovative Paradigms for ART.2019
Innovative Paradigms for ART.2019Innovative Paradigms for ART.2019
Innovative Paradigms for ART.2019
 
Свобода интернета 2018: делегирование репрессий.Доклад Международной Агоры
Свобода интернета 2018: делегирование репрессий.Доклад Международной АгорыСвобода интернета 2018: делегирование репрессий.Доклад Международной Агоры
Свобода интернета 2018: делегирование репрессий.Доклад Международной Агоры
 

Recently uploaded

Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...Taniya Sharma
 
Call Girls Siliguri Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Siliguri Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Siliguri Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Siliguri Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...indiancallgirl4rent
 
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...Arohi Goyal
 
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...narwatsonia7
 
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...hotbabesbook
 
Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...
Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...
Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...Dipal Arora
 
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls DelhiRussian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls DelhiAlinaDevecerski
 
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...narwatsonia7
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Dipal Arora
 
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...jageshsingh5554
 
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls AvailableVip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls AvailableNehru place Escorts
 
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Call Girls Bareilly Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bareilly Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Bareilly Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bareilly Just Call 9907093804 Top Class Call Girl Service AvailableDipal Arora
 
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...aartirawatdelhi
 

Recently uploaded (20)

Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Faridabad Just Call 9907093804 Top Class Call Girl Service Available
 
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
(👑VVIP ISHAAN ) Russian Call Girls Service Navi Mumbai🖕9920874524🖕Independent...
 
Call Girls Siliguri Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Siliguri Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Siliguri Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Siliguri Just Call 9907093804 Top Class Call Girl Service Available
 
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
(Rocky) Jaipur Call Girl - 09521753030 Escorts Service 50% Off with Cash ON D...
 
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
All Time Service Available Call Girls Marine Drive 📳 9820252231 For 18+ VIP C...
 
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
Top Rated Bangalore Call Girls Mg Road ⟟ 8250192130 ⟟ Call Me For Genuine Sex...
 
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ooty Just Call 9907093804 Top Class Call Girl Service Available
 
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
Night 7k to 12k Chennai City Center Call Girls 👉👉 7427069034⭐⭐ 100% Genuine E...
 
Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...
Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...
Best Rate (Guwahati ) Call Girls Guwahati ⟟ 8617370543 ⟟ High Class Call Girl...
 
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 9907093804 Top Class Call Girl Service Available
 
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls DelhiRussian Escorts Girls  Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
Russian Escorts Girls Nehru Place ZINATHI 🔝9711199012 ☪ 24/7 Call Girls Delhi
 
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
VIP Call Girls Tirunelveli Aaradhya 8250192130 Independent Escort Service Tir...
 
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
Call Girls Bhubaneswar Just Call 9907093804 Top Class Call Girl Service Avail...
 
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
 
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
VIP Service Call Girls Sindhi Colony 📳 7877925207 For 18+ VIP Call Girl At Th...
 
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Dehradun Just Call 9907093804 Top Class Call Girl Service Available
 
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls AvailableVip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
Vip Call Girls Anna Salai Chennai 👉 8250192130 ❣️💯 Top Class Girls Available
 
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Varanasi Just Call 9907093804 Top Class Call Girl Service Available
 
Call Girls Bareilly Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bareilly Just Call 9907093804 Top Class Call Girl Service AvailableCall Girls Bareilly Just Call 9907093804 Top Class Call Girl Service Available
Call Girls Bareilly Just Call 9907093804 Top Class Call Girl Service Available
 
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
Night 7k to 12k Navi Mumbai Call Girl Photo 👉 BOOK NOW 9833363713 👈 ♀️ night ...
 

Rationale and Uses For a Public HIV Drug Resistance Database

  • 1. 1 Rationale and Uses For a Public HIV DrugRationale and Uses For a Public HIV Drug Resistance DatabaseResistance Database Bob Shafer, MDBob Shafer, MD Professor of Medicine and by Courtesy PathologyProfessor of Medicine and by Courtesy Pathology (Infectious Diseases)(Infectious Diseases)
  • 2. 2 OutlineOutline • HIV drug therapy essentials • HIVDB • Examples of public health applications • Surveillance of transmitted drug resistance • Genetic mechanisms of acquired drug resistance
  • 4. HIV Replication and Targets of Therapy
  • 5. 5 AAntintirretroetrovviral Inhibitors (ARVs)iral Inhibitors (ARVs) AZT 1990 1995 2000 2005 ddI d4TddC 3TC SQV RTV IDV NVP TDFABC NFV APV DLV EFV LPV ATV T20 TPV DRV RAL MVC FTC ETR Nucleoside RT Inhibitor Nonnucleoside RT inhibitor Protease Inhibitor Fusion Inhibitor CCR5 Inhibitor Integrase Inhibitor
  • 6. 6 HIV Genetic VariationHIV Genetic Variation • Generation of variation • High mutation rate • Recombination • Proviral DNA “archive” • Selective evolutionary pressures • Immunological • Antiretroviral drugs (ARVs)
  • 7. Tebit DM, Arts EJ. Tracking a century of global expansion and evolution of HIV. Lancet Infect Dis 2011
  • 8. 8 HIV-1 RT: Active Site, Template, Primer, and dNTP Incoming nucleotide Active site
  • 9. 9 NNRTI Resistance Mutations Etravirine NNRTI resistance mutations Active site
  • 10. HIV-1 Protease Drug Resistance Mutations Active site & substrate cleft Lopinavir Major resistance mutations Minor resistance mutations
  • 11. Models Relating HIV Drug Resistance to Treatment Response
  • 12. 12 10 Million Patients on Antiretroviral Therapy 2013 Global AIDS Response Progress Reporting (WHO/UNICEF/UNAIDS)
  • 13. 13 OutlineOutline • HIV drug therapy essentials • HIVDB • Examples of public health applications • Surveillance for transmitted drug resistance • Genetic mechanisms of acquired drug resistance
  • 14. 14 Database RationaleDatabase Rationale • Drug resistance knowledge important for  Interpreting genotypic resistance tests  Designing surveillance studies and public health decisions  Assisting drug development.
  • 15. 15 How we know what we know about HIVHow we know what we know about HIV drug resistance mutationsdrug resistance mutations • Genotype-treatment correlations – 1998 • Genotype-phenotype correlations – 2002 • Genotype-outcome correlations – 2005
  • 16. 16 Database RationaleDatabase Rationale • Large amounts of drug resistance data are important for generating drug-resistance knowledge. • Uniform representation of 3 main data correlations facilitates meta-analyses.
  • 18. Genotypic HIV Resistance Testing CCTCAGATCACTCTTTGGCAACGACCCATAGTCACAATAAAGATAGCGGGACAACTAAAGGAAGCTCTATTAGATACAGGAGCAGATGATACAGT ATTAGAAGAAATGAATTTGCCAGGAAAATGGAAACCAAAAATAATAGTGGGAATTGGAGGGTTTACCAAAGTAAGACAGTATGATCATGTACAAAT AGAAATCTGTGGACATAAAGTTATAGGTGCAGTATTAATAGGACCTACACCTGCCAATATAATTGGAAGAAATCTGTTGACTCAGCTTGGCTGTAC TTTAAATTTT PQITLWQRPIVTIKIAGQLKEALLDTGADDTVLEEMNLPGKWKPKIIVGIGGFTKVRQYDHVQIEICGHKVIGAVLIGPTPANIIGR NLLTQLGCTLNF Differences from Consensus B: L10I, G17R, K20I, E35D, N37S, M46I, I62V, L63P, A71I, G73S, I84V, L90M, I93L
  • 19. HIV-1 Genotypic Resistance Testing: Online Interpretation Meaningful Results (1) Quality control (2) Sequence Interpretation (3) Literature references (4) Clinical education / advice Shafer RW et al. HIV-1 RT and Protease Search Engine for Queries. Nat Med 2000
  • 20. HIVdb: Genotypic Resistance Interpretation http://hivdb.stanford.edu
  • 21. HIVdb: Genotypic Resistance Interpretation
  • 22. HIVdb: Genotypic Resistance Interpretation
  • 23. HIVdb: Genotypic Resistance Interpretation
  • 25. 25 OutlineOutline • HIV drug therapy essentials • HIVDB • Examples of public health applications • Surveillance for transmitted drug resistance • Genetic mechanisms of acquired drug resistance
  • 26. 26 Rationale for Surveillance for Drug ResistanceRationale for Surveillance for Drug Resistance in ARV-Naive Populationsin ARV-Naive Populations • Assess extent of transmitted drug resistance (TDR). • Monitor the expected efficacy of first-line therapies.
  • 27. 27 Challenges to ARV-Resistance SurveillanceChallenges to ARV-Resistance Surveillance • There is no perfect definition of genotypic resistance. • There are many different drug-resistance mutations (DRMs). • Drug resistance mutations occasionally occur in the absence of selective drug pressure. Therefore, not all drug-resistance mutations are evidence for transmitted drug resistance (TDR).
  • 28. 28 Challenges to ARV-Resistance SurveillanceChallenges to ARV-Resistance Surveillance • More than 300 studies of genotypic resistance in ARV- naïve patients have been published. • Findings differ by region, time, study population, and potentially study methods.
  • 29. 29 Surveillance Drug Resistance Mutations (SDRMs)Surveillance Drug Resistance Mutations (SDRMs) • Drug-resistance mutations with a high sensitivity and specificity for detecting selective ARV pressure. • Nonpolymorphic. • Applicable to all HIV-1 subtypes. Shafer RW, et al. HIV drug resistance mutations for drug resistance surveillance. AIDS 2007
  • 30. 30 HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations: Analysis of Published RT and PR SequencesAnalysis of Published RT and PR Sequences • Well-characterized representative population of ARV- naïve persons. • Country and year of virus isolation known. • HIV-1 RT ± PR sequence is publicly available.
  • 31. 31 Calibrated Population Resistance Analysis ToolCalibrated Population Resistance Analysis Tool Gifford, RJ et al. The calibrated population resistance tool: standardized genotypic estimation of transmitted HIV-1 drug resistance. AIDS 2008 • Standardized approach to handling missing data and poor sequence quality. • Applies SDRM list to a set of sequences • Backward-compatibility
  • 32. HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations: Prevalence by RegionPrevalence by Region Region No. Studies No. Persons % Resistance Median % Resistance IQR North America 24 11,038 11.4 8.8 – 14.0 Europe 44 11,419 9.3 6.0 – 15.1 Latin America 39 5,802 7.6 4.0 – 10.1 High-income Asia 11 3,190 5.5 3.5 – 9.0 Former Soviet Union 11 1,124 3.4 0.0 – 6.4 South/Southeast Asia 49 4,181 3.3 2.0 – 5.3 Sub-Saharan Africa 86 9,904 2.8 1.1 – 5.7 264 46,660
  • 33. 33 887 1529 <=1 1538 <=3 1343 4 1803 <=6 1200 7 1449 <=14 Years Since AR 0 4 8 Overall 0 4 8 NRTI 0 4 8 NNRTI %Resistance 0 4 8 PI Sub-Saharan Africa HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations: Sub-Saharan AfricaSub-Saharan Africa http://hivdb.stanford.edu/surveillance/map/
  • 34. 34 South/Southeast Asia 495 512 <=2 858 3 556 4 877 <=6 811 <=9 Years Since AR 0 4 8 Overall 0 4 8 NRTI 0 4 8 NNRTI %Resistance 0 4 8 PI HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations: South / Southeast AsiaSouth / Southeast Asia http://hivdb.stanford.edu/surveillance/map/
  • 35. 35 HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations: Most Common SDRMs by Region and ARV ClassMost Common SDRMs by Region and ARV Class
  • 36. 36 • Significant differences in prevalence of resistance in ARV- naïve patients by region and year. • Transmitted NNRTI resistance is increasing in Sub- Saharan Africa and South/Southeast Asia. • Analysis of data from many studies is required to obtain meaningful estimates of transmitted drug resistance. HIV-1 Resistance in ARV-Naïve Populations:HIV-1 Resistance in ARV-Naïve Populations: ConclusionsConclusions
  • 37. 37 OutlineOutline • HIV drug therapy essentials • HIVDB • Examples of public health applications • Surveillance for transmitted drug resistance • Genetic mechanisms of acquired drug resistance
  • 38. 38 RationaleRationale • In resource-limited regions, ~25% of patients receiving first-line ART develop virological failure within 1 year. • Drug-resistance mutations are detected in 50% to 90% of patients with virological failure. • Regimens used in resource-limited countries differ from those used in well-resourced countries. • Patients in resource-limited countries are monitored infrequently and second-line therapy is chosen without genotypic resistance testing.
  • 39. 39 Genetic Mechanisms of Resistance in PatientsGenetic Mechanisms of Resistance in Patients with Virological Failurewith Virological Failure • Choosing second-line therapy. • Developing point-of-care (POC) diagnostic tests.
  • 40. 40 WHO-Recommended First-Line ARV RegimensWHO-Recommended First-Line ARV Regimens WHO-Recommended Regimens, 2016 to 2013 NRTI NRTI NNRTI / PI d4T (being phased out) 3TC (or FTC) EFV AZT NVP TDF LPV (PI, 2nd line) ABC (children)
  • 41. 41 Number of Patients by Regimen and SubtypeNumber of Patients by Regimen and Subtype A B C AE AG D G Misc Total d4T/3TC/NVP 50 55 121 430 123 27 122 40 1121 AZT/3TC/NVP 45 99 394 45 50 42 46 21 469 d4T/3TC/EFV 13 92 188 16 9 2 3 11 540 AZT/3TC/EFV 25 244 274 45 20 17 26 11 576 133 490 977 536 202 88 197 83 2706 Data summary from mid 2012
  • 42. 42 Sources of Patient Data and SequencesSources of Patient Data and Sequences Number Studies Number Patients % 10 largest 1,409 51% 20 largest 1,981 72% 50 largest 2,640 98% Data summary from mid 2012
  • 43. 43 Question From WHO: Which NRTI should beQuestion From WHO: Which NRTI should be substituted in patients stopping d4T?substituted in patients stopping d4T? • Patients with virological failure on d4T can develop resistance by two mutually exclusive mutational pathways: • Thymidine analog mutations: cross-resistance to AZT • Non-thymidine analog mutations particularly K65R: cross-resistance to TDF and increased susceptibility to AZT • In vitro studies have shown that viruses belonging to subtype C are at increased risk for developing K65R.
  • 44. 44 Impact of NNRTI, Subtype, and Years on NRTI-Impact of NNRTI, Subtype, and Years on NRTI- Resistance Mutations in 1,840 Patients Receiving d4TResistance Mutations in 1,840 Patients Receiving d4T
  • 45. 45 Impact of Subtype on AZT and TDF Cross-Resistance inImpact of Subtype on AZT and TDF Cross-Resistance in 1,840 Patients Receiving d4T1,840 Patients Receiving d4T
  • 46. 46 Rationale for Point-Of-Care (POC) Resistance TestingRationale for Point-Of-Care (POC) Resistance Testing in Low/Middle-Income Countries?in Low/Middle-Income Countries? • POC test for detecting virological failure have been developed. • A POC resistance test for a limited number of the most important mutations could be used: • To confirm virological failure • To suggest among second-line therapy options • Be used prior to therapy in regions with elevated TDR or in patients with uncertain treatment history.
  • 47. 47 Sensitivity for Detecting Resistance after 1st-LineSensitivity for Detecting Resistance after 1st-Line Failure: 4 NNRTI and 6 NRTI-Resistance MutationsFailure: 4 NNRTI and 6 NRTI-Resistance Mutations
  • 48. 48 Sensitivity for Detecting Resistance in UntreatedSensitivity for Detecting Resistance in Untreated Patients: 4 NNRTI and 6 NRTI-Resistance MutationsPatients: 4 NNRTI and 6 NRTI-Resistance Mutations
  • 49. 49 ConclusionsConclusions • Drug resistance knowledge is important for interpreting genotypic resistance tests, designing surveillance studies, and drug development. • Large amounts of drug resistance data are important for generating drug-resistance knowledge. • Drug-resistance data consists mostly of correlations between genotype-treatment, genotype-phenotype, and genotype- virological outcome.
  • 50. 50 Acknowledgements Funding NIAID – Division of AIDS Bill and Melinda Gates Foundation Database / Data analysis Soo-Yon Rhee, M.S. Tommy Liu, B.S. Michele Tang, M.D. Vici Varghese, Ph.D.
  • 51. 51 5.0 6.0 4.0 3.0 2.0 1.0 -4 0 4 8 12 16 20 24 28 32 36 40 44 PlasmaHIV-1RNAlogcopies/ml Ibalizumab Infusions Accompanying antiretrovirals: etravirine + enfuvirtide 1997 2009 97 98 99 00 01 02 03 04 05 06 07 08 09 April 2010June 2009 Below the level of quantification Below the level of quantification HIV-1 levels prior to TMB-202 HIV-1 levels during and following TMB-202 EFV ENF DRV + RAL A B HIV-1 Evolution and Drug Resistance: An Example Fessel WJ, et al. The efficacy of an anti-CD4 monoclonal antibody for HIV-1 treatment. Antivir Res 2011