The Indian government criticized Twitter for making statements expressing concerns about the safety of its employees in India and potential threats to freedom of expression. The government accused Twitter of trying to dictate terms to India's democracy and undermining India's legal system. It said Twitter needs to comply with India's laws and that policymaking is the sole prerogative of the sovereign government, not a private company. The government further condemned Twitter's statements as baseless and an attempt to defame India.
The document summarizes recent political developments in India. It discusses the Congress party naming Charanjit Singh Channi as the next Chief Minister of Punjab, making him the first Dalit to hold the position. It also mentions a major drug haul in Gujarat worth Rs 9,000 crore and the potential reopening of India to foreign tourists for the first time in 18 months with the first 500,000 issued visas free of cost. Furthermore, it discusses AAP national convener Arvind Kejriwal announcing one lakh government jobs and 80% reservation for Uttarakhand youth if AAP is elected in the upcoming state elections.
- Less than six months before Punjab state assembly elections, the Congress party replaced Punjab Chief Minister Capt Amarinder Singh, acknowledging this was the best option politically to address growing dissatisfaction with the incumbent two-term Chief Minister.
- Capt Amarinder Singh resigned as Chief Minister, submitting his resignation to the Governor, after it became clear the Congress high command's political plan was unacceptable to him and would remove him as Chief Minister.
- The political events in Punjab mirror those in Gujarat recently, where both the Chief Minister and the entire cabinet were replaced ahead of elections to give the government a new look.
India administered over 2 crore COVID-19 vaccine doses in a single day for the first time on Prime Minister Narendra Modi's birthday on September 17th. Several states like Bihar and Karnataka saw their highest single-day vaccinations. The government aims to make setting this vaccination record a birthday gift for the Prime Minister. The previous record of 1 crore daily doses was crossed within the first few hours.
The Supreme Court warned the central government that it may issue strictures if not satisfied with the justification for last-minute changes made to the NEET Super Speciality exam syllabus in 2021. The court told the health ministry and other authorities not to treat young doctors like "footballs" and to hold a meeting within a week to address the concerns of 41 postgraduate doctors challenging the syllabus changes. It said it will not allow the lives of these doctors to be placed in the hands of insensitive bureaucrats.
A survey in Maharashtra found that 75% of Covid-19 patients in private hospitals were overcharged, with nearly half of those patients dying during treatment. Additionally, a residential school in Bengaluru has become a Covid cluster after 60 of its nearly 500 students tested positive. The Punjab Police withdrew security from 20 associates of former Punjab Chief Minister Amarinder Singh as they no longer hold official positions.
As India entered the fourth phase of lockdown on Monday, several states relaxed restrictions and restarted economic activities. However, malls, schools, colleges and religious gatherings remained prohibited. The ICMR also revised its testing strategy to test all SARI patients and frontline workers, regardless of travel history. Meanwhile, India's COVID-19 cases crossed 100,000 with over 3,000 deaths as Maharashtra and Tamil Nadu reported over 2,000 new cases. The stock market declined sharply in response to the government's economic relief packages.
- The BJP central leadership held meetings expressing concerns over UP Chief Minister Yogi Adityanath's disconnect with state leaders and MLAs and imbalance in caste representation in the cabinet.
- Changes are expected in the UP cabinet that could see inductions like former bureaucrat AK Sharma and Jitin Prasada to balance caste equations ahead of the 2022 state elections.
- The Delhi Police revised maximum speed limits for vehicles in the capital, capping it at 70/60 kmph for cars on highways and 60 kmph for two-wheelers on national highways.
- The US FDA rejected an emergency use authorization for Bharat Biotech's Covid-19 vaccine Covaxin
- India's GDP growth slowed to 3.1% in January-March quarter and 4.2% for full fiscal 2019-20, an 11-year low, due to the coronavirus pandemic's disruption.
- India reported over 1,000 new COVID-19 cases in a day for the first time, with total cases at 1,73,140 and deaths at 4,975, surpassing China.
- Several states like Maharashtra, Tamil Nadu, and Delhi continued to report large increases in cases and deaths. The lockdown is expected to be extended with some relaxations.
The document summarizes recent political developments in India. It discusses the Congress party naming Charanjit Singh Channi as the next Chief Minister of Punjab, making him the first Dalit to hold the position. It also mentions a major drug haul in Gujarat worth Rs 9,000 crore and the potential reopening of India to foreign tourists for the first time in 18 months with the first 500,000 issued visas free of cost. Furthermore, it discusses AAP national convener Arvind Kejriwal announcing one lakh government jobs and 80% reservation for Uttarakhand youth if AAP is elected in the upcoming state elections.
- Less than six months before Punjab state assembly elections, the Congress party replaced Punjab Chief Minister Capt Amarinder Singh, acknowledging this was the best option politically to address growing dissatisfaction with the incumbent two-term Chief Minister.
- Capt Amarinder Singh resigned as Chief Minister, submitting his resignation to the Governor, after it became clear the Congress high command's political plan was unacceptable to him and would remove him as Chief Minister.
- The political events in Punjab mirror those in Gujarat recently, where both the Chief Minister and the entire cabinet were replaced ahead of elections to give the government a new look.
India administered over 2 crore COVID-19 vaccine doses in a single day for the first time on Prime Minister Narendra Modi's birthday on September 17th. Several states like Bihar and Karnataka saw their highest single-day vaccinations. The government aims to make setting this vaccination record a birthday gift for the Prime Minister. The previous record of 1 crore daily doses was crossed within the first few hours.
The Supreme Court warned the central government that it may issue strictures if not satisfied with the justification for last-minute changes made to the NEET Super Speciality exam syllabus in 2021. The court told the health ministry and other authorities not to treat young doctors like "footballs" and to hold a meeting within a week to address the concerns of 41 postgraduate doctors challenging the syllabus changes. It said it will not allow the lives of these doctors to be placed in the hands of insensitive bureaucrats.
A survey in Maharashtra found that 75% of Covid-19 patients in private hospitals were overcharged, with nearly half of those patients dying during treatment. Additionally, a residential school in Bengaluru has become a Covid cluster after 60 of its nearly 500 students tested positive. The Punjab Police withdrew security from 20 associates of former Punjab Chief Minister Amarinder Singh as they no longer hold official positions.
As India entered the fourth phase of lockdown on Monday, several states relaxed restrictions and restarted economic activities. However, malls, schools, colleges and religious gatherings remained prohibited. The ICMR also revised its testing strategy to test all SARI patients and frontline workers, regardless of travel history. Meanwhile, India's COVID-19 cases crossed 100,000 with over 3,000 deaths as Maharashtra and Tamil Nadu reported over 2,000 new cases. The stock market declined sharply in response to the government's economic relief packages.
- The BJP central leadership held meetings expressing concerns over UP Chief Minister Yogi Adityanath's disconnect with state leaders and MLAs and imbalance in caste representation in the cabinet.
- Changes are expected in the UP cabinet that could see inductions like former bureaucrat AK Sharma and Jitin Prasada to balance caste equations ahead of the 2022 state elections.
- The Delhi Police revised maximum speed limits for vehicles in the capital, capping it at 70/60 kmph for cars on highways and 60 kmph for two-wheelers on national highways.
- The US FDA rejected an emergency use authorization for Bharat Biotech's Covid-19 vaccine Covaxin
- India's GDP growth slowed to 3.1% in January-March quarter and 4.2% for full fiscal 2019-20, an 11-year low, due to the coronavirus pandemic's disruption.
- India reported over 1,000 new COVID-19 cases in a day for the first time, with total cases at 1,73,140 and deaths at 4,975, surpassing China.
- Several states like Maharashtra, Tamil Nadu, and Delhi continued to report large increases in cases and deaths. The lockdown is expected to be extended with some relaxations.
The Rajya Sabha witnessed chaos as TMC MP Shantanu Sen tore papers being read by IT Minister Ashwini Vaishnaw on the Pegasus snooping controversy. The government will seek action against some opposition MPs including Sen and move for his suspension. Farmers began a sit-in protest at Jantar Mantar after getting special permission from Delhi LG. The Olympics ceremony director was fired over a Holocaust joke he made in 1998.
- India has taken strong exception to the UK's policy not recognizing Covishield vaccine and requiring quarantine for vaccinated Indian travelers, calling it "discriminatory".
- India's Foreign Secretary said the issue was raised strongly with the new UK Foreign Secretary and will likely be resolved soon following assurances.
- India warned that if not satisfied, it would be within its rights to impose reciprocal measures in response.
First India-Lucknow Edition-18 May 2021FIRST INDIA
Read all Latest News from Uttar Pradesh and from every corner of India.Start your morning with First India E-Paper Lucknow News edition.Read English News on politics, Bollywood, business, sports, economy,Lifestyle and our upto date Uttar Pradesh News section.Visit First India.
CLICK:- https://firstindia.co.in/
Prime Minister Narendra Modi met with CEOs of major American companies like Qualcomm, Adobe, and Blackstone in Washington to discuss opportunities for investment and collaboration, particularly in 5G technology. The Supreme Court said it will form a technical committee to investigate allegations of surveillance using Pegasus spyware. The Enforcement Directorate launched a money laundering probe into the seizure of nearly 3,000 kg of heroin at Mundra port in Gujarat worth an estimated 21,000 crore.
The Indian Navy recovered 26 bodies from the accommodation barge Papaa-305 which was caught in Cyclone Tauktae off the coast of Mumbai. The Navy is continuing to search for 49 missing oil workers. While ONGC blamed the changing path of the cyclone, the IMD rejected this claim. The IMD said they had repeatedly warned ONGC about the approaching cyclone. Meanwhile, the Navy and Coast Guard rescued over 600 people in the largest offshore search and rescue operation.
In the first two days of India's nationwide Covid-19 vaccination drive, a total of 2.24 lakh people received the vaccine. There were 447 cases of minor adverse events reported, including fever and headache, with only 3 people requiring hospitalization. On the second day, 17,072 people were vaccinated across 553 sessions in 6 states. The Supreme Court-appointed committee on the new farm laws will hold its first meeting on January 19 to discuss the laws. Farmers have reiterated their plan to hold a tractor rally in Delhi on Republic Day in a peaceful manner on the Outer Ring Road.
Several Indian states have asked the central government to arrange special trains to transport migrant workers back to their home states due to the difficulties of logistics and travel by bus. The railway ministry plans to operate 400-1000 special trains daily. States like Bihar, Rajasthan and Telangana have registered large numbers of migrant workers seeking to return home and said it would take months to transport them all by road. The central government has asked states to facilitate smooth movement of trucks carrying essential supplies. The number of COVID-19 cases in India continues to rise with major spikes in cases in states like Maharashtra, Gujarat and Tamil Nadu. Rahul Gandhi has started an online interview series with prominent figures to discuss India's
First india ahmedabad edition-18 june 2020FIRST INDIA
This document provides an update on the COVID-19 situation in India and Gujarat. Some key details:
- Gujarat reported 520 new COVID-19 cases and 27 deaths in the past 24 hours, with the total cases reaching 25,148 and deaths at 1,561.
- Ahmedabad still accounts for 70% of Gujarat's total cases and 80% of its deaths, though cases are rising in other districts as well.
- Resident doctors in Ahmedabad staged a protest alleging that only junior doctors are assigned to COVID wards while seniors do not visit. Class 3 and 4 employees at a civil hospital also went on strike over salary issues.
- Congress leaders in Gujarat protested
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/
#First_India_NewsPaper
First india ahmedabad edition-25 september 2020FIRST INDIA
First India News Paper published from Ahmedabad & Jaipur. Get CURRENT NEWS IN INDIA on politics, sports, entertainment, business, lifestyle and many more. We are a formidable news Provider especially from Gujarat, Rajasthan and Power corridor of Delhi like The Times of India, Hindustan Times & The Hindu, etc. Read First India English NewsPaper.
Visit:- https://firstindia.co.in/newspaper
The Home Ministry has taken over control of operating trains for migrant workers from states, and issued new protocols making the Railways responsible for train operations in consultation with MHA but without consulting states. The MHA has also put responsibility on states to inform migrants about train schedules and bring people to railway stations. Over a dozen migrant labourers were killed in a truck-bus collision in Bihar, as they were returning home on foot during the lockdown. The Road Transport Ministry has asked MHA and states to designate dedicated lanes for migrants walking on roads with provisions for food and medical aid.
About one in four Indians may have been infected with COVID-19 according to a new ICMR survey, suggesting over 30 crore infections compared to the official figure of 1.08 crore cases. The infection rate was found to be much higher in urban areas, particularly urban slums. Separate tests by a diagnostics company showed 55% of Indians may have been infected. Delhi's fifth serosurvey found half of residents developed antibodies. The government has directed Twitter to comply with orders to remove accounts/tweets related to farmer protests or face penal action. Celebrities backing protests have drawn criticism from India which says talks are ongoing to resolve the issue and only a small section is agitating.
India saw a sharp rise in coronavirus cases in the last month, with the number of cases increasing nine-fold between April 9 and May 9. The country's doubling rate of 11 days for COVID-19 cases is faster than many other badly affected countries. In a meeting on Monday, Prime Minister Modi will discuss further relaxing lockdown restrictions and restarting public transport with Chief Ministers. India reported over 4,000 new coronavirus cases on Sunday, with Maharashtra adding nearly 2,000 of those cases.
First india jaipur edition-10 march 2021FIRST INDIA
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/epaper
The article discusses the findings of the fourth national sero survey conducted by ICMR across India. Some key points:
- The survey covered 70 districts across 21 states from June-July 2021 and included people aged 6 years and older.
- It found that about two-thirds of India's population above age 6 have developed COVID-19 antibodies.
- However, this also implies that around 40 crore people in India do not have antibodies and remain vulnerable.
- The highest sero-prevalence was found in age groups 45-60 years and above 60 years.
- While the findings show hope, the ICMR warns there is no room for complacency and COVID-appropriate
- The exit polls for the by-elections in Madhya Pradesh, Gujarat and Uttar Pradesh indicate the BJP will strengthen its presence in the three states. The India Today-Axis My India exit poll predicts the BJP will win 16-18 seats in Madhya Pradesh, while the Congress will win 10-12 seats.
- For the first time, the India Meteorological Department (IMD) will start issuing forecasts for malaria outbreaks during the upcoming monsoon season based on studies of rainfall and temperature data relationships with past malaria occurrences.
- Air pollution levels have sharply increased in Delhi and neighbouring areas in the last 10 days, and the Indian Medical Association estimates 13% of the rise in
The Taliban have seized control of more provinces in Afghanistan, capturing key cities and approaching the outskirts of Kabul. They now control over two-thirds of the country. However, Afghan President Ghani vowed not to give up the achievements of the past 20 years. Additionally, India will observe August 14 as "Partition Horrors Remembrance Day" to honor the struggles and sacrifices of millions displaced during the 1947 partition of India and Pakistan. The Bombay High Court also granted an interim stay on parts of India's new IT rules requiring online publishers to follow a "code of ethics".
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/
#First_India_NewsPaper
First india jaipur edition-14 october 2020FIRST INDIA
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/newspaper
Indian newspapers in english first india-rajasthan-19 march 2020 editionfirst_india
Get Exclusive Rajasthani News in english from Rajasthan,India & around the world. First India-Rajasthan provides Indian Newspapers In English Exclusive on politics, sports, entertainment, business, life style and many more.Choose once us among All India Newspaper players like The Times of India,Hindustan Times & The Hindu.Visit First India News Paper For Latest News Update.
Visit:- https://www.firstindia.co.in/epaper/
The GST Council meeting took several important decisions, including an amnesty scheme to reduce late fee burdens for small and medium taxpayers. The Council exempted IGST on imports of Amphotericin-B, which treats black fungus, but left taxes on Covid vaccines and medical supplies unchanged. A group of ministers will deliberate on changing the tax structure for vaccines and Covid supplies. The Centre will borrow Rs. 1.58 trillion in FY22 to compensate states for GST revenue losses.
The Supreme Court has formed a 12-member National Task Force to streamline oxygen allocation and ensure availability of essential drugs and medicines during the COVID-19 pandemic. The task force, which takes over the work of the Union Health Ministry and other ministries, consists of 10 renowned doctors. It will allocate oxygen supplies to states, review availability of medicines and suggest measures to improve preparedness for future health emergencies.
The Rajya Sabha witnessed chaos as TMC MP Shantanu Sen tore papers being read by IT Minister Ashwini Vaishnaw on the Pegasus snooping controversy. The government will seek action against some opposition MPs including Sen and move for his suspension. Farmers began a sit-in protest at Jantar Mantar after getting special permission from Delhi LG. The Olympics ceremony director was fired over a Holocaust joke he made in 1998.
- India has taken strong exception to the UK's policy not recognizing Covishield vaccine and requiring quarantine for vaccinated Indian travelers, calling it "discriminatory".
- India's Foreign Secretary said the issue was raised strongly with the new UK Foreign Secretary and will likely be resolved soon following assurances.
- India warned that if not satisfied, it would be within its rights to impose reciprocal measures in response.
First India-Lucknow Edition-18 May 2021FIRST INDIA
Read all Latest News from Uttar Pradesh and from every corner of India.Start your morning with First India E-Paper Lucknow News edition.Read English News on politics, Bollywood, business, sports, economy,Lifestyle and our upto date Uttar Pradesh News section.Visit First India.
CLICK:- https://firstindia.co.in/
Prime Minister Narendra Modi met with CEOs of major American companies like Qualcomm, Adobe, and Blackstone in Washington to discuss opportunities for investment and collaboration, particularly in 5G technology. The Supreme Court said it will form a technical committee to investigate allegations of surveillance using Pegasus spyware. The Enforcement Directorate launched a money laundering probe into the seizure of nearly 3,000 kg of heroin at Mundra port in Gujarat worth an estimated 21,000 crore.
The Indian Navy recovered 26 bodies from the accommodation barge Papaa-305 which was caught in Cyclone Tauktae off the coast of Mumbai. The Navy is continuing to search for 49 missing oil workers. While ONGC blamed the changing path of the cyclone, the IMD rejected this claim. The IMD said they had repeatedly warned ONGC about the approaching cyclone. Meanwhile, the Navy and Coast Guard rescued over 600 people in the largest offshore search and rescue operation.
In the first two days of India's nationwide Covid-19 vaccination drive, a total of 2.24 lakh people received the vaccine. There were 447 cases of minor adverse events reported, including fever and headache, with only 3 people requiring hospitalization. On the second day, 17,072 people were vaccinated across 553 sessions in 6 states. The Supreme Court-appointed committee on the new farm laws will hold its first meeting on January 19 to discuss the laws. Farmers have reiterated their plan to hold a tractor rally in Delhi on Republic Day in a peaceful manner on the Outer Ring Road.
Several Indian states have asked the central government to arrange special trains to transport migrant workers back to their home states due to the difficulties of logistics and travel by bus. The railway ministry plans to operate 400-1000 special trains daily. States like Bihar, Rajasthan and Telangana have registered large numbers of migrant workers seeking to return home and said it would take months to transport them all by road. The central government has asked states to facilitate smooth movement of trucks carrying essential supplies. The number of COVID-19 cases in India continues to rise with major spikes in cases in states like Maharashtra, Gujarat and Tamil Nadu. Rahul Gandhi has started an online interview series with prominent figures to discuss India's
First india ahmedabad edition-18 june 2020FIRST INDIA
This document provides an update on the COVID-19 situation in India and Gujarat. Some key details:
- Gujarat reported 520 new COVID-19 cases and 27 deaths in the past 24 hours, with the total cases reaching 25,148 and deaths at 1,561.
- Ahmedabad still accounts for 70% of Gujarat's total cases and 80% of its deaths, though cases are rising in other districts as well.
- Resident doctors in Ahmedabad staged a protest alleging that only junior doctors are assigned to COVID wards while seniors do not visit. Class 3 and 4 employees at a civil hospital also went on strike over salary issues.
- Congress leaders in Gujarat protested
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/
#First_India_NewsPaper
First india ahmedabad edition-25 september 2020FIRST INDIA
First India News Paper published from Ahmedabad & Jaipur. Get CURRENT NEWS IN INDIA on politics, sports, entertainment, business, lifestyle and many more. We are a formidable news Provider especially from Gujarat, Rajasthan and Power corridor of Delhi like The Times of India, Hindustan Times & The Hindu, etc. Read First India English NewsPaper.
Visit:- https://firstindia.co.in/newspaper
The Home Ministry has taken over control of operating trains for migrant workers from states, and issued new protocols making the Railways responsible for train operations in consultation with MHA but without consulting states. The MHA has also put responsibility on states to inform migrants about train schedules and bring people to railway stations. Over a dozen migrant labourers were killed in a truck-bus collision in Bihar, as they were returning home on foot during the lockdown. The Road Transport Ministry has asked MHA and states to designate dedicated lanes for migrants walking on roads with provisions for food and medical aid.
About one in four Indians may have been infected with COVID-19 according to a new ICMR survey, suggesting over 30 crore infections compared to the official figure of 1.08 crore cases. The infection rate was found to be much higher in urban areas, particularly urban slums. Separate tests by a diagnostics company showed 55% of Indians may have been infected. Delhi's fifth serosurvey found half of residents developed antibodies. The government has directed Twitter to comply with orders to remove accounts/tweets related to farmer protests or face penal action. Celebrities backing protests have drawn criticism from India which says talks are ongoing to resolve the issue and only a small section is agitating.
India saw a sharp rise in coronavirus cases in the last month, with the number of cases increasing nine-fold between April 9 and May 9. The country's doubling rate of 11 days for COVID-19 cases is faster than many other badly affected countries. In a meeting on Monday, Prime Minister Modi will discuss further relaxing lockdown restrictions and restarting public transport with Chief Ministers. India reported over 4,000 new coronavirus cases on Sunday, with Maharashtra adding nearly 2,000 of those cases.
First india jaipur edition-10 march 2021FIRST INDIA
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/epaper
The article discusses the findings of the fourth national sero survey conducted by ICMR across India. Some key points:
- The survey covered 70 districts across 21 states from June-July 2021 and included people aged 6 years and older.
- It found that about two-thirds of India's population above age 6 have developed COVID-19 antibodies.
- However, this also implies that around 40 crore people in India do not have antibodies and remain vulnerable.
- The highest sero-prevalence was found in age groups 45-60 years and above 60 years.
- While the findings show hope, the ICMR warns there is no room for complacency and COVID-appropriate
- The exit polls for the by-elections in Madhya Pradesh, Gujarat and Uttar Pradesh indicate the BJP will strengthen its presence in the three states. The India Today-Axis My India exit poll predicts the BJP will win 16-18 seats in Madhya Pradesh, while the Congress will win 10-12 seats.
- For the first time, the India Meteorological Department (IMD) will start issuing forecasts for malaria outbreaks during the upcoming monsoon season based on studies of rainfall and temperature data relationships with past malaria occurrences.
- Air pollution levels have sharply increased in Delhi and neighbouring areas in the last 10 days, and the Indian Medical Association estimates 13% of the rise in
The Taliban have seized control of more provinces in Afghanistan, capturing key cities and approaching the outskirts of Kabul. They now control over two-thirds of the country. However, Afghan President Ghani vowed not to give up the achievements of the past 20 years. Additionally, India will observe August 14 as "Partition Horrors Remembrance Day" to honor the struggles and sacrifices of millions displaced during the 1947 partition of India and Pakistan. The Bombay High Court also granted an interim stay on parts of India's new IT rules requiring online publishers to follow a "code of ethics".
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/
#First_India_NewsPaper
First india jaipur edition-14 october 2020FIRST INDIA
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss.For real time update Visit our social media handle.Read First India NewsPaper in your morning replace.Visit First India.
CLICK:- https://firstindia.co.in/newspaper
Indian newspapers in english first india-rajasthan-19 march 2020 editionfirst_india
Get Exclusive Rajasthani News in english from Rajasthan,India & around the world. First India-Rajasthan provides Indian Newspapers In English Exclusive on politics, sports, entertainment, business, life style and many more.Choose once us among All India Newspaper players like The Times of India,Hindustan Times & The Hindu.Visit First India News Paper For Latest News Update.
Visit:- https://www.firstindia.co.in/epaper/
The GST Council meeting took several important decisions, including an amnesty scheme to reduce late fee burdens for small and medium taxpayers. The Council exempted IGST on imports of Amphotericin-B, which treats black fungus, but left taxes on Covid vaccines and medical supplies unchanged. A group of ministers will deliberate on changing the tax structure for vaccines and Covid supplies. The Centre will borrow Rs. 1.58 trillion in FY22 to compensate states for GST revenue losses.
The Supreme Court has formed a 12-member National Task Force to streamline oxygen allocation and ensure availability of essential drugs and medicines during the COVID-19 pandemic. The task force, which takes over the work of the Union Health Ministry and other ministries, consists of 10 renowned doctors. It will allocate oxygen supplies to states, review availability of medicines and suggest measures to improve preparedness for future health emergencies.
Police used water cannons and tear gas shells to disperse BJP workers who were marching towards the West Bengal State Secretariat in Kolkata to protest against the worsening law and order situation. Over 100 people, including several senior BJP leaders, were injured in the clashes. The BJP accused the police of using excessive force against peaceful protesters, while the police said they had to act after the protesters tried to force their way past blockades. The clashes are seen as an attempt by the BJP to provoke the ruling Trinamool Congress ahead of the state assembly elections in West Bengal.
The leaked data from tax consulting firm Nishith Desai Associates includes controversial correspondence with 33 major Indian corporations and several high-net-worth individuals about exploiting tax loopholes. A Delhi-based whistleblower provided the 1.5GB of data to authorities in August 2020, alleging tax evasion. The data contains memos, advice and communications regarding setting up shell companies in tax havens like Mauritius to avoid taxes in India. Investigations into the data, which implicates several influential Indians, have been slow, gathering dust with authorities.
The Union Cabinet approved a new Rs 23,123 crore package to ramp up India's medical infrastructure in preparation for the anticipated third wave of COVID-19. Out of the package, Rs 8,000 crore will be provided to state governments over the next 9 months to improve infrastructure. The new health minister stated the funds will go toward setting up pediatric care centers, 20,000 additional ICU beds, and supplies like medicines and equipment. Separately, the Cabinet approved a Rs 1 lakh crore fund for farmers that will provide loans to agricultural groups for post-harvest infrastructure and assets.
First india jaipur edition-20 october 2020FIRST INDIA
First India News Paper published from Ahmedabad & Jaipur. Get CURRENT NEWS IN INDIA on politics, sports, entertainment, business, lifestyle and many more. We are a formidable news Provider especially from Gujarat, Rajasthan and Power corridor of Delhi like The Times of India, Hindustan Times & The Hindu, etc. Read First India English NewsPaper.
Visit:- https://firstindia.co.in/newspaper
The BJP announced in its Bihar election manifesto that it would provide free COVID-19 vaccination to all Bihar residents. This led to criticism from opposition parties who accused the BJP of politicizing the pandemic and linking vaccine access to elections. Several senior BJP leaders in Bihar, including Deputy Chief Minister Sushil Kumar Modi and former Union Minister Shahnawaz Hussain, then announced that they had tested positive for COVID-19.
- There was a minor face-off between Indian and Chinese troops at Naku La in North Sikkim on January 20, resulting in minor injuries to soldiers on both sides. The situation was resolved by local commanders.
- China denied the incident took place, while India confirmed it but said it was a minor incident resolved locally as per protocols. Around 20 Chinese soldiers and 4 Indians received minor injuries.
- The incident occurred when China tried to enter Indian territory, and took place as military commanders from both countries were preparing for talks to defuse border tensions.
1) Defence Minister Rajnath Singh addressed Parliament regarding the ongoing border situation with China in Ladakh. He accused China of violating prior agreements and transgressing the border.
2) The Home Ministry informed Parliament that no leaders in Jammu & Kashmir are under house arrest, though 223 people remain in detention including former Chief Minister Mehbooba Mufti.
3) India's COVID-19 cases crossed 5 million, with several states continuing to report high daily numbers, though some states saw fewer cases than previous peaks.
Pushkar Singh Dhami was sworn in as the eleventh Chief Minister of Uttarakhand, along with his new cabinet. Dhami has retained all ministers from the previous cabinet and elevated three state ministers to cabinet positions. After being sworn in, Dhami said his government will work to fill job vacancies and provide employment to youth, while also addressing economic issues caused by the COVID-19 pandemic.
1) A new "double mutant variant" of the coronavirus has been detected in 18 Indian states, according to the Health Ministry. This presents a fresh challenge in the pandemic.
2) The government says it is too early to say this new variant is responsible for the second wave, as its presence is not yet substantial. However, samples from Maharashtra show increased mutations.
3) Daily cases in India hit a new high for this year of over 47,000, with states like Maharashtra, Punjab, and Madhya Pradesh reporting many infections.
The document discusses three main topics:
1. Hafiz Saeed, the mastermind of the 2008 Mumbai attacks, was sentenced to 10 years in prison by a Pakistani court for terror financing.
2. The Delhi government announced stricter measures to curb the rise in COVID-19 cases, including doubling testing and a Rs. 2,000 fine for not wearing masks.
3. The Indian government signed a $500 million loan agreement with China's New Development Bank to fund the Delhi-Ghaziabad-Meerut rapid transit project.
Clashes broke out between protesting farmers and police at Delhi borders on Friday as farmers tried to enter the city to protest against agricultural laws. Police used tear gas shells and water cannons against the protesters. The farmers refused the government's offer to hold protests in Burari and demanded permission for Ramlila Maidan. Meanwhile, a MiG-29K fighter jet of the Indian Navy crashed into the sea off Goa with one pilot rescued and the other missing.
Indian newspapers in english first india rajasthan-18 january 2020 editionfirst_india
Welcome to the Official Websiite of First India Rajasthan.WE are India’s own INDIAN NEWSPAPERS IN ENGLISH. We are most FIRST NEWSPAPERS IN INDIA exclusive of Rajasthan interspersed with the best of national, international and sports news from across category.First India News Paper coverage are 360 degree dyanamic which will be keep ahead you in the world.For keep up to date visit us ENGLISH NEWS PAPER TODAY Edition.
For English News Paper Today please click :- https://www.firstindia.co.in/jpr/epaper/
First India provides exclusive Today's News Headlines from politics, technology, business news,sports, Bollywood news, life style and many more.For your morning update read First India English NewsPaper.Our special coverage are Rajasthan , Gujrat and power corridor of the country national capital Delhi and rest of India .
CLICK:- https://firstindia.co.in/
#First_India
Fourteen children were allegedly trafficked from Bihar to Delhi. They were rescued by Delhi Police along with an NGO. Ten people were arrested. The rescued children aged 12-14 years have been taken to a quarantine centre.
Actress Rhea Chakraborty, who was arrested in a drug case related to Sushant Singh Rajput's death, has filed a bail plea which will be heard in court on Thursday. She faces charges of sourcing and procuring drugs for Sushant. Her lawyer claims she is innocent.
Human trials of a promising COVID-19 vaccine candidate being developed by Oxford University have been paused after a participant had an adverse reaction in the UK. The pharmaceutical
The Congress-led Opposition is set to oppose four of the 11 Government Ordinances in the upcoming Monsoon Session of Parliament starting Monday. They will try to corner the ruling dispensation on issues like the India-China border tension, COVID-19 situation, and the state of the economy. The Opposition will raise issues like unemployment, the plight of migrant workers, and economic conditions. They will also seek answers on the government's handling of the border situation with China. Meanwhile, veteran socialist leader and former Union Minister Raghuvansh Prasad Singh passed away at AIIMS in Delhi after battling post-COVID complications.
The Monsoon Session of Parliament is set to begin amid controversy over reports that phones of several top Indian politicians and officials were hacked using Israeli spyware. The opposition is expected to strongly question the government on this issue and other matters like its handling of COVID-19 and the economy. At an all-party meeting, PM Modi said the government is ready for meaningful discussion. Separately, heavy rains in Mumbai killed 33 people and affected transport, while three athletes in the Olympic Village tested positive for COVID-19, increasing doubts about the Tokyo Games.
First india ahmedabad edition-21 july 2020FIRST INDIA
Welcome to the Official Website of First India E-Paper. We are the best ENGLISH NEWS PAPER in India with Special coverage of Rajasthan & Gujrat. Follow us for the LATEST NEWS & Top LIVE NEWS in India and around the world.
Visit:- https://www.firstindia.co.in/
The oxygen supply situation in Delhi is unlikely to improve soon as INOX, the main supplier, has warned it cannot meet increased demand due to production constraints. INOX said it has contracts to supply 45 Delhi hospitals and cannot supply additional hospitals. The Delhi government will have to rely on alternative oxygen sources. The Centre has directed 100 MT of oxygen be supplied daily to Delhi but INOX says it is already supplying above that amount.
Similar to Pioneer dehradun-english-edition-2021-05-28 (20)
Navjot Singh Sidhu resigned as president of the Punjab Pradesh Congress Committee, triggering further resignations in solidarity. This came after the allocation of portfolios to ministers, which Sidhu was apparently unhappy with. Sidhu wrote in his resignation letter that he could never compromise on Punjab's future. The political tremors from Sidhu's resignation were felt in the party high command in New Delhi as well, as senior leaders held emergency meetings to discuss the situation in Punjab. Former chief minister Captain Amarinder Singh also arrived in Delhi amid the turmoil in Punjab Congress, fueling speculation about his political intentions.
Yogi Adityanath expanded his UP cabinet by inducting 7 new ministers from various social groups including OBCs, Dalits and ST in an attempt to balance caste equations ahead of state elections. The new 15-member cabinet formed by Punjab CM Charanjit Singh Channi inducted 7 new, younger faces while retaining 8 old ministers in an attempt to infuse youth and ensure social and regional balance. India told China not to confuse border management with the larger boundary issue and that both sides have made progress in disengaging troops at friction points in Ladakh through dialogue.
Prime Minister Narendra Modi addressed the 76th session of the UN General Assembly in New York. He targeted Pakistan and China in his speech, saying Afghanistan should not be used for terrorism and that ocean laws should be followed and not abused. Without naming China, he warned about countries with "regressive thinking" using terrorism as a political tool. He said India's scientific progress is helping not just India but the world, while such countries are going backwards. He focused on Afghanistan, saying the people there need help. He also spoke about upholding rule-based maritime security and not abusing ocean resources. The Quad grouping of India, US, Japan and Australia met in Washington and agreed to work together against coercion in the Ind
Three gangsters, including gangster Jitender Mann, alias Gogi, were killed in a shootout at Rohini court in Delhi. Two members of a rival gang dressed as lawyers opened fire on Gogi during a hearing. Gogi and the two attackers died from bullet injuries in the exchange of fire between the police escort and attackers. The incident raised serious questions about security at the court. The US Vice President met with the Indian Prime Minister in Washington and stressed the need to monitor Pakistan's support for terrorism and asked Pakistan to take action against terrorist groups operating from its soil that threaten India and the US.
- Prime Minister Narendra Modi left for a three-day visit to the United States where he will meet with President Joe Biden and address the UN General Assembly. The interactions are aimed at strengthening the India-US partnership as well as ties with Japan and Australia.
- The Supreme Court directed the central government to provide Rs. 50,000 as ex-gratia compensation to the families of those who died from Covid-19 in India. The amount will be disbursed from state disaster response funds.
- Pakistan allowed the use of its airspace for Modi's flight to the US, after India requested permission, as Afghanistan's airspace remains closed since the Taliban takeover. This is a change from
The Government has announced a Rs 30,600 crore package to help set up a 'bad bank' called the National Asset Reconstruction Company Limited (NARCL) to help take over stressed loan assets from public sector banks, helping clean up their balance sheets. The NARCL will pay 15% of the agreed loan value in cash and issue security receipts for the remaining 85% backed by government guarantees. This is aimed at resolving bad loans worth Rs 2 lakh crore. The decision was taken at a Cabinet meeting chaired by Prime Minister Narendra Modi. The Madras High Court has stayed certain rules introduced in February this year regarding regulation of digital media on grounds that they infringe media independence.
The Union Cabinet approved major reforms in the telecom sector including a 4-year moratorium on payment of AGR dues for Vodafone-Idea and Airtel to provide relief. It also approved 100% FDI in the telecom sector through the automatic route. A ₹26,058 crore PLI scheme was approved for the auto, auto components and drone industries to boost manufacturing. The Delhi Government challenged amendments to the GNCTD Act in the Supreme Court, claiming it violates federalism by increasing the LG's powers over the elected state government. India criticized Pakistan and the OIC at the UNHRC for raising the Kashmir issue and said it does not need lessons from
Prime Minister Modi laid the foundation stone for Raja Mahendra Pratap Singh State University in Aligarh, Uttar Pradesh. He praised the work of Chief Minister Yogi Adityanath in creating an investment friendly environment in the state. Modi said that Aligarh, known for locks, will now contribute to national security by manufacturing defense equipment. He added that India will become self-reliant and a major exporter in the defense sector. The event was seen as Modi sounding the bugle for the 2022 UP state assembly polls.
The Supreme Court will pass an interim order in 2-3 days regarding the Pegasus spyware case after the Centre refused to file a detailed affidavit. The Chief Justice told the Solicitor General that the interim order will come soon and the Centre can reconsider filing the affidavit before then. The Solicitor General argued against making details of software used by the government public, saying it could harm national security efforts. He said an expert committee will examine the allegations and submit a report to the court.
The BJP leadership in Gujarat appointed Bhupendra Patel, a first-time MLA and lightweight Patidar politician, as the new Chief Minister, replacing Vijay Rupani. Patel, who has been a protege of former Gujarat CM Anandiben Patel, surprised many in the state BJP with his selection. He was appointed with the approval of PM Modi and Amit Shah, and will contest the 2022 state elections under Modi's leadership.
- Vijay Rupani resigned as Chief Minister of Gujarat to make way for a new leader ahead of key state elections next year. This comes as the BJP faces challenges from opposition parties and wants a more dynamic leader.
- Several names are being considered as his replacement, primarily from the influential Patidar community, as the BJP looks to win back support. A decision is expected on Sunday after the BJP legislature party meeting.
- Rupani's management was seen as weakening the state unit and he faced criticism over his handling of the second COVID wave. The BJP wants to revamp its leadership in the state to win the upcoming elections.
- The fifth and final Test between India and England in Manchester was cancelled due to an outbreak of COVID-19 cases in the Indian camp.
- The BCCI initially said India was unable to field a team, forfeiting the match, but later said India was "regrettably unable to field a team" due to fears of more cases.
- The status of the series is unclear, with the BCCI saying they will work to reschedule the match but the ECB CEO saying it would be a standalone match rather than a decider.
The document discusses several leadership and political changes in India:
- Gurmit Singh was appointed as the new Governor of Uttarakhand, replacing Baby Rani Maurya who resigned. Some other governor changes were also made.
- At the BRICS summit, PM Modi said the forum adopted a counter-terrorism plan. Russia raised concerns about Afghanistan becoming a threat or source of terrorism. The joint statement condemned terrorism and called for peaceful resolution in Afghanistan.
- New data from India showed that a single vaccine dose provides 96.6% protection against Covid death, while two doses provide 97.5% protection. Officials urged all to get fully vaccinated.
India expressed concerns to Russia and the US about Pakistan's ties to the Taliban and terrorist groups in Afghanistan. During meetings between India's National Security Advisor Ajit Doval and his counterparts from Russia and the US, India said Afghan soil should not be used to spread terrorism and sought assurances for the safety of minorities in Afghanistan. India is wary of Pakistan's role in Afghanistan due to its links with the Taliban and wants Pakistan to ensure Afghanistan is not used for terrorism. Russia and India agreed to coordinate on the situation in Afghanistan.
Nitish Kumar is likely to share a stage with opposition parties including TMC, Samajwadi Party, NCP, RLD, RJD, Shiromani Akali Dal and National Conference at a rally in Haryana on September 25 in an attempt to pitch for a third front. INLD leader Om Prakash Chautala is trying to bring these opposition leaders together at the rally to raise issues related to farmers. Abhay Chautala said that leaders like Nitish Kumar, Mulayam Singh Yadav, HD Deve Gowda and others have confirmed their presence at the rally marking the birth anniversary of former Deputy Prime Minister Devi Lal.
The Taliban have claimed control over all of Afghanistan after capturing the last holdout province of Panjshir. According to Taliban sources, their fighters overran resistance forces in Panjshir overnight. The resistance was led by Ahmad Massoud, son of late anti-Taliban fighter Ahmad Shah Massoud, and former Vice President Amrullah Saleh. Experts had doubted the resistance could succeed long-term against the Taliban. Separately, the Kerala High Court ruled that the second dose of Covishield vaccine can be administered after 28 days, not 84 days as mandated by the central government. The court said the government's stance was discriminatory. The Supreme Court slammed the central government for not making appointments to tribun
- The Taliban said the new Afghan government will be announced soon and will be "inclusive". However, the structure and features of the future government were not detailed.
- The remarks come amid a visit by Pakistan's ISI chief to Kabul, amid reports of an internal crisis within the Taliban over power sharing.
- Former Afghan VP Saleh has said the Taliban are being micromanaged by Pakistan's ISI, effectively making Pakistan a "colonial power" in Afghanistan.
The Supreme Court has stayed the Kerala government's decision to hold offline exams for Class 11 from September 6 amid rising COVID-19 cases in the state. The court observed that Kerala accounts for 70% of India's current COVID cases, so exposing children to risk is unacceptable. It directed the central government to frame guidelines for death certificates of COVID victims by September 11. A UK study found that around 1 in 7 children who tested positive for COVID reported lingering symptoms 15 weeks later, though the prevalence of long COVID was lower than initially feared. India is set to commission its first ballistic missile tracking ship INS Dhruv next week, joining an elite group of nations with such surveillance capabilities.
Dr Chandan Mitra, a veteran journalist and former Rajya Sabha MP, passed away at 66 years old after an illness. Tributes poured in from political leaders praising his contributions to journalism and politics over his decades-long career. Mitra was the longtime editor of The Pioneer newspaper and helped transform it into a leading publication. He was respected across party lines for his intellect and understanding of politics. Mitra began his career in journalism with publications like The Statesman before becoming involved in politics and being nominated to the Rajya Sabha by the BJP party. He will be remembered for his leadership of The Pioneer and his sharp political commentary.
The Taliban called on resistance fighters in the Panjshir Valley to lay down their arms, while the National Resistance Front said they had repulsed heavy Taliban attacks. The rugged Panjshir Valley north of Kabul is the center of remaining anti-Taliban forces in Afghanistan. Meanwhile, the Taliban and Afghan leaders reportedly reached a consensus on forming a new government under the leadership of the Taliban's supreme leader.
केरल उच्च न्यायालय ने 11 जून, 2024 को मंडला पूजा में भाग लेने की अनुमति मांगने वाली 10 वर्षीय लड़की की रिट याचिका को खारिज कर दिया, जिसमें सर्वोच्च न्यायालय की एक बड़ी पीठ के समक्ष इस मुद्दे की लंबित प्रकृति पर जोर दिया गया। यह आदेश न्यायमूर्ति अनिल के. नरेंद्रन और न्यायमूर्ति हरिशंकर वी. मेनन की खंडपीठ द्वारा पारित किया गया
Youngest c m in India- Pema Khandu BiographyVoterMood
Pema Khandu, born on August 21, 1979, is an Indian politician and the Chief Minister of Arunachal Pradesh. He is the son of former Chief Minister of Arunachal Pradesh, Dorjee Khandu. Pema Khandu assumed office as the Chief Minister in July 2016, making him one of the youngest Chief Ministers in India at that time.
Essential Tools for Modern PR Business .pptxPragencyuk
Discover the essential tools and strategies for modern PR business success. Learn how to craft compelling news releases, leverage press release sites and news wires, stay updated with PR news, and integrate effective PR practices to enhance your brand's visibility and credibility. Elevate your PR efforts with our comprehensive guide.
13062024_First India Newspaper Jaipur.pdfFIRST INDIA
Find Latest India News and Breaking News these days from India on Politics, Business, Entertainment, Technology, Sports, Lifestyle and Coronavirus News in India and the world over that you can't miss. For real time update Visit our social media handle. Read First India NewsPaper in your morning replace. Visit First India.
CLICK:- https://firstindia.co.in/
#First_India_NewsPaper
1. 20?BD;4
34030=A4CDA=B
7405C4A78B5D=4A0;
9PX_da)0#hTPa^[SP]
_aTbdTSSTPSbW^fTSd_
dRWc^cWTbda_aXbT^UWXb
UPX[hPfTTZPUcTacWThWPS
_TaU^aTSPUd]TaP[XbcPZT][h
XST]cXUhX]VPSTR^_^bTS
R^a_bTPbWXbQ^ShCWTV^^Ud_
c^^Z_[PRTPUcTacWTBcPcTad]
A:7^b_XcP[STR[PaTScWTQ^Sh
^UPP]]PTS6^eTaSWP]
?aPYP_PcfW^fPbd]STa
caTPcT]cPccWTW^b_XcP[Pb
²d]XST]cXUXTS³P]S[PcTaZPa
;P[6PSd[XP³baT[PcXeTbfa^]V[h
c^^Z_^bbTbbX^]^UcWPcQ^ShPc
APYbPP]SSXbcaXRcX]APYPbcWP]
6EC=35AC$;C
:8=53403B2A814B
=Tf3T[WX)CWT2T]caTP__a^eTS
UX]P]RXP[PbbXbcP]RTc^UPX[XTb^U
!%^aTY^da]P[XbcbfW^
bdRRdQTSc^2^eXS (CWT
X]Xbcah^U8]U^aPcX^]
1a^PSRPbcX]VbPXSAb$[PZW
PbbXbcP]RTTPRWfX[[QTVXeT]c^
cWTUPX[XTb^UcWTbT%
Y^da]P[Xbcb2^XccTTP[b^
R^]bXSTaTSP__[XRPcX^]b^U
UPX[XTb^U Y^da]P[XbcbfW^
WPS_PbbTSPfPhSdTc^aTPb^]b
^cWTacWP]cWTX]UTRcX^]XcbPXS
?=BQ =4F34;78
Hours after Twitter
expressed concerns
regarding the safety of its
employees and “potential threat
to freedom of expression” for its
users, the Centre lashed out at
US-based microblogging site
asking it to stop beating around
the bush and comply with the
rules framed by the Ministry of
Information and Technology.
In a strongly worded state-
ment, the Ministry of
Electronics and Information
Technology (MeitY) said the
statement by the social media
intermediary was an attempt to
dictate its terms to the world’s
largest democracy, and accused
Twitter of trying to undermine
India’s legal system with its
“actions and deliberate defi-
ance”.
The Ministry said it
“strongly controverts” the
claims made by Twitter in its
press release. The statement
has been posted on Koo, the
India-made social media plat-
form, which gained traction
earlier this year after the long-
standing spat between the
Centre on Twitter started
around January-February. It
termed Twitter’s statement
“unfortunate”, totally baseless,
false and an attempt to defame
India to hide their own follies”.
“Twitter needs to stop
beating around the bush and
comply with the laws of the
land. Lawmaking policy for-
mulation is the sole prerogative
of the sovereign and Twitter is
just a social media platform
it has no locus in dictating
what should India’s legal poli-
cy framework should be,” the
Ministry said.
Through its actions and
deliberate defiance, Twitter
seeks to undermine India’s
legal system, it added.
“The Government con-
demns the unfortunate state-
ment issued by Twitter as
totally baseless, false and an
attempt to defame India to
hide their own follies,” the IT
Ministry said.
“Twitter refuses to comply
with those very regulations in
the Intermediary Guidelines
on the basis of which it is
claiming a safe harbour pro-
tection from any criminal lia-
bility in India,” the Ministry
said.
The strongly-worded state-
ment said the only instance of
scuttling free speech on Twitter
is Twitter itself and its opaque
policies. “As a result of this,
people’s accounts are sus-
pended and tweets deleted
arbitrarily without recourse.”
“India has a glorious tra-
dition of free speech and
democratic practices dating
back centuries. Protecting free
speech in India is not the pre-
rogative of only a private, for-
profit, foreign entity like
Twitter,” it added.
0A270=09HC8Q =4F34;78
Taking cue from the
European countries, India
too is considering mix-and-
match doses of vaccines on a
trial basis with the Government
on Thursday saying that there
is no concern if just in case peo-
ple are getting different doses.
Its assertion came following
a recent Spanish study that has
found that vaccinating people
with both the Oxford-
AstraZeneca and Pfizer-
BioNTech Covid-19 vaccines
produces a potent immune
response against the virus
SARS-CoV-2.
“As per the protocol, stick to
the same dose of vaccine as the
first one. If people are getting
different doses there is no cause
for concern, it’s safe. We are
thinking to mix and match
(vaccine doses) on a trial basis,”
said Dr VK Paul, member
(Health) of Niti Aayog at a press
conference here. The mix-and
match option suits the
Government too in view of
supply-chain and shortage
issues affecting its nationwide
Covid-19 vaccination drive,
especially for the second dose.
Dr Paul was replying to a
query if there were health con-
cerns in a case of 20 residents of
a village in Uttar Pradesh who
were administered a different
coronavirus vaccine as a second
dose.
“There should be no cause
of concern and added that any
adverse event is unlikely,” he
said, adding that more scrutiny
was required in the case.
?=BQ =4F34;78
With Antiguan Prime
Minister Gaston Browne
urging neighbouring Dominica
to directly hand over fugitive
businessman Mehul Choksi to
India, agencies here are explor-
ing options to get him extra-
dited to face the law. Choksi is
wanted in the C13,500 crore
PNB credit fraud case.
Choksi was nabbed in
Dominica late on Wednesday
after fleeing from neighbouring
Antigua and Barbuda.
Browne reportedly said
Choksi will be deported to
India and Indian authorities are
in touch with their counter-
parts in Dominica.
Indian agencies were in
touch with Antigua and
Barbuda on the matter and
contact has also been estab-
lished with the Government of
Dominica for repatriation of
Choksi to India, sources here
confirmed.
They said the agencies are
exploring possible legal
recourse to seek his custody at
the earliest.
After reports of Choksi’s
arrest in Dominica, Browne
told the media there that he has
given “clear instructions” to the
Dominican authorities to repa-
triate Choksi to India.
344?0::D?A4C8Q =4F34;78
The anti-BS Yediyurappa
“rebellion” in Karnataka
has fizzled out again as the BJP
central leadership has not been
able to find out a “Lingyat”
leader of Yedyurappa’s stature
even though complaints that
his son was remote-controlling
the administration and run-
ning a “parallel power-centre”
are on the rise in the State.
“Dissidents have not
received support from central
leaders as BSY, despite his age-
related problems, is still the
biggest vote catcher among
the dominant Lingyat com-
munity that forms around 11 to
13 per cent vote bank,” said a
State leader who identified
himself a “BJP loyalist” away
from pro or ant-BSY camps.
He went on to admit that
BSY’s “family” (son) interfer-
ence has adversely impacted
governance and “image” of the
party in the State with the rival
camp levelling charges of cor-
ruption.
The dissidents in
Karnataka, including backward
class leader and State Rural
Development Minister BS
Eshwarappa, have alleged that
the Chief Minister’s son BY
Vijayendra was running the
Government like a de-facto
Chief Minister.
Eshwarappa, a bitter crit-
ic of the BSY, is also a claimant
for the top post.
?=BQ ;D2:=F
When Uttar Pradesh Chief
Minister Yogi
Adityanath called on
Governor Anandiben Patel on
Thursday evening, it gave cre-
dence to the speculation about
possibility of reshuffle or
expansion of the Uttar Pradesh
Ministry.
The Chief Minister was on
an inspection tour of districts
for last three days and
returned to Lucknow on
Thursday at 6 pm and an
hour later he drove down to
the Raj Bhawan to meet
Governor Anandiben Patel,
who is also in charge of
Madhya Pradesh, and had
suddenly returned to Lucknow
on Thursday from Bhopal.
Anandiben Patel went to
Bhopal on May 10 and was
slated to stay there till Saturday
next. The sudden arrival of the
Governor in Lucknow and
her meeting with Yogi
Adityanath was seen as a step
toward finalising details of
reshuffle in the Ministry.
Raj Bhawan officials, how-
ever, said it was a routine
meeting.
?=BQ =4F34;78
The alluring coral archipel-
ago of Lakshadweep is in
turmoil. A series of decisions
initiated by Lakshadweep
Administrator Praful Khoda
Patel, a former BJP leader, have
triggered a huge controversy,
inviting sharp criticism not
only from the Opposition but
also from within the BJP.
Patel’s recall is demanded
by the Opposition parties,
including the Congress, the
CPM and the Nationalist
Congress party (NCP).
The steps taken by Patel
include a ban on beef con-
sumption in the Muslim-dom-
inated Lakshadweep, intro-
duction of a Goonda Act, a
proposal to disqualify pan-
chayat poll aspirants with
more than two children, and
establishment of a develop-
ment authority with powers to
acquire land.
The steps has led to a
sharp division in the
Lakshadweep BJP unit with
president Abdul Khadee Haji
backing Patel but general sec-
retary Mohammad Kasim
describing the administrator
“authoritarian” saying his pro-
posals are against the interests
of islands. Kasim wrote a let-
ter to Prime Minister
Narendra Modi opposing the
proposals.
Kasim is of view that
Patel’s measures would lead to
job losses and harassment of
people.
A094B7:D0AQ =4F34;78
The liquor industry has
reported a decline of 12 per
cent in the sale of the Indian-
made foreign liquor (IMFL)
segment amid COVID pan-
demic and lockdown despite 6
per cent growth in the January-
March quarter in 2020-21.
The total sales of IMFL
were 305 million cases (9 litres
each) products in 2020-21 ---
nearly 12 per cent below the
previous year. Though the sales
picked up in the second half of
2020-21 in most parts, the
States which imposed high
corona cess and other taxes
after the first wave of Covid-19
showed poor recovery.
According to a data com-
piled by the Confederation of
Indian Alcoholic Beverage
Companies (CIABC), the
liquor sales fell by a whopping
42 per cent in first quarter of
the last fiscal, it declined by 9
per cent in the second quarter
and 1 per cent in the third
quarter, before showing a
recovery of 6 per cent in the
fourth quarter.
The top five States in terms
of recovery in sales were
Maharashtra, Goa, Haryana,
Himachal Pradesh and
Uttarakhand, while West
Bengal, Rajasthan and
Chhattisgarh were among the
big States which witnessed
largest declines over the previ-
ous fiscal.
As per the data,
Uttarakhand, Himachal
Pradesh and Haryana reported
over 40 per cent growth in
IMFL sales during the fourth
quarter of 2020-21, while
Maharashtra and Goa report-
ed 23 and 22 per cent growth,
respectively. However, during
the January-March quarter,
sales of IMFL in States such as
Chhattisgarh reported a 31 per
cent decline, 28 per cent in West
Bengal and a 20 per cent in
Rajasthan. The highest decline
of 52 per cent was in Meghalaya
and 43 per cent in the Union
Territory of Daman, Diu and
Silvassa.
In Delhi, the sale of IMFL
fell by 67 per cent in the first
quarters, 8 per cent in the sec-
ond quarters, 3 percent in the
3rd quarter and in the fourth
quarter, it showed recovery of
2 per cent. Andhra Pradesh’s
sales fell by 70 per cent in the
first quarter, 51 per cent in the
second quarter, 19 per cent in
the third quarter and two per
cent in the fourth quarter.
Chandigarh recorded 65 per
cent decline in the sale of
IMFL in the first quarter, 13
percent in the second quarter,
21 per cent in the third quar-
ter. In the fourth quarter the
growth rate was only 4 per cent.
Some States including Delhi,
Assam, Odisha, Chandigarh,
and Madhya Pradesh have
shown positive trend
in sales, but the recov-
eries were not strong
enough, or were
inconsistent through
q u a r t e r s ,
r e f l e c t i n g
i n h e r e n t
fragility in the
market.
According to
C I A B C
D i r e c t o r
General Vinod Giri: “Many
states showed positive trend
through the quarters, and even
though most states were unable
to fully recover volume lost in
first and second quarters,
strong performance in third
and fourth quarters reflects
fundamental strength in the
market.
It also confirms that there
is no lasting shift against alco-
holic beverages in consumption
baskets.”
“Incidentally,themajorityof
these states are ones that
imposed high cess / tax during
the first wave of Covid, and
unlike other states did
not withdraw or
reduceit.WestBengal
and Chhattisgarh also
made changes in the
route-to-market
which may have
suppressed the mar-
ket’s natural uplift”,
he said.
RXFDQ¶W
GLFWDWHWHUPV
RQ,7UXOHV
IDOOLQWROLQH
*RYWRUGHUV
7ZLWWHU
BC055A4?AC4AQ =4F34;78
The Delhi Police on
Thursday said Twitter’s
latest statements on ongoing
enquiry in toolkit are devised
to seek dubious sympathy
when they themselves not
only refuse to comply with the
law but also claim to be in
possession of material evi-
dence which they refuse to
share with legal authority.
The strongly-worded
statement by the Delhi Police
came after Twitter on
Thursday called the visit by
the Delhi Police to its offices
a form of intimidation and
said it was concerned about its
employees and the potential
threat to freedom of expres-
sion.
4c`T`UZ]VeVRcd
a`]ZTVcVSfWW
WRVT`_TVc_d
*RYWPXOOVPL[ PDWFK
RYLGMDEVRQWULDOEDVLV
?`h`ccZVdZW
aV`a]VXVeeZ_X
U`dVd`WUZWWVcV_e
gRTTZ_Vd+5cARf]
New Delhi: The Centre on
Thursday directed States and
Union Territories to continue
the ongoing Covid-19 guide-
lines till June 30 and asked
them to go for intensive and
local containment measures
in districts with a high number
of cases to check the spread of
the deadly disease.
4`_eZ_fReZ`_`W
4`gZUXfZUV]Z_VdeZ]]
;f_VV_UdRjd92
8]SXPTg_[^aTb2W^ZbX´b
TgcaPSXcX^]Pb0]cXVdP]
?UPe^dabST_^acPcX^]
RJLFDOOVRQ*XY
VSDUNVVSHFXODWLRQ
DERXWDELQHW
UHMLJH[SDQVLRQ
ATe^[cPVPX]bc
1BHUXii[Tb^dc
/RFNGRZQVSLULWVDZDEXHUV
?=BQ =4F34;78
Against the backdrop of its
ongoing face-off with the
Centre and the Delhi Police,
Twitter on Thursday
expressed displeasure on the
recent raid at its offices in
Delhi and Gurugram saying it
was concerned with the
“recent events” regarding its
employees in the country and
“the potential threat to free-
dom of expression” for its
users.
In a statement and in a
series of tweets, Twitter said
certain provisions of new IT
rules in India are against the
open public conversations and
wish to have a constructive
dialogue with the Indian
Government.
The microblogging site
expressed displeasure on the
recent raid at its offices in
Delhi and Gurugram.
“But just as we do around
the world, we will continue to
be strictly guided by principles
of transparency, a commit-
ment to empowering every
voice on the service, and pro-
tecting freedom of expression
and privacy under the rule of
law. Right now, we are con-
cerned by recent events
regarding our employees in
India and the potential threat
to freedom of expression for
the people we serve,”said
Twitter’s Policy Division.
1P]^]QTTUX]db[X
S^X]PcTSXb[P]S
8]ca^SdRcX^]^U6^^]SP0RcX]
;PZbWPSfTT_fXcW[^fRaXTaPcT
?a^_^bP[c^SXb`dP[XUh_P]RWPhPc
_^[[Pb_XaP]cbfXcW^aTcWP]!
RWX[SaT]
4bcPQ[XbWT]c^UPSTeT[^_T]c
PdcW^aXchfXcW_^fTabc^PR`dXaT
[P]S
;^RP[19?SXeXSTS
7XbaTRP[[XbSTP]STSQh
__^bXcX^]
BC055A4?AC4AQ =4F34;78
The Indian Medical
Association (IMA) on
Thursday lodged a complaint at
Delhi’s IP Estate police station
against yoga guru Ramdev
over his comment on allopathy.
Police said that they are con-
ducting an enquiry into the
matter.
According to the May 9
complaint of the IMA, Ramdev
has “wilfully and deliberately
spread false, baseless and mali-
cious information” about treat-
ment of Covid patients by
established and approved
methods and drugs.
“In a video which has sur-
faced and is being shared wide-
ly throughout the social media,
Swami Ramdev is seen wilful-
ly and deliberately spreading
false, baseless and malicious
information with regard to the
treatment of various patients
suffering from Covid-19 by
established and approved
treatment methods and drugs,”
it said.
The IMA has also served a
defamation notice on Ramdev
for his alleged disparaging
remarks against allopathy.
:2]`UXVda]RZ_e
RXRZ_deCR^UVg
S CfXccTad]STaX]X]V8]SXP³b[TVP[bhbcTfXcW
Xcb°PRcX^]bP]SST[XQTaPcTSTUXP]RT±
S 0ccT_cc^STUPT8]SXPc^WXST
cWTXa^f]U^[[XTb
S ?T^_[T³bPRR^d]cbPaTbdb_T]STS
P]ScfTTcbST[TcTSPaQXcaPaX[hfXcW^dc
aTR^dabT
S ?a^cTRcX]VUaTTb_TTRWX]8]SXPXb]^ccWT
_aTa^VPcXeT^U^][hP_aXePcTU^a_a^UXcU^aTXV]
T]cXch[XZTCfXccTa
S CfXccTafX[[P[fPhbaTPX]bPUTX]8]SXP
P]ScWTaTXb]^cWaTPcc^cWTXa_Tab^]P[
bPUTchP]SbTRdaXch
S CfXccTaP[b^RW^bTc^bW^fcWT
VT^[^RPcX^]^URTacPX][^RPcX^]bX]
;PSPZWPb_Pac^U2WX]P
S CfXccTaWPb[TSc^°aP_P]c_a^[XUTaPcX^]^UUPZT
P]SWPaUd[R^]cT]cPVPX]bc8]SXPP]S8]SXP]b±
4V_ecVEhZeeVc¶d
c`hZ_eV_dZWZVd
CfXccTabcXRZbc^Xcb
Vd]bRaXTbcWaTPcc^
UaTTS^^UTg_aTbbX^]
4`gZU*
:?:?5:2
CC0;20B4B) !$###$$
%!'$
340C7B) '$#'$
A42E4A43) !#''!$#
!$
02C8E4)! ##
070)$%! '! !
:´C0:0)!$!(('!#! #
:4A0;0)!##'$$$!# %%
D?) %''' (%
34;78) #!!$#( !
7c`^SVVWe`X``_URhYRe
RZ]deYZdVi`eZTZd]R_UFE
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+
fffSPX[h_X^]TTaR^
X]bcPVaPR^SPX[h_X^]TTa
;PcT2Xch E^[ $8bbdT #$
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
?dQ[XbWTS5a^
34;78;D2:=F 17?0;17D10=4BF0A
A0=278A08?DA 270=3860A7
347A03D= 7H34A0103E890HF030
4bcPQ[XbWTS '%#
51,1R5HJQ877(1*5(*'1R8$'2''1
347A03D=5A830H0H !'!! *?064B !C!
@A:?:@?'
F74=8=BC8CDC8=B
0A4DC=0;81
DA@CE#
I830=4A4B86=B0B
A40;03A831BB
m
m
H@C=5)
D=A867CB27845)8BA04;8BCA8:4B
8=60I00H14F0A2A84B
2B14@9DDG9C
:?9D3ECD?4I
?6;94C
! F9F139DI
2. ]PcX^]!
347A03D=k5A830H k0H !'!!
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS·VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
?=BQ 270=3860A7
Extending the existing
Covid-19 curbs till June 10,
the Punjab Government on
Thursday decided to provide
some relaxations in view of
decline in the positivity and
number of active caseload. At
the same time, the Chief
Minister has issued instruc-
tions to remain prepared for
the “possible third wave”.
Among other things, the
Government has decided to
remove the limit on number of
passengers in private vehi-
cles, restoring elective surg-
eries, operation of full OPD,
allowing use of oxygen for
essential non-medical use.
The Chief Minister Capt
Amarinder Singh, who took
the decisions taken during
the COVID review meeting,
said that it had been decided
to continue with the curbs on
the advice of experts.
At the same time, he clar-
ified that while the limit on
personal cars and two-wheel-
ers was being removed as
these are used mainly by fam-
ily members and close friends,
those on commercial passen-
ger vehicles and taxis shall
continue to be in place at pre-
sent.
The Deputy
Commissioners will also con-
tinue to be empowered to
make any adjustments in
opening of non-essential shops
as are merited by local condi-
tions, he said.
The Chief Minister has
also directed the resumption
of elective surgeries in both
government and private hos-
pitals, as well restoration of
OPD operations at all
Government Medical Colleges
and Hospitals (GMCHs)
across the State, in view of the
improvement in overall
COVID situation.
Notably, the elective surg-
eries had been stopped from
April 12 to ensure adequate
availability of beds and oxygen
for serious COVID cases, but
the Chief Minister has now
allowed these to be resumed,
“subject to the condition that
there shall, for the present, be
no reduction in beds for Level
III patients in the hospital”.
The state Medical
Education Minister OP Soni
said that three GMCs had
already started 50 percent OPD
operations, which will soon be
scaled up to 100 percent.
Taking strong note of
overcharging by some private
hospitals, the Chief Minister
warned that profiteering and
fleecing of patients amid such
a crisis will not be allowed at
any cost. He directed the
Health and Medical Education
Departments to ensure that
hospitals display huge (11’x5’)
boards at the entrance dis-
playing rates.
Reviewing the COVID sit-
uation with top health experts
and officials, as well as police
and administrative officers,
Capt Amarinder directed the
close and continuous moni-
toring of high risk individuals
and pregnant women in home
isolation through special
teams.
O2 SITUATION COM-
FORTABLE IN PUNJAB
Given the comfortable
Oxygen situation in the State
currently, the Chief Minister
also directed that Oxygen may
now be allowed to be used for
essential non-medical pur-
poses, with a three-day buffer
stock of medical oxygen, how-
ever, to be maintained at all
times. He noted with satisfac-
tion that oxygen concentrator
banks were now present in
every district for post COVID
care patients who have a doc-
tor’s prescription. The control
room had ensured that there
was no shortage of Oxygen in
any hospital, he said, adding
that the demand in the State
had come down from 304 MT
to 236 MT in the last 10 days.
CM ORDERS TO RAMP
UP TESTING, SAMPLING
IN VILLAGES
The Chief Minister also
ordered ramping up of testing
and sampling in the rural
areas to ensure early identifi-
cation and treatment of infect-
ed persons, as part of the
Corona Mukt Pendu Abhiyan.
He expressed satisfaction that
almost 1.4 crore individuals
(37 lakh households) had
already been screened in these
areas. The state Health and
Family Welfare Minister Balbir
Singh Sidhu said that the sit-
uation in the rural areas was
bad mainly because people
were going to hospitals late.
The state Health Secretary
Hussan Lal said that the pos-
itivity rate in rural areas was
four percent with people there
shying from testing and com-
ing forward only when faced
with severe symptoms.
STATE TRYING TO
PROCURE MORE VAC-
CINES
Expressing concern over
vaccine shortage, the Chief
Minister said that the State
Government was trying to
procure vaccines from all pos-
sible sources to meet the sud-
den demand as more and
more people were realizing
that this was the only protec-
tion against the pandemic,
especially in view of the fast-
spreading strain that originat-
ed in UK.
A P P R E H E N D I N G
THIRD WAVE, PUNJAB TO
SEEK 500 PAEDIATRIC
VENTILATORS FROM
CENTRE
Asserting that the State
could not afford to be lax
despite some easing of the sit-
uation, the Chief Minister
directed the Health and
Medical Education
Departments to continue
strengthening the COVID care
infrastructure and facilities to
deal with a possible third wave
of the pandemic.
He asked them to invest
also in augmenting paediatric
care and to seek 500 paediatric
ventilators from the
Government of India. The
meeting was informed all the
809 ventilators received earli-
er under the PM Cares Fund
had been distributed and 136
of them were not working.
The Chief Minister also
ordered creation of more tech-
nical and specialist posts to
meet the demands of the pos-
sible third wave.
Baba Farid University’s
Vice-Chancellor Dr Raj
Bahadur informed the meet-
ing that the recruitment of
doctors and nurses had almost
been completed, while the
process for procurement of
equipment for the makeshift
hospitals had also started. All
mid-level IAS or PCS transfers
in all departments should be
put on hold till the COVID
crisis continues, directed the
Chief Minister.
Af_[RSVieV_Ud4`gZUTfcSdeZ]];f_V!
?aT_PaX]VU^a
_a^YTRcTScWXaS
fPeT
AT^eTb[XXc
^]_PbbT]VTabX]
_eceTWXR[Tb*
ATbc^aTbT[TRcXeT
bdaVTaXTbUd[[
?3^_TaPcX^]b
?=BQ 0170A
After opening eight Covid
Care Centres in Punjab,
the Shiromani Gurdwara
Parbandhak Committee will
start ‘Vaccine Sewa’ at
Amritsar from May 29.
Announcing this, Shiromani
Akali Dal (SAD) president
Sukhbir Singh Badal on
Thursday also announced fur-
ther extension of the Oxygen
Sewa started by the party to
more constituencies in the
State.
Sukhbir, who was in
Abohar to start the Oxygen
Sewa initiative, also released
helpline numbers. “The tech-
nicians hired by SAD would
provide and install Oxygen
concentrators at residences of
the needy persons,” he added.
He said that the SGPC and
SAD were providing vaccines
and medical facilities, includ-
ing Oxygen concentrators, to
the people even as the
Congress Government had
failed to provide quality med-
ical healthcare due to which
the mortality rate was the
highest in Punjab.
“More than 500 concen-
trators had been imported
and the Sewa, which had been
launched in 10 constituencies
presently, would be broad
based further,” he said adding
that the party was now pro-
viding ‘langar sewa’ to COVID
patients and their families in
70 constituencies. Asserting
that the third COVID wave
could be even more severe
than the first two, Sukhbir
asked the Chief Minister Capt
Amarinder Singh to immedi-
ately order vaccines worth Rs
1,000 crore to vaccinate every-
one in the next six months.
“The Congress govern-
ment is befooling Punjabis by
trying to order vaccines from
global companies which have
not been approved by the
Indian Government…Instead
of doing this, the Government
should place its orders for
any number of Covaxin,
Covishield, or Sputnik doses.
The SGPC was able to order
and receive a consignment of
Covaxin within 10 days,” he
added.
6*3WRVWDUW
9DFFLQH6HZDIURP
0DLQ$PULWVDU ?=BQ
270=3860A7
Sh i r o m a n i
Akali Dal
(SAD) on
Thursday con-
demned the
C e n t r a l
Government
for trying to
defame the
kisan andolan
(farmers’ agita-
tion) as well as suppress it by
filing a “politically motivated”
charge-sheet accusing the
farmers of conspiring to turn
the Red Fort into a protest site
on January 26 this year.
“It is shocking that the
Delhi Police has filed a charge-
sheet accusing farmers of try-
ing to capture the Red Fort on
January 26 with the aim of
turning it into a protest site, and
this is furthest from the truth,”
said former minister Daljit
Singh Cheema.
He said: “It is a matter of
record that the entire estab-
lished leadership of the Kisan
Andolan as well as thousands
of protesters took a predeter-
mined route as finalized after
talks with the Delhi Police.
Only a small section of people
reached the Red Fort.”
Cheema said that it was
apparent that the Delhi Police
had not done a professional
investigation into the entire
case. “The factual position on
the ground has not been taken
into consideration while fram-
ing the charge sheet. In fact, it
seems to be motivated by pol-
itics,” he said.
SAD leader asked the
Central Government to take
stock of the situation immedi-
ately and take corrective mea-
sures to ensure no farmer was
victimized due to the partisan
charge sheet filed by the Delhi
Police.
B03R^]ST]b2T]caTU^a
STUPX]V:XbP]0]S^[P]
?=BQ 270=3860A7
More than 91,439 patients
having influenza-like ill-
ness have so far been detect-
ed in over 5000 villages of
Haryana during the ongoing
state villagers general health
checkup scheme.
The door-to-door survey
in villages to identify COVID-
19 patients began on May 15
in the State. Around 8000
multidisciplinary teams were
constituted for conducting
door to door health check-ups
in rural areas. In just a short
span of 12 days, teams consti-
tuted for the survey have con-
ducted the health check-up of
around 1.25 crore people resid-
ing in 25,49,464 houses in
rural areas across the state, said
an official spokesman. He said
that during door-to-door
check-up as many as 91,439
patients having flu-like symp-
toms were identified and got
timely treatment.
As per the data available,
samples of 1,07,852 (90,474
rapid antigen tests and 17,378
RT-PCR tests) have so far
been taken in rural areas under
the Haryana village general
health check-up
scheme(HVGHCS), in which
3781 patients were found pos-
itive.
The strategy of test-track-
treatment certainly proved to
be very effective as the posi-
tivity rate has come down to
3.47 per cent, the spokesman
said.
While conducting these
health check-ups, the teams are
closely monitoring every
patient and those having mild
or moderate symptoms are
being asked to stay in home
isolation, while those who are
not having home isolation
facility are made to stay in iso-
lation centres that are being set
up in the village itself.
Over 160 are admitted in
village isolation centres.
The work of door to door
health check-up is likely to fin-
ish in the next two days, the
spokesman said.
He said that when in the
month of May, India saw a sud-
den spurt in COVID-19 cases,
Haryana Government adopt-
ed proactive strategies coupled
with aggressive surveillance,
stringent containment, focused
clinical management along
with proactive Information
Education and
Communication (IEC) activi-
ties to combat the virus spread
in both urban and rural areas.
While especially empha-
sizing on the villages of
Haryana-NCR districts from
where people are traveling
daily to Delhi and other big
cities for their work, the
Haryana Government started
monitoring all such people
ensuring that the virus spread
is contained and further hot-
spot-like situations do not
arise in such villages, he said.
( #(STcTRcTSfXcW8;Dbh_c^b^eTa
$cTbcTS_^bXcXeTX]7PahP]PeX[[PVTb
?=BQ 270=3860A7
Engaging the state's youth in
its fight against the
COVID-19, Punjab
Government on Thursday
rolled out a new initiative to
take forward the state’s Mission
Fateh 2.0 as a part of the
‘Corona Mukt Punjab Abhiyan’
(COVID-free Punjab
Campaign).
Launching the initiative,
the Chief Minister Capt
Amarinder Singh has directed
the formation of groups of
seven Rural Corona Volunteers
(RCVs) per village or munici-
pal ward as a cadre to fight the
pandemic.
With the villages more
badly affected in the second
wave of COVID, it was impor-
tant to drive a strong campaign
for ‘Corona Mukt Pind’, said the
Chief Minister directing the
Department of Sports and
Youth Affairs and the Deputy
Commissioners to immediate-
ly form such RCVs to be the
torchbearers in the war against
the contagion.
“Existing clubs can also
become RCVs,” he said, adding
that these could work as a pow-
erful support system for the
Panchayats and Municipalities
in the war against COVID.
Interacting with youth
from rural and urban areas
through video conferencing,
the Chief Minister said that as
a result of the people’s support,
the number of cases in the State
had come down from around
9,000 to 4,000-plus in a matter
of about three weeks. “But
given the impact on rural areas
this time, the situation contin-
ues to be grave,” he said.
The Chief Minister tasked
the RCVs with carrying for-
ward the 3Ts drive (Test, Trace
and Treat), taking care of poor
and elderly and connecting
them to the COVID Control
Rooms and helplines, con-
ducting Theekri Pehras in all
villages, promoting COVID
appropriate behaviour, assisting
villagers in accessing adequate
healthcare, discouraging
quacks, encouraging down-
load of COVA App, besides
preparing and displaying ban-
ners and pamphlets.
The youth could also play
a big role also in countering
rumours and false propaganda
on social media, he said, adding
that the State Government will
extend full support to them to
fight the pandemic “and save
Punjab together”.
He also urged the RCVs to
spread awareness among the
people in rural areas on the
proper protocols to be fol-
lowed for COVID treatment,
given the spread of black or
white fungus due to high usage
of steroids.
“Beginning today, the
Department of Youth Affairs
has started distributing one
lakh badges and four lakh car
stickers carrying the message ‘I
Am Vaccinated’,” he said while
urging the RCVs to encourage
people to “flaunt their vacci-
nation status”, and it would dis-
play the spread of our vacci-
nation coverage and motivate
others too. As a reward for their
participation in the war against
Corona, every RCV will be
given a Sports Kit, to be dis-
tributed on August 12
(International Youth Day), said
the Chief Minister, directing
the Department of Sports and
Youth Affairs to immediately
commence the procurement of
15,000 kits.
Expressing the hope that
Mission 2.0 would be the last
battle in the war against
COVID, the Chief Minister,
however, underlined the need
to be prepared for a third
wave. The event was simulta-
neously telecast in all districts,
sub-divisional headquarters,
as well as 500 rural and urban
locations, presided over by
Speaker, Deputy Speaker,
Ministers, MPs, MLAs, DCs,
SDMs, Mayors, presidents of
MCs, chairmen and members
of Zila Parishads, and
Panchayat Samitis or
Sarpanches.
Youth icon and Brand
Ambassador of State's COVID
Vaccine Campaign Sonu Sood
underscored the need to create
awareness amongst people
especially in rural areas about
the importance of vaccination.
He said that he will personal-
ly try to ensure maximum vac-
cine supply from Bharat
Biotech for the State. He also
evinced interest in setting up a
medical oxygen plant in
Government Hospital, Moga.
?=BQ 270=3860A7
Haryana Chief Minister
Manohar Lal Khattar on
Thursday directed to set up
sewage treatment plants (STPs)
at the exit point of all drains
that flow into Saraswati river
and work towards setting up a
power plant on the dam to be
built in Adi Badri.
The Chief Minister was
presiding over the meeting of
the Governing Body of the
Saraswati Heritage
Development Board here.
During the meeting, the
Chief Minister was apprized
that to make this river flow, not
only will the dam be built but
barrage and small reservoirs
will also be constructed. This
will bring the ground water
level up, so that not only will
the area come out of the dark
zone, but it will also be in the
interest of the farmers.
The Chief Minister also
took stock of the progress
related to the construction of
the proposed dam in the
Saraswati project and gave
necessary directions for setting
up a power generation plant
with the dam.
Along with this, he also
asked to settle the pending
matters with Himachal
Pradesh at the earliest.
He said that since dams are
already being constructed, a
large power generation plant
should be set up to produce as
much electricity as possible.
I t
w a s
informed
in the
meeting
that work
is being
done to
promote
tourism
at the
ghats at
A d i
B a d r i
and Pipli.
A cafete-
ria has been established in
Adi Badri with the assistance
of the Tourism Department.
Work is also being done to
build the riverfront to attract
tourists.
The Chief Minister said
that everything should be done
in a time-bound manner and
all works should be completed
within the stipulated time.
Khattar was apprized that
a plan is being devised to con-
struct an underpass on the
National Highway to connect
the ghat at Pipli with the zoo
to attract tourists. This will be
completed soon.
It was also informed that
despite STPs being installed in
many places, they are not
being commissioned and dirty
water is being pumped direct-
ly into the Saraswati river.
Taking strong cognizance
of this, the Chief Minister
directed the Public Health
Department to monitor the
STPs. He also said that in case
of STP, the task of fault-finding
should also be seen by the offi-
cers of the Public Health
Department.
The Chief Minister also
said that the Board will bear the
expenses for the Centre set up
under the Chair at Kurukshetra
University for research on the
Saraswati River.
For this, he asked to ear-
mark Rs 20 lakh annually for
the Chair and for research
works such as water testing and
carbon dating etc.
3XQMDELQYROYHVRXWKWRILJKW
RYLGXQGHU0LVVLRQ)DWHK
7PahP]P2SXaTRcbc^R^XbbX^]BC?bc^bc^_U[^f^USXachfPcTaX]c^BPaPbfPcX
0bbTQ[hB_TPZTa?aT2WP]S0VVPafP[PSX]XbcTabcWT^PcW^U^UUXRTP]SbTRaTRhc^aTRT]c[hT[TRcTSBP[c;0PWTbW
9TT]PPccWTEXSWP]BPQWP^]CWdabSPhPb2WXTUX]XbcTaCXaPcWBX]VWAPfPcP]S^cWTab[^^Z^] ?X^]TTa_W^c^
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG3ORW1R+WR+6HODTXL,QGXVWULDO
$UHD'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL3KRQH
RPPXQLFDWLRQ2IILFH)6HFWRU12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
3. dccPaPZWP]S
347A03D=k5A830H k0H !'!!
?=BQ 347A03D=
Continuing the focus on
tackling the Covid-19 pan-
demic and assisting those
affected by it, the Bharatiya
Janata Party core group mem-
bers have stressed on utilising
more resources and maximis-
ing the number of people being
provided relief.
During its meeting on
Thursday evening, the BJP
state core group discussed the
measures taken by the organi-
sation so far and the manner in
which the third wave of Covid
will be faced. The BJP State
president Madan Kaushik
informed that the party’s state
general secretary Suresh Bhatt
has been made the in-charge of
the Gaon Me Sewa campaign.
He will inform by Friday about
the villages in which the MPs,
MLAs and office bearers will
participate in the campaign.
The Chief Minister and minis-
ters will also participate in this
campaign while observing
Covid guidelines. The chief
minister and ministers will
participate in the campaign vir-
tually in two villages each. CM
Tirath Singh Rawat, former
CM Trivendra Singh Rawat,
party's state in-charge
Dushyant Kumar Gautam and
other members were present in
the core group meeting.
Earlier, the BJP national
general secretary (organisa-
tion) BL Santhosh, who is on a
two-day visit to Uttarakhand,
sought feedback from office
bearers of all the seven cells of
the party and the core group
members about the Covid
related works being done by the
organisation in the state.
Informing about the meeting,
Kaushik said that the national
general secretary had laid stress
on the training of party work-
ers at the district level. The
Kisan Morcha members can
study the situation and provide
its suggestions to the govern-
ment. The government can
implement the suggestions as
per the geographical condi-
tions.
The heads of all the cells
were also directed to increase
communication till the booth
level.
Separate work targets were
given to heads of different
cells. The Yuva Morcha was
given the target of 2,000 units
of blood while the other six
cells were given a target of 2,000
units of blood. The Yuva
Morcha has also been directed
to undertake the Mera Gaon
Corona Mukt, Mera Booth
Corona Mukt campaign across
the state from June 1 to 12.
Further, the Yuva Morcha has
also been directed to make a list
of doctors, nurses, Covid war-
riors, laboratory technicians
and workers involved in cre-
mation and felicitate them as
Covid heroes.
Such persons should also
be brought to the fore who are
playing their roles actively even
though not visible in the front
line.
%-3WRVWHSXSRYLGUHOLHIHIIRUWVDFURVV6WDWH
2^aTVa^d__Pach
RT[[bSXbRdbb
TP]bc^
T]WP]RTTUU^acb
PVPX]bc2^eXS
?=BQ 347A03D=
Questioning the timing of
the meeting of the BJP
core group held in Dehradun
on Thursday the Uttarakhand
Congress has said that the BJP
has come into damage control
mode.
The spokesperson of
Uttarakhand Congress, Garima
Dasauni said on Thursday that
the BJP is the party which
always likes to be on poll mode
and in view of the upcoming
assembly elections it is now try-
ing to control the damage
caused to it due to inapt han-
dling of the pandemic of Covid
19.
She said that when the
disease was at its peak in the
state and disaster prevailed
everywhere the BJP leaders
and workers had isolated them-
selves. Dasauni said that now
on the occasion of completion
of two years in office of Prime
Minister Narendra Modi, the
BJP is organising a ‘ service day’
and has asked its workers to
visit villages which is an inhu-
man and insensitive approach.
The Congress leader said
that thousands of people lost
their lives during the pandem-
ic due to lack of basic health
facilities.
She said that though BJP is
trying to control the damage,
the people of the state would
not forgive it for its follies.
People of Uttarakhand are
determined to show the exit
door to the BJP in the assem-
bly elections, she claimed.
3_^W*2:@S_bUWb_e`
]UUdY^WQTQ]QWU
S_^db_UhUbSYcU
?=BQ 347A03D=
Retired Justice B C Kandpal
has said immediate inter-
vention is needed in West
Bengal which is reeling under
post poll violence. He was
addressing a virtual press
conference of ‘Save Bengal’
forum here on Thursday.
He said that 16 out of 23
districts of West Bengal are
affected by violence and 25
people including women have
lost their lives. Kandpal said
that 4000 to 5000 people have
fled to neighbouring states
due to violence and the gov-
ernment should provide them
a relief package.
Terming the violence as
an attack on the culture and
sovereignty of the country, he
said that an inquiry by the
National Investigation Agency
(NIA) should be ordered into
the violence.
Major General ( Retd)
Ranvir Yadav said that the
newly elected West Bengal
government has failed in con-
trolling the violence, impar-
tial investigation of the inci-
dences of violence and in
acting against the perpetra-
tors of violence. He said
women are deliberately being
targeted to spread fear among
the people.
Under the Save Bengal
forum many prominent
retired bureaucrats, retired
judges and armed forces vet-
erans have written a letter to
the President Ram Nath
Kovind and requested that the
West Bengal violence should
be probed by the NIA.
³=80_a^QT]TTSTSU^a
F1_^bc_^[[eX^[T]RT´
?=BQ 347A03D=
Drawing flack for non avail-
ability of Amphotericin B
injections used in the treatment
of Mucormycosis patients, the
state health department got
some relief on Thursday as it
received 15000 doses of the
injection. The Drug controller
Uttarakhand, Tajber Singh said
the state government has
received 15000 injections from
Udham Singh Nagar based
company VHB Medicosciences
Limited.
He said that the injections
would be supplied to different
hospitals of the state as per
requirement. Singh added pur-
chase orders for 1190 injections
from different medical insti-
tutes have been given to dif-
ferent drug manufacturers. He
said that the state had received
500 injections of Amphotericin
B at the start of this week. The
drug controller claimed that the
state has 400 injections of
Tocilizumab available with it
and an order for 400 more has
been given.
The infection of the
Mucormycosis (Black Fungus)
is steadily increasing in the
state.
The disease affects the eye
and brain of the patients and
the threat on their lives increas-
es by the infection. The
Uttarakhand government has
notified the disease under the
epidemic act and has mandat-
ed 12 Dedicated Covid hospi-
tals for its treatment. In the
state a total of 155 patients of
Mucormycosis are undergo-
ing treatment in different hos-
pitals and 14 patients of the dis-
ease have died.
The supply of 15000 doses
of the much sought after injec-
tion Amphotericin B would
help in providing treatment to
the patients admitted in the dif-
ferent hospitals of the state.
Eµ[XQ^TWUdc!%
Y^ZUSdY_^c_V1]`X_dUbYSY^2
CWTaTXbPWdVT
STP]SU^acWT
X]YTRcX^]dbTSX]
caTPcT]c^U
Q[PRZUd]Vdb
?=BQ 347A03D=
On the slow pace of the
Covid 19 vaccination and
acute shortage of the medicines
needed in the treatment of
Mucormycosis,theUttarakhand
Congress organised a dharna at
the state health directorate on
Thursday. On the day the Vice
President of Uttarakhand
Congress Surya Kant
Dhasmana and others arrived at
the health directorate and
staged a sit-in there.
Dhasmana said that the
vaccination drive in the state
has virtually ceased for 18 plus
individuals. He said that in all
the vaccination centres the
posters of no vaccines are greet-
ing the people. Dhasmana said
that only two percent of the
population of Uttarakhand has
been vaccinated so far and at
the present pace it would
require at least three years for
vaccination of the population.
Dhasmana said that the union
government has relieved itself
from the responsibility of pro-
viding vaccines by loading it on
the states. The state govern-
ments are not able to procure
the vaccines due to which peo-
ple are suffering. He also tar-
geted the health department for
failing to provide injections for
the Black fungus. Later he
marched into the office of
Director General (DG) health
servicesDrTriptiBahugunaand
questioned her on the non
availability of vaccines and
injections for treating Black
fungus. The secretary of
Pradesh Congress Committee
(PCC) Vikas Negi, Mahesh
Joshi and Girish Bhadri and
others accompanied Dhasmana.
2^]V_a^cTbcb^eTaePRRX]T
0_W^cTaXRX]1bW^acPVT
?=BQ 347A03D=
The graph of the contagion
of Covid 19 is continuing
on its downward path in
Uttarakhand. The state health
department reported 2,146 new
patients of the disease on
Thursday which increased the
cumulative count of the
patients of the disease to
3,23,483 in the state.
The authorities also report-
ed the death of 81 patients from
the disease on the day after
which the death toll has
mounted to 6,201.
The authorities reported
6306 recoveries on Thursday in
the state. A total of 2,72,428
patients have recovered from
the disease in the state far.
Out of 81 deaths reported
on Wednesday, 15 occurred at
All India Institute of Medical
Sciences (AIIMS) Rishikesh,
seven at Government Doon
Medical College (GDMC) hos-
pital Dehradun, six at Sushila
Tiwari Government hospital
Haldwani and five at HNB
base hospital Srinagar. Similarly
four patients each died at
Himalayan hospital Dehradun,
District hospital Rudrapur and
Medicity Udham Singh Nagar.
Dehradun reported 330
new cases of Covid -19 on
Thursday while Nainital
reported 261, Pithoragarh 252,
Haridwar 219, Udham Singh
Nagar 205, Pauri 181, Almora
178, Chamoli 153, Uttarkashi
103, Rudraprayag 98,
Bageshwar 74, Tehri 51 and
Champawat 41 new cases of the
disease on the day.
The state now has 39,177
active patients of the disease.
Haridwar is the top position in
the list of active cases with
7,939 cases. Dehradun is on
second position with 5,427
cases, Pauri 4,247, Tehri 4,171,
Udham Singh Nagar 3,809,
Nainital 2,717, Chamoli 2,384,
Rudraprayag 1,943, Almora
1826, Pithoragarh 1,658,
Bageshwar 1,233, Uttarkashi
1,032, and Champawat 791
active cases of the disease.
To contain the contagion of
Covid-19, the state adminis-
tration has set up 435 contain-
ment zones in different parts of
the state.
In the ongoing vaccination
drive 17,524 people were vac-
cinated in 484 sessions in dif-
ferent parts of the state on
Thursday. A total of 6,82,040
people have been fully vacci-
nated while 21,72,760 have
received the first dose of the
vaccine in the state.
4`gZU*+#%'WcVdYTRdVd
)UVReYdcVa`ceVUZ_#%Ycd
0dcW^aXcXTb
aT_^acTS%%
aTR^eTaXTb^]
CWdabSPhX]cWT
BcPcT
?=BQ 347A03D=
The All India Institute of
Medical Sciences (AIIMS)
Rishikesh has clarified that
only the patients having mod-
erate symptoms of Covid- 19
would be admitted to the
Covid Care Centre (CCC)
prepared by Defence Research
and Development
Organisation (DRDO) at
IDPL Rishikesh. The 500 bed
centre named after Rifleman
Jaswant Singh Rawat was
inaugurated by chief minister
(CM) Tirath Singh Rawat on
Wednesday.
Trauma surgeon, AIIMS
and in-charge of 'Rifleman
Jaswant Singh Rawat of IDPL
centre, Dr Madhur Uniyal
informed that the centre has
four wards of 100 oxygen
beds each and a centralized
oxygen supply is available in
these wards. He informed that
Covid patients with moderate
symptoms would be
treated at the centre
while 100 ICU beds
are available in the
AIIMS Rishikesh for
proper treatment of
critical patients of
C o v i d - 1 9 .
“Ambulances have
been kept ready to
transport critical
patients from IDPL
to AIIMS. The cen-
tre also has a facility
for admission of
children and Mucar
patients,’’ he said.
A 'Raibaar Desk'
has been set up in
the centre by which
the information
about the health of
admitted Covid-19
patients can be gath-
ered. 'Raibaar' is a
word of Garhwali
language which means con-
veying the message.
B4A8DB?0C84=CBC
14CA0=B?AC43C
088B5AC74
24=CA4
?=B Q =08=8C0;
Pulling up the Mussoorie
Dehreadun Development
Authority (MDDA) vice chair-
man and Dehradun municipal
commissioner for not sub-
mitting a detailed report on
buildings being constructed
illegally on the foothills of
Mussoorie in violation of the
foothill policy, the
Uttarakhand high court has
directed that the report be
submitted in the court by
June 9.
The division bench of
chief justice RS Chauhan and
justice Alok Kumar Verma
issued this direction while
hearing on a public interest lit-
igation filed by Dehradun res-
ident Reenu Paul.
According to the case
details, finding the buildings
constructed on land with more
than 30 degree gradient to be
in violation of Uttarakhand
building bylaws, the division
bench had in the previous
hearing directed that such
constructions should be
sealed. The petitioner had also
pointed out that according to
a 2015 amendment in the
Uttarakhaand construction
policy, construction of build-
ings was not permitted on land
with more than 30 degrees
gradient.
However, in blatant viola-
tion of this law, various small-
er hills between Dehradun
and Mussoorie are being cut
and buildings are being con-
structed indiscriminately.
The petitioner had further
contended that such activity is
causing damage to the envi-
ronment and making the
Shivalik mountains unstable.
Taking serious cognisance of
the matter, the high court had
sought a detailed report by
May 27. In addition to this, the
petitioner had also provided
photographs to the court to
show how hills were being
destroyed indiscriminately for
construction of buildings.
It is pertinent to mention
here that though the issue of
indiscriminate constructions
on the foothills between
Dehradun and Mussoorie was
raised earlier too, the author-
ities evidently ignored the
issue.
The previous mayor of
Dehradun, Vinod Chamoli
had also expressed concern
and written about this to the
state government while in
the mayoral office.
72_d[[bd_^UUXRXP[bbTTZbSTcPX[TSaT_^ac^]
dbb^^aXTU^^cWX[[R^]bcadRcX^]bQh9d]T(
?=BQ 347A03D=
The noted environmentalist
Sunder Lal Bahuguna who
passed away on May 21 while
bravely battling Covid-19 at the
age of 94 years, shared an
affectionate bond with Natraj
Green bookshop and with its
late owner Sohan Lall. They
both were born in 1927 and
had graduated from the same
college in Lahore. Bahuguna
had met Lall in the bookshop
in the late seventies. Upendra
Arora of Natraj had the oppor-
tunity of meeting Bahuguna
last year after the world was hit
by Covid-19 and asked him if
he had any message for the
nation and also took the oppor-
tunity to show him the old pho-
tograph of him visiting the
bookshop. He recorded his
message to telling effect and
wrote “say yes to life and no to
death”. Bahaguna was always
deeply appreciative of the fact
that a bookshop dedicated to
spreading the message of envi-
ronment conservation was pre-
sent in the heart of the city. He
felt that Natraj would serve as
a reminder for all generations
to come to protect and save
nature. Bahuguna's compas-
sion for saving forests, should
be a positive reinforcement to
us all in these unprecedented
times, that nature does have an
answer to all ills of society, said
Arora.
1PWdVd]P³bTbbPVT
aTTQTaTS¯bPhhTb
c^[XUT]^c^STPcW
?PcXT]cb^U^STaPcTbh_c^bc^QTPSXccTSX]83?;RT]caT)088BA
CWT_TcXcX^]TaWPSP[b^_^X]cTS^dccWPc
PRR^aSX]Vc^P! $PT]ST]cX]cWT
DccPaPZWPP]SR^]bcadRcX^]_^[XRh
R^]bcadRcX^]^UQdX[SX]VbfPb]^c_TaXccTS
^][P]SfXcW^aTcWP]STVaTTbVaPSXT]c
?=BQ 347A03D=
In order to step up marketing
of organic produce of the
state, the Agriculture minister
Subodh Uniyal has directed
officials to construct oulets for
special agricultural organic pro-
duce at the earliest. A total of
1,300 outlets will be established
as part of this plan. In the first
phase, 344 outlets and 20 exclu-
sive outlets will be established at
the airport, railway stations,
bus stations and prominent
locations.
The exclusive oulets will be
set up in Guptkashi, Gangotri,
Muni Ki Reti, Joshimath,
Devprayag, Jolly Grant,
Kotdwar, Ranikhet, Haridwar,
Pauri, Pithoragarh,
Chinyalisaud, Chitai Golu
Devta, Haldwani, Nainital,
Dehradun, Mussoorie, Srinagar,
Narendranagar and Pantnagar.
As part of this scheme, special
focus will be laid on the pack-
aging, branding, value enhanc-
ing exhibition and marketing of
the state’s special organic pro-
duce.
The aim of this scheme is to
provide good price to the farm-
ers while at the same time facil-
itating special organic produce
of the state to customers at
appropriate price. Removing
the middlemen from this
process is also a major aim of
this scheme. About 6,400
groups will be provided input
and training under this scheme
which will also aim at inform-
ing tourists about the specialty
of the state’s organic produce to
make them brand ambassadors.
0c^cP[^U
^dc[TcbfX[[QT
TbcPQ[XbWTSPb
_Pac^UcWXb_[P]
=Q[U_bWQ^YS
`b_TeSU
_edUdcQd
UQbYUcd*E^YiQ
4. ]PcX^]#
347A03D=k5A830H k0H !'!!
?=BQ =4F34;78
In the last 50 years (1970-
2019), as many as 117
cyclones hit India and claimed
over 40,000 lives, according to
a study on extreme weather
events. However, the study
stated that the mortality rate
due to tropical cyclones has
come down significantly over
the past 10 years.
A total of 7,063 extreme
weather events killed 1,41,308
people during the 50-year
period in the country, which
included 40,358 (or 28 per
cent) due to cyclones and
65,130 (a little over 46 per
cent) due to floods, the study
said.
The research paper pub-
lished earlier this year has
been authored by M Rajeevan,
Secretary of Ministry of Earth
Sciences, along with scien-
tists Kamaljit Ray, S S Ray, R
K Giri and A P Dimri.
Kamaljit Ray is the lead author
of the paper.
The study assumes signif-
icance against the backdrop of
the back-to-back severe
cyclones, Tauktae and Yaas,
hitting India's western and
eastern coasts respectively,
leaving a trail of destruction.
The study stated that the
number of deaths due to
cyclones has come down sig-
nificantly in the last two
decades, whose latter years
have witnessed much
improvement in the IMD's
weather forecast abilities.
In 1971, the study said,
four tropical cyclones devel-
oped in the Bay of Bengal
within a period of about six
weeks. Of these, the most
destructive one struck the
Odisha coast. About 10,000
people were reported to have
lost their lives, and more than
one million rendered home-
less, it said.
In 1977, two tropical
cyclones developed over the
Bay of Bengal during
November 9-20, out of which
the second one (Chirala
cyclone) which was a very
severe tropical cyclone with a
wind speed of the order of 200
kilometres per hour along
with tidal waves 5 metres
high, hit coastal Andhra
Pradesh, the study said.
The estimated mortalities
were around 10,000 and total
damage to infrastructure and
crops was more than USD 25
million. The decade from
1970-1980 alone recorded over
20,000 mortalities due to
cyclones.
“Overall, the analysis
showed that the mortality rate
associated with tropical
cyclones decreased by almost
88 per cent in the last decade
(2010–2019) in comparison to
the earlier decade (2000–2009)
despite the significant increas-
ing trend of severe tropical
cyclones during the post-mon-
soon season over Bay of
Bengal,” the paper stated.
India Meteorological
Department Director General
Mrutunjay Mohapatra said
the reason for declining fatal-
ities during cyclones over the
years was due to improvement
in IMD's forecast abilities.
Earlier, storm surge was the
major reason behind fatalities,
but now deaths are caused
mostly by the collapse of a tree
or a house now, he said.
?=BQ =4F34;78
The Centre on Thursday
granted a one-year exten-
sion of service to incumbent
chiefs of Research and
Analysis Wing (RAW) and
Intelligence Bureau (IB),
Samant Kumar Goel and
Arvind Kumar respectively,
who were due to retire on
June 30.
Goel, a 1984-batch IPS
officer from Punjab cadre,
would continue to be the
Secretary of Research and
Analysis Wing (RAW) for a
one-year period beyond the
presence tenure, according
to an official order.
Likewise, Kumar, an IPS
officer of Assam and
Meghalaya cadre, will con-
tinue as Director of
Intelligence Bureau for a peri-
od of one year after
June 30.
The extensions were
cleared by the Appointments
Committee of Cabinet, read
the separate orders, signed by
secretary of the ACC and
Establishment Officer
Srinivas R Katikithala.
8=8=380
FORQHVNLOOHG.LQUV6WXG
?=BQ =4F34;78
Defence Minister Rajnath
Singh on Thursday
launched an online medical
consultation platform to ensure
hassle-free health services for
Armed forces' personnel and
veterans.
Speaking after the virtual
launch, he said the online out-
patient platform will ensure
widespread access to quality
health services in remote areas
besides reducing the load on
the hospitals.
This is a very important
step taken at a very critical time
for the health of service per-
sonnel, the Defence Minister
said even as he outlined that the
Central Government was con-
stantly monitoring the Covid-
19 situation and taking appro-
priate steps to fight it.
He said the second wave of
the disease is more dangerous
and unpredictable than the
first one and lauded the role of
the armed forces in contribut-
ing to the national effort to
meet this challenge.
He pointed out that the
Central Government has taken
steps to improve the supply of
medicines, medical oxygen and
other equipment through high-
level committees and a group
of ministers.
Chief of Defence
Staff(CDS) General Bipin
Rawat, Army Chief General M
M Naravane and Navy Chief
Admiral Karambir Singh were
among those who attended
the event.
Rajnath also talked about
the anti-Covid oral drug 2-
deoxy-D-glucose (2-DG)
developed by the Institute of
Nuclear Medicine and Allied
Sciences (INMAS), a leading
laboratory of the DRDO, in
collaboration with Dr Reddy's
Laboratories (DRL),
Hyderabad.
He said the drug has yield-
ed good results.
][X]TTSXRP[R^]bd[cPcX^]
U^a0aTSU^aRTb_Tab^]]T[
eTcTaP]b[Pd]RWTS
4YZVWd`W:3C2HXVed
jcVieV_dZ`_`WdVcgZTV
?=BQ =4F34;78
The India Meteorological
Department (IMD) on
Thursday said that conditions
are favourable for the onset of
monsoon over Kerala around
May 31, a day ahead of its usual
date.
“Monsoon has advanced
into some more parts of
Maldives-Comorin area,
Southwest and east-central Bay
of Bengal, most parts of
Southeast Bay of Bengal and
some parts of west-central Bay
of Bengal on Thursday,” the
IMD said. The normal onset
date of seasonal rains over the
Indian mainland is June 1.
The IMD has warned that
strong winds attaining speeds
of 40 to 50 kmph are likely over
the Kerala coast till May 29.
According to Skymet, a
private weather forecaster,
cyclone Yaas expedited the
advance of monsoon over these
parts and the next stop is
mainland India anytime soon.
Monsoon countdown starts
amidst a change of guard over
the Pacific Ocean. A La Nina
advisory is no longer in effect
and ENSO neutral conditions
are present.
Due to Yaas, Nawana
received 28 mm rainfall, Joda-
27 mm, Joshipur-25 mm,
Lathikata-21 mm, Jhumpura-
21 mm, Champua-20 mm,
Keonjhargarh-20 mm,
Panposh-20 mm, Basudevpur-
19 mm, Chandikhol-17 mm,
Karanjia-17 mm, Rajgangpur-
14 mm, Mandira Dam-14 mm,
Swam-Patna-13 mm, Deogarh-
13 mm, Tiring-12 mm, Udala-
11 mm, Gurundia-11 mm,
Barkote-11 mm, Hatadihi-11
mm, Tihidi-11 mm, Pallahara-
11 mm in Odisha.
Monsoon is likely to arrive
over Kerala on May 31 a day
ahead of its normal arrival
date of June 1, with a possible
error margin of plus/minus
four days, IMD had said on
May 14.
The monsoon season,
which begins on June 1, is cru-
cial for summer crops and
brings about 70% of India’s
annual rainfall. It is critical to
the country’s agriculture, which
is one of the mainstays of its
economy. Monsoon spurs farm
produce and improves rural
spending. It is the lifeline for
about 60% of the country’s net
cultivated area, which has no
irrigation. The monsoon
impacts inflation, jobs, and
industrial demand. Good farm
output keeps a lid on food
inflation. Ample harvests raise
rural incomes and help inject
demand into the economy.
0RQVRRQWRKLW.HUDOD
RQ0DVDV,0'
0A270=09HC8Q =4F34;78
The Government is in a fix
over the insistence of for-
eign vaccine manufacturers,
US-based Pfizer and Moderna
and JJ, on providing indem-
nification or protection from
compensation claims in case of
adverse events before they roll
out the jabs in India, given that
the Indian companies, Bharat
Biotech and Serum Institute of
India (SII), do not enjoy any
such legal shield.
In other words, any com-
pany providing vaccines here
will have to follow the rules of
the land. The SII’s indemnifi-
cation request was turned
down by the Government last
year itself.
The foreign vaccine mak-
ers want that “if a person expe-
riences severe side-effects after
being administered the Covid-
19 jab, he/she cannot sue Pfizer
or Moderna in the US as they
have been granted immunity
from liability. The person can-
not slap a legal case against the
US government for damages
either,” experts explained,
adding that the protection is for
the next three years. To date,
India has not provided any
manufacturer of a Covid-19
vaccine indemnity against the
costs of compensation for any
severe side effects.
The experts, however, said
that the Government needs to
make up its mind quickly as
dilly dallying in the matter
would only further delay in
achieving the vaccination tar-
gets. Amid acute shortage of
vaccine availability, the
Government on Thursday
claimed that it is moving
towards ensuring at least one
crore vaccinations per day
soon.
“ We made providing 43
lakh doses in a day possible.
We should bring it up to 73
lakh in the next 3 weeks. We
should make a system to
achieve it,” said Dr VK Paul,
Member-Health, Niti Aayog.
The Government is under
intense pressure to provide
the vaccine to the people and
has been maintaining that as
soon as Pfizer indicated vac-
cine availability, one can hope
for its earliest possible
import.
Foreign Minister S
Jaishankar too is in the US
especially for the purpose of
ensuring vaccine
imports.
According to sources,
Pfizer has told the Government
that its jab has shown high
effectiveness against the SARS-
CoV-2 variant prevalent in
India and on people of Indian
ethnicity or nationality, while
it is suitable for everyone aged
12 years or above and can be
stored for a month at 2-8
degrees.
6_bUYW^fQSSY^U]Q[Ubcµ
TU]Q^T_VUWQcXYUT
Y^9^TYQUQfUc7_fdY^VYh
?=BQ =4F34;78
The Centre on Thursday
came out with a detailed
counter to States’ allegations of
closure of supply of vaccines to
them saying it was the States
which wanted “flexibility” and
“a say” in procurement of vac-
cines and it was in view of their
demand that a new “decen-
tralised” system was brought in.
As per the system, the
Government said, the Centre
was to procure 50 per cent of
vaccines produced domestical-
ly for States for free for 45+
group and a special channel was
to be created for the remaining
50 per cent which the State
Governments and private hos-
pitals could purchase.
In a statement titled ‘Myths
Facts on India’s Vaccination
Process’, Dr VK Paul, Member-
Health, Niti Aayog, listed out
seven ‘myths’ ranging from
the Centre abdicating its
responsibility to the states, not
doing enough to buy vaccines
from abroad, not giving
enough vaccines to the States
and not approving vaccines
available globally among oth-
ers. He asserted that these are
arising due to “distorted state-
ments, half truths and blatant
lies”.
He said the Centre ran the
entire vaccine programme
from January to April and it
was quite well-administrated
compared to the situation in
May. “But States, who had not
even achieved good coverage of
healthcare workers and front-
line workers in 3 months,
wanted to open up the process
of vaccination and wanted
more decentralisation,” he
stressed.
“Health is a State subject
and the liberalised vaccine pol-
icy was a result of the incessant
requests being made by the
states to give them more power.
The fact that global tenders
have not given any results only
reaffirm what we have been
telling the States from day one:
that vaccines are in short sup-
ply in the world and it is not
easy to procure them at short
notice,” he maintained against
the backdrop of Delhi Chief
Minister Arvind Kejriwal com-
plaining about foreign vaccine
makers not being ready to deal
with States and the global ten-
ders floated by States not evok-
ing a warm response from
these manufacturers.
Incidentally, a number of
Opposition Chief Ministers
and leaders had sought for
more power to the States in the
vaccine procurement process.
Facing accusations of
delay in placing orders for vac-
cines, the government said it
has been pursuing Pfizer, JJ
and Moderna since mid-2020
for the earliest possible
imports, and has even waived
local trials for well-established
foreign vaccine makers.
Buying vaccines internation-
ally is not similar to buying
''off-the-shelf'' items, Paul
maintained.
On allegations by some
states that the Centre is not giv-
ing enough vaccines to the
states, it pointed out that the
Centre is allotting enough vac-
cines to the states in a trans-
parent manner as per agreed
guidelines.
The behaviour of some of
our leaders, who in spite of full
knowledge of the facts on vac-
cine supply, appear on TV
daily and create panic among
the people is very unfortunate.
This is not the time to play pol-
itics. We need everyone to
unite in this fight, the state-
ment said.
The Government also dis-
missed a report published by
The New York Times on India's
Covid death toll and called it
completely baseless and false.
In its report, the NYT esti-
mated that India's real Covid
death toll could be way higher
than what has officially been
reported.
4V_ecVcV[VTedDeReVd¶[RSTYRcXVd
?=BQ =4F34;78
Prime Minister Narendra
Modi on Thursday chaired
a high-level meeting to review
the National Digital Health
Mission (NDHM) that sug-
gested that a Unified Health
Interface (UHI) should soon
be rolled out.
Chairing the meet, the
Prime Minister said that the
mission will bring ease of liv-
ing for citizens as they can avail
a large number of health ser-
vices via it. The meeting
expected that the UHI would
be soon rolled out.
It will allow users to
search, book and avail neces-
sary healthcare services such as
tele-consultations or labora-
tory tests. The system will
ensure that only verified
healthcare providers join the
ecosystem, a statement from
the Prime Minister's Office
said.
This interface is likely to
unleash a digital health tech
revolution with innovations
and various services for citi-
zens. In such a manner, health-
care infrastructure and human
resources can also be utilised in
a more efficient manner across
the nation, the statement said.
On August 15, 2020, dur-
ing his Independence Day
address, Prime Minister had
announced the launch of
NDHM. Since then, the digital
modules and registries have
been developed and the mis-
sion has been rolled out in six
Union Territories.
So far, nearly 11.9 lakh
Health IDs have been generat-
ed and 3106 doctors and 1490
facilities have registered on
the platform.
The meeting also discussed
the concept of UPI e-Voucher
developed by National
Payment Corporation of India
(NPCI).
This digital payment
option will enable financial
transactions linked to specific
purposes which can be used
only by the intended user. It can
be useful for targeted and effi-
cient delivery of various gov-
ernment schemes and an
immediate use of UPI e-
Voucher could be healthcare
services.
Modi directed that steps be
expedited to expand operations
under the NDHM. He
observed that though the tech-
nical platform and building up
of registries are inevitable
essential elements, the utility of
the platform to the citizens will
be visible only by way of
enabling citizens across the
country to avail of services like
tele consultation with a Doctor,
availing services of a lab, trans-
ferring test reports or health
records digitally to the Doctor
and paying digitally for any of
the above services.
2E83 (E0228=4?A2DA44=C
CQicYdgQcCdQdUcgXYSXgQ^dUTVUhYRYYdi
?=BQ =4F34;78
India is witnessing a down-
swing in the second wave of
Covid-19 and hopefully it will
be sustained even when restric-
tions are gently, systematically
and cautiously relaxed, the
Government said on Thursday
as it pointed out a steady
decline in new infections
recorded in the country for the
last 20 days, with 24 States wit-
nessing a dip in active cases
since the last week.
The country continues to
note stabilisation of second
wave in most parts, both by the
number of cases and positivi-
ty rate, and despite a sustained
and high overall testing cover-
age which is “reassuring”, NITI
Aayog member (Health) V K
Paul said at a Press conference
here.
“We are achieving this in
face of very significant restric-
tions in most states in addition
to other tools and operations,
including testing and Covid
appropriate behaviour and vac-
cination efforts. Nonetheless, it
is reassuring that we are on the
downswing of the second wave
and we do hope and believe
that it will be sustained even
when restrictions are gently,
systematically and cautiously
opened up,” he said.
Health ministry Joint
Secretary Lav Agarwal said
while Covid-19 testing has
increased manifold, a steady
decline in weekly COVID-19
positivity rate has been seen
since the last three weeks.
Paul said the vaccination
pace should pick up in July.
“We have a total of 51.6 crore
doses, a large proportion of it
is available and has to be used
in an efficient manner. Bharat
Biotech which started with 90
lakh capacity is ramping up and
it is well within our expectation
that it can reach ten times the
production level to 10 crore per
month in the next few months,”
he said.
Paul said similarly the
Serum Institute of India is also
ramping up vaccine production
from 6.5 crore per month to 11
crore or even more in months
to come. Other vaccines in the
pipeline are also moving close
to increasing supplies such as
Sputnik, Zydus and Genova
vaccines so steady progress is
being made.
*RYW 6WDWHVVHH
GLSLQDFWLYHRYLG
FDVHVVLQFHODVWZHHN
CWTX]XbcTa^UBcPcTU^a2d[cdaTP]SC^daXb8]ST_T]ST]c2WPaVT?aPW[PSBX]VW?PcT[PccT]SbPSXbRdbbX^]^]3dQPX4g_^cWa^dVWeXST^R^]UTaT]RX]VX]=Tf3T[WX
^]CWdabSPh?aTbXST]c822A3aEX]PhBPWPbaPQdSSWTP]ScWT36822A3X]TbW:?Pc]PXZP[b^bTT] ?81
8cfX[[P[[^fdbTabc^
bTPaRWQ^^ZP]SPePX[
]TRTbbPahWTP[cWRPaT
bTaeXRTbbdRWPb
cT[TR^]bd[cPcX^]b^a
[PQ^aPc^ahcTbcb
3QV_bb_Y^W_ed_Ve^YVYUTXUQdXY^dUbVQSUWYfU^
5. ]PcX^]$
347A03D=k5A830H k0H !'!!
B0D60AB4=6D?C0 Q :;:0C0
As it takes a natural calami-
ty to bring Narendra Modi
and Mamata Banerjee to return
to the dialogue table the Prime
Minister and Bengal Chief
Minister will hold a brief dis-
cussion on the extent of dam-
age left by super cyclone Yaas
that on Wednesday hit coastal
Bengal and Odisha.
The duo will speak to each
other for the first time since the
Trinamool Congress roared
back to power on May 2 defeat-
ing BJP in the State Assembly
elections which saw unprece-
dented washing of dirty linen
in public.
The Prime Minister would
meet her on Friday at
Kalaikunda airport from where
he would fly off to Delhi after
making an aerial survey of
Odisha and parts of East
Midnapore, Banerjee on
Thursday said.
Bengal might have suf-
fered a loss in the vicinity of
C15,000 crore in the super
cyclone that conspired with a
full moon high tide to burst 134
dams and inundate large tracts
of land with saline water leav-
ing lakhs of fishes dead, ren-
dering thousands of village
ponds useless and reducing
thousands of hectares of land
unworthy of cultivation in four
districts of East Midnapore,
two 24 Parganas and Howrah
the Chief Minister informed.
“The Prime Minister is
coming to Bengal tomorrow.
He will first go to Balasore,
Jaleswar and Bhadrak in
Odisha and after that, he will
land at Kalaikunda in West
Midnapore via Digha in East
Midnapore to assess the extent
of damage, due to cyclone
Yaas. He will meet me at
Kalaikunda” enroute to Delhi,
Banerjee said adding after her
meeting with the Prime
Minister she would herself go
to Digha from where she would
make an aerial survey of East
Midnapore the next day.
Before meeting Modi the
Chief Minister Banerjee would
make an aerial survey of the vil-
lages of North and South 24
Parganas. “Before the meeting
with the PM, I will have an aer-
ial survey at Sandeshkhali and
Hingalganj in North 24
Parganas. Then, I will visit
Sagar Island at South 24
Parganas to review the damage
and devastation due to post
Yaas,” Banerjee said adding
though it would not be imme-
diately possible to calculate
the extent of damage “a pre-
liminary ground report
received by me puts it at about
C15,000 crore considering the
loss of both moveable and
immoveable properties.”
The Chief Minister who on
Thursday sanctioned an initial
government grant of C1,000
crore said her Government
would start “Duarey Traan”
(relief at doorsteps) pro-
gramme “where a task force of
government officials will first
visit the localities to assess the
damage and accept application
forms from the people seeking
help and then “after making an
assessment the Government
will directly send the relief
amount to the accounts of the
people affected.”
Interestingly in an apparent
bid to avoid controversy the
local TMC leadership and pan-
chayats are being kept out of
the monetary part of the relief
programme one was told. The
whole process of assessment of
loss and granting of relief
would take a month’s time, the
Chief Minister said adding
sectors like agriculture, elec-
tricity, fishery, animal hus-
bandry, horticulture were the
worst affected due to the
cyclone.
To avoid allegations,
“regarding hoarding of relief
materials that embarrassed the
state administration,” post
cyclone Amphan last “this time
the Chief Minister will per-
sonally instruct officials and
supervise the relief operations
and ensure that they reach the
affected,” a senior official at the
CMO said adding while more
than a one crore of people were
affected by the cyclone “a total
15 lakh people have been evac-
uated and are presently kept at
various shelter homes.”
B0D60AB4=6D?C0Q :;:0C0
Bengal will extend its lockdown-
like restrictions for another
fortnight beginning May 31, Chief
Minister Mamata Banerjee said on
Thursday adding the Board exams
forClassesCIIandXwouldbeheld
between last week of July and the
last week of August.
“Though I do not consider it a
lockdownandwillratherliketocall
it restrictions as most of the estab-
lishments are open within limited
hours the Government will extend
suchrestrictionsbeyondMay31till
June 15 after which a review will be
done,” Banerjee said.
Accordingly the markets will
remain open from 7 till 10 am
everyday whereas saree and jew-
ellery shops will open between 12
and 3 pm,
Banerjeesaid.Allowingthejute
mills will to function with addi-
tional 10 percent attendance
Banerjee said “there is huge pres-
sure for products from Punjab
and so we are increasing the atten-
dance in jute industries by 10 per-
centandhenceforwardtheywillbe
allowed to work with 40 percent
attendance.”
Banerjee also said that the
Government would allow con-
struction sites to function provid-
edtheygottheirworkersvaccinated
in private hospitals and made their
in-house living arrangements for
them.
The transports including local
trains and metro, schools, colleges
and government and private offices
would remain closed at least till
June 15, the Chief Minister said
even as the daily infections in
Bengal reported a marked reduc-
tionfrommorethan19,000perday
to 16,800 cases on Thursday. There
were 153 deaths in the past 24
hours.
BOARD EXAMS
Speaking about Board exams
the Chief Minister said “Class XII
exams will be held only for the
compulsory subjects (numbering
15) in the last week of July.” The
examswillbecompletedbythefirst
week of August where after the
Class X exams would start with
reduced syllabus and for reduced
hours and for compulsory subjects
(numbering seven) only .
With this, West Bengal has
become one of the first states in the
country to announce dates for
board exams. “We understand the
importance of these two examina-
tions and so we are the first state to
announce the schedule. Higher
Secondary examination (Class XII)
will be held ahead of Madhyamik
(ClassX)becauseafterClassXIIthe
students have to go for higher stud-
ies and have to take all-India level
entrance tests which is closed by
that time,” Banerjee said.
While 8.5 lakh students would
appear for the HS exams 12 lakh
will take the Madhyamik exams,
Banerjee said adding both the tests
would be of 1.5 hours instead of 3
hours with reduce d syllabus and
question, the Chief Minister said.
The Class X exam would be held in
home centres.
5ZUZe`UZdTfddTjT]`_VUR^RXVhZeYAe`URj
?T^_[TR^[[TRcf^^SUa^PUP[[T]caTTPcPRhR[^]THPPbPUUTRcTSR^PbcP[PaTP^U
3XVWPX]4PbcXS]P_^aTSXbcaXRc^]CWdabSPh ?C8
?=B Q 90D
The Union Territory of Jammu
Kashmir on Thursday recorded a
positivity rate of 6.25 as it reported 4,352
recoveries and 2,769 fresh cases of coro-
navirus. For the second consecutive
day less than 40 deaths were reported
across JK and the active case load stood
at 42,272.
In Jammu division, eight out of 10
districts reported less than 100 cases of
coronavirus while Jammu district record-
ed 384 fresh cases and Reasi 102 cases.
A total number of 10 patients suc-
cumbed to the virus in Jammu district
taking the tally of deaths to 1013 in
Jammu district alone.
Compared to Srinagar district, the
total number of active positive cases were
still more in Jammu. According to the
media bulletin, 6,631 patients were
active positive while Srinagar district had
5,450 active positive cases..
:D0A274;;0??0=Q :278
Pinarayi Vijayan, Chief
Minister, said that Covid-19
claimed 181 lives in Kerala in
the 24 hours ended on
Thursday 6 pm, while 24,166
new persons were diagnosed
with the pandemic. Thoiugh
there has been a fall in the
number of new cases, the death
toll continues to be high, said
Vijayan.
Total number of Covid-19
patients across the State as on
Thursday stood at 2,41, 966
while 1,35, 232 samples were
tested. Across the State 89
health workers were afflicted
with the pandemic. The Chief
Minister said that the Test
Positivity Rate as on Thursday
was 17.87, which he said was a
sign that situation was improv-
ing in the State.
2^eXSR[PXb
' ^aT
[XeTbX]:TaP[P
:D0A274;;0??0=Q :278
Controversy over develop-
mental activities in
Lakshadweep islands took a
new turn with S Asker Ali, col-
lector cum district magistrate
and leaders of Opposition polit-
ical parties contradicting each
other. Collector Ali who flew
down to Kochi on Thursday to
brief the media was shown
black flags by the CPI(M)
activists demanding immediate
stoppage of all developmental
activities in the archipelago.
A disclosure by a top
marine scientist in Kerala that
sea cucumber was being smug-
gled out of the islands has
added to the chaos. Resentment
by non-BJP political parties is
increasing day by day and
chances of a flare up cannot be
ruled out, said intelligence offi-
cials. Collector Ali said that 90
per cent of the population was
with the Administrator’s initia-
tives to develop the islands. “It
is true that the administration
has ordered beef and chicken off
the menu from the meals served
theisland’sschool.Thishasbeen
done to encourage the children
to switch over to fish and eggs
which are more protein-rich
than beef and chicken,” he told
reporters.”
He said the administra-
tion’s decision to demolish the
sheds and buildings along the
coastline was in line with the
policies enacted with the sole
intention of developing and
beautifying the islands and
atolls. “The crime rate in the
islands have gone up and that
was why the Goondas Act was
enforced. The administration is
workingonsettingupthreehos-
pitals in the islands and works
are progressing fast,” said
Collector Ali.
Dr S Mohammed Raffi,
associate professor department
of aquatic biology and fisheries,
University of Kerala, said there
was large scale smuggling of sea
cucumber (a kind of marine
animal) from Lakshadweep
islands.
“These species, widely seen
in atolls and coral reefs of
Lakshadweep and Guld of
Mannar find use in preparing
aphrodisiac drugs in China and
Japan, “ said Prof Raffi. Another
marine scientist in Kochi said
that the smuggling of sea
cucumber from the islands was
on the hike because of the pre-
mium commanded by the
species in international market.
But leaders of opposition
parties ranging from Congress,
Muslim League and CPI(M)
took to the streets on Thursday
challenging the move of the
administration under the pre-
text of development. “The
demolition of buildings and
sheds owned by fishermen was
done without any notice. We do
not want any kind of develop-
ment proposed by administra-
tor Praful Patel in these islands,”
said Komala Kasim, CPI(M)
leader.
:D0A274;;0??0=Q 274==08
The knitwear units in Tamil Nadu’s
Tiruppur (known as the Knitwear
Capital of India) have the potential to
emerge as the global capital of casual dress
manufacturing if Government of India
comes forward to help the entrepreneurs
facing liquidity problems caused by the
pandemic, according to a leading indus-
trialist.
“As on today, the knitwear industry in
Tirupur directly employs six lakh work-
ers. The pandemic and its impact have
opened new vistas to the industry with
which we can additionally employ three
lakh workers in the next three years if the
Government of India listens to our pleas
and help us by offering a few crores as
loans,” Raja M Shanmugham, an indus-
trialist and president of Tirupur Exporters’
Association, told The Pioneer. He said the
TEA has written to Finance Minister
Nirmala Sitaraman highlighting the chal-
lenges and pleading for the extension of
Emergency Credit Line Guarantee
Scheme (ECLGS) 3.0 to the sector.
S Sakthivel, executive secretary, TEA,
said that there was huge demand for
Tirupur products from USA and Europe.
“But the work force is moving out fol-
lowing the lockdown and the possibilities
of it getting extended further,” said
Sakthivel. World all over the demand for
casual wears is on the rise and this is the
moment Tirupur was waiting for, he
said.
“The Centre has helped us by sanc-
tioning as financial packages to tide over
the crisis caused by the lock down of 2020.
But now the Tamil Nadu Government has
declared total lock down taking into
account the increasing number of persons
afflicted with Covid-19. On Wednesday,
Coimbatore had 4,268 new patients while
Tirupur had 1,880 new cases. The Chief
Minister has said that he was not satisfied
with the way things were moving and
chances of the extension of lockdown can-
not be ruled out,” said Shanmugham.
He said that the Union Government
should come forward to extend the
ECLGS announced along with the
Atmanirbhar Bharat Scheme to the
knitwear industry also. “The scheme was
meant to help specified sectors like
tourism and hospitality to tide over the liq-
uidity crisis. The Centre should take into
account the labour intensive Ready
Made Garment Sector and extend the
additional liquidity support of 20 per cent
so as to quickly revive the MSMEs in
RMG sector to save the industry and
simultaneously protect the labour sector,”
pleaded Shanmugham.
He pointed out that though the pan-
demic has caused havoc across the world
, it has also opened a window of oppor-
tunities for the casual wear manufac-
turing segment (mostly carried out in
Tirupur like cluster) of Ready Made
Garment Sector. “The work from home
culture has become a new trend and this
is sure to energize the garment business.
Due to this there is a lot of demand for
casual-wear products like T shirts, trousers
and track suits. Moreover we wish to
emphasis that the Ready Made Garment
Sector creates more jobs equivalent to or
better than agriculture in our country.
Considering this crucial importance, the
Ready Made Garment Sector should be
protected effectively to revive the coun-
try’s economy,” he said.
78C:0=370A8Q 90D
The Jammu Kashmir Prisons
department is gearing up to
launch an intensive vaccination
drive for the jail inmates above 45
years of age across both the central
jails in Jammu and Srinagar besides
one dozen district and sub jails in
the region.
According to official sources,
over 150 jail inmates have been test-
ed positive for coronavirus in the
recent weeks across different jails.
The highest number of 72
inmates tested positive while they
were lodged in Udhampur district
jail and 53 Rohingyas shifted to a
holding centre set up inside sub-jail
Hiranagar also tested positive
recently. Chief Medical Officer,
Kathua Dr Ashok Choudhary said,
all 53 Rohingyas have been kept
under observation inside the hold-
ing centre and have been provided
with Corona kits. No one needed
hospitalisation as they were asymp-
tomatic, he added.
According to DIG Prisons Dr
Mohd Sultan Lone, out of over 4500
jail inmates 316 prisoners were vac-
cinated across different jails till
May 26.He said a vaccination camp
was organised in Anantnag district
jail on Thursday. He said it's a con-
tinuous process and we are on the
job to vaccinate prisoners belong-
ing to different age groups. So far,
38 prisoners have been vaccinated
in Central jail Srinagar, 81 in
Udhampur, 42 in Bhaderwah, 53 in
Rajouri, 10 in Baramulla, 28 in
Pulwama, 58 in Kathua and 6 in
Reasi jail premises.
Earlier, a high powered com-
mittee headed by Justice Ali Mohd
Magrey of Jammu Kashmir High
Court had suggested the UT
administration to decongest the
prisons in the wake of prevailing
circumstances.
The Committee was constitut-
ed by the Jammu Kashmir
Government following an order by
the Supreme Court on March 23,
2020 and May 7, 2021, directing the
States and the UTs to decongest jails
to ensure social distancing among
the prisoners.
9:)9PX[X]PcTb
c^QTePRRX]PcTS
Lucknow: The Uttar Pradesh Government extended
the provisions of Essential Services Maintenance Act
(ESMA) banning all types of strikes and protests in
Government-run offices and organisations across the
State with immediate effect for the next six months.
According to a Government notification issued
on Tuesday and made public on Thursday, all strikes
in government offices and organisations have been
banned for the next six months. “As the provision of
ESMA expired on May 24, it was mandatory to extend
it,” a government official said. The ban will be enforced
in all government departments, including all public
services, authorities, corporations under the UP
Government.
The Essential Services Maintenance Act, 1996
(ESMA) can be invoked by any government in their
respective jurisdiction to prohibit striking employees
from refusing to work on certain essential services
which were necessary and important for maintaining
normal life in the region. PNS
:;_Wc')^UgSQcUc
%HQJDOH[WHQGVRYLGFXUEVWLOO-XQH
Jammu: A centenarian in Reasi district of the
Jammu division on Thursday set an example for oth-
ers to follow when he got his first dose of the
Covid-19 vaccine during an inoculation drive organ-
ised by the district administration.
118-year-old Sher Mohammad of Mahore
Tehsil in Reasi got the first jab of anti-corona vac-
cine. After taking the vaccine he feels others should
follow the same to tackle the deadly disease.
“Today after getting the Covid-19 jab, I feel
more confident and protected as the vaccine is the
biggest shield against the deadly disease,” he said.
Sher Mohammad appealed to the people of the
district to come forward and get vaccinated against
the infection. He said the vaccine has been advised
by top doctors and experts and no one should pay
heed to any rumour. “If I at this age can receive the
dose, I feel others shouldn’t shy away from getting
vaccinated and pay no attention to hearsay,” he said.
He also prayed for the good health and safety
of the whole mankind.
He said till the pandemic is over people should
continue to wear masks, maintain social distanc-
ing norms besides, follow other SOPs being issued
by the Government. PNS
3U^dU^QbYQ^WUdc
3_fYTZQRY^BUQcY
C=A067D=0C70 Q D108
In what it called an effort to
check the consumption of
illicit liquor, plug the huge
revenue loss of revenue to the
state exchequer and curb the
growing crimes, the
Maharashtra Government on
Thursday lifted the six-year-old
ban on the sale and consump-
tion of liquor in the naxalite-
infested Chandrapur district in
eastern Maharashtra.
Acting on a report sub-
mitted In March this year by a
committee headed by retired
Principal Secretary Ramnath
Jha, the State Cabinet – at its
weekly meeting presided over
by Chief Minister Uddhav
Thackeray – decided to do
away with the ban on the sale
and consumption of liquor in
Chandrapur district where the
liquor ban had come into effect
from April 1, 2015.
“Keeping in view the
increased consumption of illic-
it liquor and consequent
increase in the crimes, the
Maharashtra Government has
lifted the ban on sale and con-
sumption of liquor in
Chandrapur district,” the state
government said in a news
release after the State Cabinet
meeting.
In its report submitted to
the State Government on
March 9, 2021, the Ramnath
Jha committee stated that the
administration had miserably
failed in implementing the ban
on sale and consumption of
liquor in Chandrapur district.
“Illicit liquor was easily
available in the district in the
black market. This liquor was
dangerous to health. The sale
of illicit liquor increased in
black market. As a conse-
quence, the state began to suf-
fer huge losses in excise rev-
enue. The criminals began to
exploit the situation. In a dis-
turbing development, women
and children began to take part
in the illicit liquor business in
a big way,” the Committee stat-
ed in its report.
Another reason based on
which the Ramnath Jha-head-
ed committee recommended
the resumption of sale of liquor
in Chandrapur district was
that the various NGO and cit-
izens – who participated in a
poll on the issue —favoured the
lifting of the ban on the sale and
consumption of liquor in the
district. Quoting the crime sta-
tistics prior to and after the pro-
hibition imposed in April 2015,
the committee noted that in all
16,132 crimes were registered
between 2010 and 2014.
However the number of crimes
shot up to 40,381 between 2016
and 2019.
While there wereonly 1,729
cases against women before the
liquor ban, the number rose to
4,042 after the prohibition was
implemented. In addition, it
also came to light a large num-
ber of children were being used
for the illicit liquor trade.
³][h2T]caTRP]WT[_CXad__dac^QTR^TV[^QP[RP_XcP[^URPbdP[fTPa´
;PZbWPSfTT_2^[[TRc^abPhb(_T^_[Tbd__^ac0SX]´bX]XcXPcXeTb
PWP[XUcbQP]^]bP[TR^]bd_cX^]^U[X`d^aX]2WP]SaP_da
83*RYWH[WHQGV(60$
SURYLVLRQVIRUPRQWKV
1T]TUXRXPaXTbU[^dcb^RXP[SXbcP]RX]V]^abPbcWThfPXcc^aTRTXeTcWT2^eXS (ePRRX]TS^bTPcP
ePRRX]PcX^]RT]caTX]6dfPWPcX^]CWdabSPh ?C8
5PaTabWPaeTbcZaPX]PUXT[SX]BdaPc^]CWdabSPh ?C8
C=A067D=0C70 Q D108
The daily Covid-19 infec-
tions in Maharashtra
dropped to 21,273 on
Thursday, even as the pan-
demic deaths came down to
884 in the State.
A day after the State
recorded 1,137 fatalities –
comprising 601 fresh deaths
and 531 previous unaccounted
deaths and 24,316 infections,
the situation improved in the
state as the infections dropped
by 3043, the daily deaths rose
by 884 — comprising 425 cur-
rent deaths and 459 previous
unaccounted deaths.
With 884 deaths deaths
reported on Tuesday, the total
number of deaths in the state
climbed from 91,341 to 92,225.
Similarly, with 21,273 new
infections, the total number of
cases climbed from 56,50,907
to 56,72,180.
As 34,370 patients were
discharged from the hospitals
across the state after full recov-
ery, the total number of people
discharged from the hospitals
since the second week of March
last year increased from
52,41,833 to 52,76,203 on
Thursday. The recovery rate in
the State rose from 92.76 per
cent to 93.02 per cent.
0_PXa^U8]SXP]Qd[[Ua^VbbXcX]PaPX]UX[[TSfPcTaQ^ShX]=PSXP^]CWdabSPh ?C8
0DKDORJV
QHZFRURQDFDVHV
6. tion, diagnostic and emer-
gencypreparednesstrainingto
officials and is responsible for
appliedresearch,qualitytesting
of vaccines and other biologi-
cals and providing laboratory
supporttotheinvestigationand
control of outbreaks.
ItsthirdpillaristheIndian
Council for Medical Research
(ICMR), which is a research-
orientedinstitutionresponsible
for“theformulation,coordina-
tionandpromotionofbiomed-
ical research”. This amounts to
“undertaking,coordinatingand
implementingmedicalresearch
and translating medical inno-
vationsintoproducts/process-
es and introducing them in to
the public health system”.
In theory, the NDMA
ensures that the country is
prepared to deal with any dis-
aster that may occur, and pro-
vides the necessary coordina-
tion,expertiseandinputstothe
Governmentswhenneeded.In
the event of a pandemic, the
NCDC sends out teams, con-
ductsepidemiologicalresearch
andsuggeststhebestcourseof
action. The ICMR, on receipt
ofepidemiologicaldata,under-
takesresearchintovaccinesand
processes to counter the virus
andalsoassistsintheirmarket-
ing, after necessary approvals
havebeenobtained.Inpractice,
however,politicsandturfwars
have ensured a disparate
response, leaving citizens to
fend for themselves.
Clearly, Modi had little
time for the NDMA because,
sincethecommencementofhis
first term, he emasculated it
completely. He downgraded
the vice-chairman’s post to the
level of Cabinet Secretary and
politicised its functioning by
forcing the incumbent vice-
chairman and members to
resignonthespeciousgrounds
ofhavingbeenappointedbythe
previousGovernment,thereby
ensuring that the available
experience, continuity and
expertise were lost. He com-
pounded this by failing to
appointavice-chairman,which
remainsvacanttothisdate,and
appointing only five of the
authorisedninemembers.The
final nail in the coffin was to
replaceit,withtheNITIAayog
beingmadetheleadforprovid-
ing forecasting, coordination
and guidance of our response,
something it was ill-equipped
to do, with neither the experi-
encenortheexpertiserequired.
As for the scientific thrust
of our response to this pan-
demic, it appears that the
NCDCwasdivestedofitslead
rolebytheICMRwhich,aswe
haveseen,hasacompletelydif-
ferent role. As a result, it has
been overwhelmed and has
beenunabletodojusticeinful-
filling its own mandate. The
reasons for this lopsided
approach appear to be rooted
in bureaucratic wrangling.
Probably the fact that the
Director General (ICMR) is
alsoaSecretaryintheMinistry
of Health Family Welfare,
under which the NCDC also
functions,andwouldobvious-
ly have more influence within
the Government may have
something to do with it.
In the final analysis, this
once proud nation has been
brought to its knees, thanks to
one man’s culpability and
inabilitytoseebeyondhisown
selfish needs. His failure to
comprehend the importance
of institutions and their role in
ensuringeffectiveandefficient
governance has resulted in
avoidable fatalities. His
enablers too must share much
of the blame and be held
accountable, be they Cabinet
colleagues,bureaucratsoruni-
formed senior officers.
(The writer is a military
veteran,whoisaVisitingFellow
with the Observer Research
Foundation and Senior Visiting
Fellow with The Peninsula
Foundation, Chennai. The
views expressed are personal.)
7
KHFODLPVRIWKH8QLRQDQGWKH6WDWH*RYHUQPHQWVDERXWWKHHIILFLHQWDQGH[SHGL
HQWKDQGOLQJRIWKHYDFFLQDWLRQFDPSDLJQQRWZLWKVWDQGLQJWKHKGUDRIFRQIXVLRQ
DQGSUREOHPVREGXUDWHOUHIXVHVWREHVODLQ$IWHUDUROOHUFRDVWHURIDFFXVDWLRQV
DQGFRXQWHUDFFXVDWLRQVUHYROYLQJPDLQODURXQGYDFFLQHVRUUDWKHUWKHODFNRIWKRVH
QRZIUHVKFRORXUVRIIXQJXVLQKXPDQERGDUHEHLQJGLVFRYHUHGDOPRVWHYHURWKHU
GD(YHQLIZHZHUHWROHDYHWKHVWDWHRIYDFFLQHSUHSDUHGQHVVWRWKHH[SHUWVWKHHOH
PHQWRIKXPDQHUURURURYHUVLJKWRFFDVLRQDOOFUHHSVLQDQGDGGVWRWKHDOUHDGH[LV
WHQWDSSUHKHQVLRQVRI´YDFFLQHKHVLWDQFµ,QWKHODW
HVWVXFKFDVHQHDUOYLOODJHUVLQ8WWDU3UDGHVK·V
6LGGKDUWKQDJDUGLVWULFWZHUHUHFHQWOJLYHQDYDFFLQH
´FRFNWDLOµ³ WKH ILUVW VKRW WKH UHFHLYHG ZDV RI
RYLVKLHOG DQG WKH VHFRQG GRVH KDSSHQHG WR EH
RYD[LQ2IFRXUVHDSUREHLQWRWKHLQFLGHQWKDVEHHQ
RUGHUHGEXWLQVWDQFHVOLNHWKLVJRDORQJZDLQJHU
PLQDWLQJWKHVHHGVRIGRXEWLQWRWKHPLQGVRIWKHFRP
PRQSRSXODFHWKDWLVDOUHDGVFDUHGDQGFRQIXVHGZKDW
ZLWKWKHYDULRXVYDULDQWVRIWKHYLUXVDQGPXOWLFRORXUHG
IXQJXVEHLQJGLVFRYHUHGLQVLGHKXPDQERGLHV
7R SUHFLSLWDWH PDWWHUV WKH OHIW KDQG RI WKH
*RYHUQPHQWLVEHUHIWRIWKHNQRZOHGJHZKDWWKHULJKW
KDQGLVXSWR:HKDYHVHHQLWZLWKUHJDUGWRWKHDQQRXQFHPHQWRIRSHQLQJXSRIWKH
LQRFXODWLRQGULYHIRUDOOLQGLYLGXDOVLQWKHDJHEUDFNHW$OPRVWLPPHGLDWHOKRZ
HYHUVHYHUDO6WDWHVDQQRXQFHGWKDWWKHZHUHQRWHWUHDGIRUWKLVNLQGRIYDFFLQDWLRQ
H[SHULHQFHODUJHORQDFFRXQWRIWKHVKRUWDJHRIYDFFLQHV)RULWVSDUWWKHHQWUHVWHDG
IDVWOPDLQWDLQHGWKDWWKHUHZDVQRGHDUWKRIMDEVZKLOHDWWKHVDPHWLPHVHYHUDO6WDWHV
ZHUHFULQJKRDUVHWKDWWKHKDGEHHQOHIWLQWKHOXUFKVLQFHWKHIRUHLJQPDQXIDFWXUHUV
ZHUHWDNLQJWKHSOHDWKDWWKHZHUHDXWKRULVHGWRGREXVLQHVVRQOZLWKWKHHQWUHDQG
QRWZLWKLQGLYLGXDO6WDWHV7KHQDVPHQWLRQHGLQWKHVHFROXPQVUHFHQWOWKHUH·VWKH
GHEDWHZKHWKHULW·VILQDOOWLPHWRKROGFODVV;,,%RDUGH[DPLQDWLRQVRPSRXQGLQJWKH
PDWWHULVWKHIDFWWKDWDOOVWDNHKROGHUVPDLQOWKHVWXGHQWVWHDFKHUVWKHVXSSRUWVWDII
DWH[DPLQDWLRQFHQWUHVDQGHYHQWKHSDUHQWVQHHGWREHYDFFLQDWHG(YHQLIDUUDQJH
PHQWVDUHPDGHWRSURYLGHDOOVXFKFDQGLGDWHVWKHLUILUVWVKRWRYHUWKHQH[WIRUWQLJKW
WKHZRXOGVWLOOKDYHWRZDLWWKUHHPRQWKVIRUWKHVHFRQGGRVH7KH*RYHUQPHQWVPXVW
EHRQJXDUGDJDLQVWDQLQIRUPDWLRQPLVILULQJRUQHJOLJHQFH
7
KH,QIRUPDWLRQ7HFKQRORJ,QWHUPHGLDU*XLGHOLQHVDQG'LJLWDO0HGLD(WKLFVRGH