Alexandre Masselot, profile picture
Uploaded byAlexandre Masselot
KEY, PDF631 views

groovy & grails - lecture 10

The document outlines a programming lecture on source code management (SCM) systems, specifically focusing on using Subversion (SVN) for version control in projects hosted on Google Code. It covers the setting up of project repositories, managing contributors, accessing code through command line and IDEs, and integrating with different functionalities such as bug reporting and asynchronous loading using AJAX. Additionally, it includes practical examples of developing web applications using the Grails framework, managing protein isoforms, and implementing a Twitter-like messaging system.

Embed presentation

Downloaded 16 times
1 / 114
2 / 114
3 / 114
4 / 114
5 / 114
6 / 114
7 / 114
8 / 114
9 / 114
10 / 114
11 / 114
12 / 114
13 / 114
14 / 114
15 / 114
16 / 114
17 / 114
18 / 114
19 / 114
20 / 114
21 / 114
22 / 114
23 / 114
24 / 114
25 / 114
26 / 114
27 / 114
28 / 114
29 / 114
30 / 114
31 / 114
32 / 114
33 / 114
34 / 114
35 / 114
36 / 114
37 / 114
38 / 114
39 / 114
40 / 114
41 / 114
42 / 114
43 / 114
44 / 114
45 / 114
46 / 114
47 / 114
48 / 114
49 / 114
50 / 114
51 / 114
52 / 114
53 / 114
54 / 114
55 / 114
56 / 114
57 / 114
58 / 114
59 / 114
60 / 114
61 / 114
62 / 114
63 / 114
64 / 114
65 / 114
66 / 114
67 / 114
68 / 114
69 / 114
70 / 114
71 / 114
72 / 114
73 / 114
74 / 114
75 / 114
76 / 114
77 / 114
78 / 114
79 / 114
80 / 114
81 / 114
82 / 114
83 / 114
84 / 114
85 / 114
86 / 114
87 / 114
88 / 114
89 / 114
90 / 114
91 / 114
92 / 114
93 / 114
94 / 114
95 / 114
96 / 114
97 / 114
98 / 114
99 / 114
100 / 114
101 / 114
102 / 114
103 / 114
104 / 114
105 / 114
106 / 114
107 / 114
108 / 114
109 / 114
110 / 114
111 / 114
112 / 114
113 / 114
114 / 114
Groovy: Efficiency Oriented Programming Lecture 10 Master Proteomics & Bioinformatics - University of Geneva Alexandre Masselot - summer 2011
Agenda ‣ SVN & google code hosting ‣ More on GSP ‣ Including third parties libraries ‣ Ajax ‣ Runtime environment ‣ Domains
SCM ‣ Code evolve in time
SCM ‣ Code evolve in time ‣ Source code is shared
SCM ‣ Code evolve in time ‣ Source code is shared ‣ Source Code Management system host code + versioning
SCM ‣ Code evolve in time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe...
SCM ‣ Code evolve in time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe... ‣ SVN is a client/server solution
SCM ‣ Code evolve in time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe... ‣ SVN is a client/server solution ‣ Server can be in-house
SCM ‣ Code evolve in time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe... ‣ SVN is a client/server solution ‣ Server can be in-house ‣ Free solution for open source http://code.google.com/hosting/
make an google account
Create Project Project name: geop-demo Project summary: A demo project for GEOP course Project description: geop demo code Version control system: Subversion Source code license:  New BSD License Use a separate content license: license... Project labels: Create project... Project name must start with a lowercase letter, followed by lowercase letters, digits, and dashes, with no spaces. This will be part of your project's URL and cannot be changed later. Project summary will be shown whenever the project's name is displayed. Project description is the main content of your project's home page. You may use wiki markup. Version control system selects the type of your project's repository. Learn more. Licenses determine how others may build upon your work. Code and documentation may be distributed under separate licenses. Project labels help classify your project so others can easily find it or browse projects by label.
Google proposes command line commands We’ll see how to integrate svn into eclipse
Command-line access If you plan to make changes, use this command to check out the code as yourself using HTTPS: # Project members authenticate over HTTPS to allow committing changes. svn checkout https://geop-demo.googlecode.com/svn/trunk/ geop-demo --username alexandre.masselot When prompted, enter your generated googlecode.com password. Use this command to anonymously check out the latest project source code: # Non-members may check out a read-only working copy anonymously over HTTP. svn checkout http://geop-demo.googlecode.com/svn/trunk/ geop-demo-read-only GUI and IDE access This project's Subversion repository may be accessed using many different client programs and plug-ins. See your client's documentation for more information.
Google code offers for “free” ‣ SVN repository
Google code offers for “free” ‣ SVN repository ‣ Managing contributors to a project
Google code offers for “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki
Google code offers for “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki ‣ Ticketing system
Google code offers for “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki ‣ Ticketing system ‣ Bug reporting
Google code offers for “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki ‣ Ticketing system ‣ Bug reporting ‣ Visibility
Google code hosting ⇒ your code is open source
SVN: eclipse or command line
Installing svn in Eclipse ‣ Help > dashboard > extension - Subversion (subclipse)
Installing svn in Eclipse ‣ Help > dashboard > extension - Subversion (subclipse) ‣ Or command line: installed by default or - sudo apt-get install subversion
Eclipse: connecting to the SVN repository ‣ menu Window - > open perspective - > SVN repository exploring
Eclipse: connecting to the SVN repository ‣ menu Window - > open perspective - > SVN repository exploring ‣ view SVN repositories - > right click - > new repository location - https://geop-demo.googlecode.com/svn
Sharing an existing project to your google code account
Sharing an existing project to your google code account ‣ Perspective java
Sharing an existing project to your google code account ‣ Perspective java ‣ project right-click - > team - > share project - use specifier folder name trunk/your.project.name
‣ username & password from google page ‣ save password check box
Commit the project ‣ At this stage, the project is only created on the remote server - check with SVN repository exploring perspective - or browse source code from google page
Commit the project ‣ At this stage, the project is only created on the remote server - check with SVN repository exploring perspective - or browse source code from google page ‣ Mark generated file & folder to be ignored from svn - e.g. target/
Commit the project ‣ At this stage, the project is only created on the remote server - check with SVN repository exploring perspective - or browse source code from google page ‣ Mark generated file & folder to be ignored from svn - e.g. target/ ‣ Right-click > team > add to svn:ignore
All eclipse functionalities can be replaced by shell commands
SVN command line: share project ‣ Import original project demo.svn to the repository ‣ cd workspace directory svn import -m “initial import” --non-recursive demo.svn https://geop-demo.googlecode.com/svn/trunk/demo.svn ‣ Directory itself is not imported, so checkout (with force) svn checkout --force https://geop-demo.googlecode.com/svn/ trunk/demo.svn
SVN command line: share project (cont’d) cd demo.svn ‣ Add target/ directory to svn:ignore svn propset svn:ignore target . ‣ Add other directories to svn svn add $(ls | grep -v target) ‣ Commit files svn commit -m "adding all initial files" ‣ Back to eclipse, F5 (refresh in package explorer view)
Browse your project
From google code source page 25
SVN for a daily use
SVN for a daily use minutely
SVN: flow use ‣ Checkout out or share an existing project to contribute
SVN: flow use ‣ Checkout out or share an existing project to contribute ‣ Commit changes to the repository
SVN: flow use ‣ Checkout out or share an existing project to contribute ‣ Commit changes to the repository ‣ Update changes from repository
SVN: flow use ‣ Checkout out or share an existing project to contribute ‣ Commit changes to the repository ‣ Update changes from repository ‣ Eclipse: - select project - > right-click - > team - > Synchronize with repository - commit/update/manage conflict
SVN: flow use (cont’d) ‣ Command line svn status svn update svn commit -m “my message to describe changes”
Commit/update often
SVN is more ‣ History
SVN is more ‣ History ‣ See contribution from others
SVN is more ‣ History ‣ See contribution from others ‣ Tag / branch versions
SVN is more ‣ History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution
SVN is more ‣ History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server
SVN is more ‣ History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server ‣ File locking :(
SVN is more ‣ History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server ‣ File locking :( ‣ Integration with tickets
SVN is more ‣ History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server ‣ File locking :( ‣ Integration with tickets ‣ Windows integration: http://tortoisesvn.tigris.org/
Back to grails... and proteins isoforms
Problem: uniprot AC ➙ isoform list in a web application
Grails: including a third parties libraries ‣ Library is available as a jar (export ➙ .jar)
Grails: including a third parties libraries ‣ Library is available as a jar (export ➙ .jar) ‣ Copy jar in lib/
Grails: including a third parties libraries ‣ Library is available as a jar (export ➙ .jar) ‣ Copy jar in lib/ ‣ For eclipse completion - right-click - build path - add to build path
Get is forms for ac (00:44:01.975) Q70Z44 List >Q70Z44-1 MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT >Q70Z44-2 MASMSIVKATSNTISQCGWSASANWTPSISPSMDRAERSPSALSPTQVAIRRRCRPSPYV VNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASL VRPHPSRDQKRGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQ GRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQK QHSVELWVQFSHAMDALLFRLYLLFMASSIITVICLWNT
Isoforms_v1 -> v5 same controller different views (gsp) for different rendering interaction
Isoforms_v1 -> v5 same controller different views (gsp) for different rendering interaction
Isoforms_vXController ⇒ views/isoforms_vX/ direcgtory with gsp’s
IsoformController_v?.groovy def list = { def ac=params.ac def xml=new XmlSlurper() .parseText("http://pir.uniprot.org/uniprot/$ {ac}.xml".toURL().text).entry UniprotEntrySplicer splicer=[entryXml:xml] def proteins=splicer.buildAllIsoforms().values() as List [proteins: proteins] }
v1
isoforms_v1/list.gsp <html> <body> <h2>Get is forms for ac (${String.format('%tH:%<tM: %<tS.%<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> <h3>List</h3> <g:each in="${proteins}" var="prot"> <pre> ${prot} </pre> </g:each> </body> </html>
Problem: direct access to /list only
v2
v2
isoforms_v2: add index.gsp <html> <body> <h1>Isoform list application</h1> <h2>Get is forms for ac (${String.format('%tH:%<tM: %<tS.%<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> </body> </html>
Problem: <g:form> is duplicated (DRY!)
isoform_v3: use template ‣ _form.gsp <h2>Get is forms for ac (${String.format('%tH:%<tM:%<tS. %<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form>
isoform_v3: use template ‣ _form.gsp <h2>Get is forms for ac (${String.format('%tH:%<tM:%<tS. %<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> ‣ In index.gsp and list.gsp <g:render template="form" />
isoform_v3: use template ‣ _form.gsp <h2>Get is forms for ac (${String.format('%tH:%<tM:%<tS. %<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> ‣ In index.gsp and list.gsp <g:render template="form" />
Problem: all the page is reloaded totally
v4
Ajax: asynchronous load web browser Q70Z44 submit server isoform/list 47
Ajax: asynchronous load web browser Q70Z44 submit server isoform/list 47
Ajax: asynchronous load web browser Q70Z44 submit server List isoform/list >Q70Z44-1 MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT >Q70Z44-2 MASMSIVKATSNTISQCGWSASANWTPSISPSMDRAERSPSALSPTQVAIRRRCRPSPYV VNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASL VRPHPSRDQKRGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQ GRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQK QHSVELWVQFSHAMDALLFRLYLLFMASSIITVICLWNT 47
isoform_v4/index.gsp <html> <head> <g:javascript library="prototype" /> </head> <body> <h2>Get is forms for ac (${String.format('%tH:%<tM: %<tS.%<tL', new Date())})</h2> <!-- g:formRemote stands for an ajax form --> <g:formRemote name="listForm" url="[action:'list']" update="isoforms-list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:formRemote> <!-- the target element of the form --> <div id="isoforms-list"/> </body> </html>
isoform_v4/list.gsp <h3>List</h3> <g:each in="${proteins}" var="prot"> <pre> ${prot} </pre> </g:each>
Twitter 1
People post messages and follow others
database (domain) + controller (actions) + views (web)
Domain: Person & Message
Domain: bean definition + database storage
Person domain ‣ Create the database entry + bean class grails create-domain-class Person project > right-click > grails > create-domain-class Person
Person domain ‣ Create the database entry + bean class grails create-domain-class Person project > right-click > grails > create-domain-class Person ‣ Files created: ./grails-app/domain/eop/lec10/twitter/Person.groovy ./test/unit/eop/lec10/twitter/PersonTests.groovy
Person.groovy ‣ Created class package eop.lec10.twitter class Person { static constraints = { } }
Person.groovy
Person.groovy ‣ Enriched with fields package eop.lec10.twitter class Person { String username String firstName String lastName String email Date dateCreated static constraints = { } }
run-app ⇒ database + table created
Web access: need controller + views
Scaffolding is pure magic
PersonController.groovy create-controller Person
PersonController.groovy create-controller Person ‣ grails-app/controller/PersonController.groovy: package eop.lec10.twitter class PersonController { def scaffold = true }
PersonController.groovy create-controller Person ‣ grails-app/controller/PersonController.groovy: package eop.lec10.twitter class PersonController { def scaffold = true } ‣ scaffold generate all default action & view implicitely
PersonController.groovy create-controller Person ‣ grails-app/controller/PersonController.groovy: package eop.lec10.twitter class PersonController { def scaffold = true } ‣ scaffold generate all default action & view implicitely
http://localhost:8080/eop.lec10.twitter/person ‣ Default url is redirected on the list page
http://localhost:8080/eop.lec10.twitter/person ‣ Default url is redirected on the list page
http://localhost:8080/eop.lec10.twitter/person ‣ Entering a new Person lucky luke
http://localhost:8080/eop.lec10.twitter/person ‣ Entering a new Person lucky luke
http://localhost:8080/eop.lec10.twitter/person ‣ Entering a new Person lucky luke
http://localhost:8080/eop.lec10.twitter/person
http://localhost:8080/eop.lec10.twitter/person ‣ Back to list - view all - edit - delete - sort
Domain constraints
Person.groovy class Person { String username String firstName String lastName String email Date dateCreated //firstName is compulsory //email field has an email format //username cannot be null, is unique and is between 6 and 20 characters static constraints = { firstName(blank:false) email(email:true, blank:false) username(blank:false, unique:true, matches:/w{6,20}/) } }
groovy & grails - lecture 10

More Related Content

KEY
groovy & grails - lecture 9
byAlexandre Masselot
 
KEY
groovy & grails - lecture 13
byAlexandre Masselot
 
KEY
groovy & grails - lecture 5
byAlexandre Masselot
 
KEY
groovy & grails - lecture 6
byAlexandre Masselot
 
PDF
Using the Groovy Ecosystem for Rapid JVM Development
bySchalk Cronjé
 
PDF
Gradle in 45min - JBCN2-16 version
bySchalk Cronjé
 
PDF
Basic Gradle Plugin Writing
bySchalk Cronjé
 
PDF
Gradle in 45min
bySchalk Cronjé
 
groovy & grails - lecture 9
byAlexandre Masselot
 
groovy & grails - lecture 13
byAlexandre Masselot
 
groovy & grails - lecture 5
byAlexandre Masselot
 
groovy & grails - lecture 6
byAlexandre Masselot
 
Using the Groovy Ecosystem for Rapid JVM Development
bySchalk Cronjé
 
Gradle in 45min - JBCN2-16 version
bySchalk Cronjé
 
Basic Gradle Plugin Writing
bySchalk Cronjé
 
Gradle in 45min
bySchalk Cronjé
 

What's hot

KEY
groovy & grails - lecture 4
byAlexandre Masselot
 
PDF
Cool JVM Tools to Help You Test
bySchalk Cronjé
 
PDF
Cool Jvm Tools to Help you Test - Aylesbury Testers Version
bySchalk Cronjé
 
PDF
Golang Project Layout and Practice
byBo-Yi Wu
 
PDF
Build microservice with gRPC in golang
byTing-Li Chou
 
PDF
Idiomatic Gradle Plugin Writing - GradleSummit 2016
bySchalk Cronjé
 
PDF
Gradle build tool that rocks with DSL JavaOne India 4th May 2012
byRajmahendra Hegde
 
PDF
Rest, sockets em golang
byjefferson Otoni Lima
 
PDF
Managing dependencies with gradle
byLiviu Tudor
 
PDF
Making the Most of Your Gradle Build
byAndres Almiray
 
PDF
GraphQL IN Golang
byBo-Yi Wu
 
PDF
Gradle plugins, take it to the next level
byEyal Lezmy
 
PDF
Making the Most of Your Gradle Build
byAndres Almiray
 
PDF
Node.js cluster
byDerek Willian Stavis
 
PDF
Everything as a code
byAleksandr Tarasov
 
PDF
Release with confidence
byJohn Congdon
 
KEY
groovy & grails - lecture 2
byAlexandre Masselot
 
PDF
Gradle Introduction
byDmitry Buzdin
 
PPTX
Going native with less coupling: Dependency Injection in C++
byDaniele Pallastrelli
 
PDF
Let's go HTTPS-only! - More Than Buying a Certificate
bySteffen Gebert
 
groovy & grails - lecture 4
byAlexandre Masselot
 
Cool JVM Tools to Help You Test
bySchalk Cronjé
 
Cool Jvm Tools to Help you Test - Aylesbury Testers Version
bySchalk Cronjé
 
Golang Project Layout and Practice
byBo-Yi Wu
 
Build microservice with gRPC in golang
byTing-Li Chou
 
Idiomatic Gradle Plugin Writing - GradleSummit 2016
bySchalk Cronjé
 
Gradle build tool that rocks with DSL JavaOne India 4th May 2012
byRajmahendra Hegde
 
Rest, sockets em golang
byjefferson Otoni Lima
 
Managing dependencies with gradle
byLiviu Tudor
 
Making the Most of Your Gradle Build
byAndres Almiray
 
GraphQL IN Golang
byBo-Yi Wu
 
Gradle plugins, take it to the next level
byEyal Lezmy
 
Making the Most of Your Gradle Build
byAndres Almiray
 
Node.js cluster
byDerek Willian Stavis
 
Everything as a code
byAleksandr Tarasov
 
Release with confidence
byJohn Congdon
 
groovy & grails - lecture 2
byAlexandre Masselot
 
Gradle Introduction
byDmitry Buzdin
 
Going native with less coupling: Dependency Injection in C++
byDaniele Pallastrelli
 
Let's go HTTPS-only! - More Than Buying a Certificate
bySteffen Gebert
 

Similar to groovy & grails - lecture 10

ODP
An introduction to SVN
byOlivier Teytaud
 
PPT
SVN Usage & Best Practices
byAshraf Fouad
 
PDF
Git your life for fun & profit
byGeeks Anonymes
 
KEY
Version control with subversion
byxprayc
 
PPTX
[Mas 500] Software Development Strategies
byrahulbot
 
PPT
Introduction to Subversion and Google Project Hosting
byPhilip Johnson
 
PDF
Git your life for fun & profit
byInterface ULg, LIEGE science park
 
ODP
Subversion in a distributed world
byLorna Mitchell
 
PPT
Source control
byanushka perera
 
PDF
Distributed Version Control (DVCS) With Mercurial
byTed Naleid
 
PDF
The Source Control Landscape
byLorna Mitchell
 
ODP
Svn Basic Tutorial
byMarco Pivetta
 
PPTX
Subversion
bythebdot1
 
PDF
SVN essentials
byBedis ElAchèche
 
PPTX
Version Control and Continuous Integration
byGeff Henderson Chang
 
KEY
Version Control Lassosoft 2009 Lasso Developers Conference
byBrian Loomis
 
PPT
Subversion client
byrchakra
 
PPTX
Subversion
byVaibhav Sakhalkar
 
ODP
Develop FOSS project using Google Code Hosting
byNarendra Sisodiya
 
PPT
Totalsvn Usage And Administration By Gopi
bygopinathkarangula
 
An introduction to SVN
byOlivier Teytaud
 
SVN Usage & Best Practices
byAshraf Fouad
 
Git your life for fun & profit
byGeeks Anonymes
 
Version control with subversion
byxprayc
 
[Mas 500] Software Development Strategies
byrahulbot
 
Introduction to Subversion and Google Project Hosting
byPhilip Johnson
 
Git your life for fun & profit
byInterface ULg, LIEGE science park
 
Subversion in a distributed world
byLorna Mitchell
 
Source control
byanushka perera
 
Distributed Version Control (DVCS) With Mercurial
byTed Naleid
 
The Source Control Landscape
byLorna Mitchell
 
Svn Basic Tutorial
byMarco Pivetta
 
Subversion
bythebdot1
 
SVN essentials
byBedis ElAchèche
 
Version Control and Continuous Integration
byGeff Henderson Chang
 
Version Control Lassosoft 2009 Lasso Developers Conference
byBrian Loomis
 
Subversion client
byrchakra
 
Subversion
byVaibhav Sakhalkar
 
Develop FOSS project using Google Code Hosting
byNarendra Sisodiya
 
Totalsvn Usage And Administration By Gopi
bygopinathkarangula
 

More from Alexandre Masselot

PDF
Offshoring software development in Switzerland: You can do it
byAlexandre Masselot
 
PDF
Dev Wednesday - Swiss Transport in Real Time: Tribulations in the Big Data Stack
byAlexandre Masselot
 
PDF
Swiss Transport in Real Time: Tribulations in the Big Data Stack
byAlexandre Masselot
 
KEY
groovy & grails - lecture 8
byAlexandre Masselot
 
KEY
groovy & grails - lecture 1
byAlexandre Masselot
 
KEY
groovy & grails - lecture 11
byAlexandre Masselot
 
KEY
groovy & grails - lecture 12
byAlexandre Masselot
 
KEY
groovy & grails - lecture 7
byAlexandre Masselot
 
KEY
groovy & grails - lecture 3
byAlexandre Masselot
 
Offshoring software development in Switzerland: You can do it
byAlexandre Masselot
 
Dev Wednesday - Swiss Transport in Real Time: Tribulations in the Big Data Stack
byAlexandre Masselot
 
Swiss Transport in Real Time: Tribulations in the Big Data Stack
byAlexandre Masselot
 
groovy & grails - lecture 8
byAlexandre Masselot
 
groovy & grails - lecture 1
byAlexandre Masselot
 
groovy & grails - lecture 11
byAlexandre Masselot
 
groovy & grails - lecture 12
byAlexandre Masselot
 
groovy & grails - lecture 7
byAlexandre Masselot
 
groovy & grails - lecture 3
byAlexandre Masselot
 

Recently uploaded

PDF
Best-Travel-Portal-Development-Solutions-for-Online-Growth
bykashishnagarrajput
 
PDF
Josh Chu Boston - An Innovative Technology Executive
byJosh Chu Boston
 
PPTX
TechSprint Kickoff - Everything You Need to Know
bygdgcodecellcmpn
 
PPTX
DATALIVA-Presentation-EN_2026 Budgeting SAP Odoo ERP
byMustafa Kuğu
 
PPTX
Software Tools for penetration Testing (1).pptx
byAmosCheruiyot13
 
PDF
oracle_apex_tamil_export_an_application.pdf
byUthamaselvan M
 
PPTX
Design Flaws and Known Attacks in Agentic AI - ITI Business Session
byInformation Technology Institute
 
PDF
Generating Structured Outputs from Unstructured Content Using LLMs
byEnterprise Knowledge
 
PPTX
Flutter & Firebase Session Slides - GDG VESIT
bygdgcodecellcmpn
 
PPTX
Unit 1 Introduction of Computer Networks
bySuvarnaSharma5
 
PDF
Requestly or Postman: What’s the Right API Tool for Your Team?
byhenrycavill30521
 
PPTX
Building Real-Time Voice AI — Udaiappa Ramachandran
byUdaiappa Ramachandran
 
PPTX
Full course that Prymehat uploads for you version 2
byOhenebaManu1
 
PPTX
Lecture 04. about Black heads and Hackerss.pptx
byvinocol222
 
PPTX
02_Extended Warehouse Management Functions and Features.pptx
byUdayakumar218983
 
PDF
DataLiva-LivaGRC- Business Software for Governance, Risk, and Compliance
byMustafa Kuğu
 
PDF
Purple Team - Active Directory and AzureAD v1
byVICTOR MAESTRE RAMIREZ
 
PPTX
On-Device AI with Gemma 3n and PaliGemma 2 Session Slides - GDG VESIT
bygdgcodecellcmpn
 
PDF
Higgsfield AI: The New Way to Create Cinematic Video
bytechnologyupside
 
PDF
The Rise of AI Fashion Tools and Innovations in 2026
bymockitseo
 
Best-Travel-Portal-Development-Solutions-for-Online-Growth
bykashishnagarrajput
 
Josh Chu Boston - An Innovative Technology Executive
byJosh Chu Boston
 
TechSprint Kickoff - Everything You Need to Know
bygdgcodecellcmpn
 
DATALIVA-Presentation-EN_2026 Budgeting SAP Odoo ERP
byMustafa Kuğu
 
Software Tools for penetration Testing (1).pptx
byAmosCheruiyot13
 
oracle_apex_tamil_export_an_application.pdf
byUthamaselvan M
 
Design Flaws and Known Attacks in Agentic AI - ITI Business Session
byInformation Technology Institute
 
Generating Structured Outputs from Unstructured Content Using LLMs
byEnterprise Knowledge
 
Flutter & Firebase Session Slides - GDG VESIT
bygdgcodecellcmpn
 
Unit 1 Introduction of Computer Networks
bySuvarnaSharma5
 
Requestly or Postman: What’s the Right API Tool for Your Team?
byhenrycavill30521
 
Building Real-Time Voice AI — Udaiappa Ramachandran
byUdaiappa Ramachandran
 
Full course that Prymehat uploads for you version 2
byOhenebaManu1
 
Lecture 04. about Black heads and Hackerss.pptx
byvinocol222
 
02_Extended Warehouse Management Functions and Features.pptx
byUdayakumar218983
 
DataLiva-LivaGRC- Business Software for Governance, Risk, and Compliance
byMustafa Kuğu
 
Purple Team - Active Directory and AzureAD v1
byVICTOR MAESTRE RAMIREZ
 
On-Device AI with Gemma 3n and PaliGemma 2 Session Slides - GDG VESIT
bygdgcodecellcmpn
 
Higgsfield AI: The New Way to Create Cinematic Video
bytechnologyupside
 
The Rise of AI Fashion Tools and Innovations in 2026
bymockitseo
 

groovy & grails - lecture 10

  • 1.
    Groovy: Efficiency OrientedProgramming Lecture 10 Master Proteomics & Bioinformatics - University of Geneva Alexandre Masselot - summer 2011
  • 2.
    Agenda ‣ SVN &google code hosting ‣ More on GSP ‣ Including third parties libraries ‣ Ajax ‣ Runtime environment ‣ Domains
  • 3.
  • 4.
    SCM ‣ Code evolvein time ‣ Source code is shared
  • 5.
    SCM ‣ Code evolvein time ‣ Source code is shared ‣ Source Code Management system host code + versioning
  • 6.
    SCM ‣ Code evolvein time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe...
  • 7.
    SCM ‣ Code evolvein time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe... ‣ SVN is a client/server solution
  • 8.
    SCM ‣ Code evolvein time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe... ‣ SVN is a client/server solution ‣ Server can be in-house
  • 9.
    SCM ‣ Code evolvein time ‣ Source code is shared ‣ Source Code Management system host code + versioning ‣ Many solutions exist: CVS, SVN, GIT, SourceSafe... ‣ SVN is a client/server solution ‣ Server can be in-house ‣ Free solution for open source http://code.google.com/hosting/
  • 10.
  • 12.
    Create Project Project name:geop-demo Project summary: A demo project for GEOP course Project description: geop demo code Version control system: Subversion Source code license:  New BSD License Use a separate content license: license... Project labels: Create project... Project name must start with a lowercase letter, followed by lowercase letters, digits, and dashes, with no spaces. This will be part of your project's URL and cannot be changed later. Project summary will be shown whenever the project's name is displayed. Project description is the main content of your project's home page. You may use wiki markup. Version control system selects the type of your project's repository. Learn more. Licenses determine how others may build upon your work. Code and documentation may be distributed under separate licenses. Project labels help classify your project so others can easily find it or browse projects by label.
  • 13.
    Google proposes commandline commands We’ll see how to integrate svn into eclipse
  • 15.
    Command-line access If youplan to make changes, use this command to check out the code as yourself using HTTPS: # Project members authenticate over HTTPS to allow committing changes. svn checkout https://geop-demo.googlecode.com/svn/trunk/ geop-demo --username alexandre.masselot When prompted, enter your generated googlecode.com password. Use this command to anonymously check out the latest project source code: # Non-members may check out a read-only working copy anonymously over HTTP. svn checkout http://geop-demo.googlecode.com/svn/trunk/ geop-demo-read-only GUI and IDE access This project's Subversion repository may be accessed using many different client programs and plug-ins. See your client's documentation for more information.
  • 16.
    Google code offersfor “free” ‣ SVN repository
  • 17.
    Google code offersfor “free” ‣ SVN repository ‣ Managing contributors to a project
  • 18.
    Google code offersfor “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki
  • 19.
    Google code offersfor “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki ‣ Ticketing system
  • 20.
    Google code offersfor “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki ‣ Ticketing system ‣ Bug reporting
  • 21.
    Google code offersfor “free” ‣ SVN repository ‣ Managing contributors to a project ‣ Wiki ‣ Ticketing system ‣ Bug reporting ‣ Visibility
  • 22.
    Google code hosting ⇒ your code is open source
  • 23.
    SVN: eclipse orcommand line
  • 24.
    Installing svn inEclipse ‣ Help > dashboard > extension - Subversion (subclipse)
  • 25.
    Installing svn inEclipse ‣ Help > dashboard > extension - Subversion (subclipse) ‣ Or command line: installed by default or - sudo apt-get install subversion
  • 26.
    Eclipse: connecting tothe SVN repository ‣ menu Window - > open perspective - > SVN repository exploring
  • 27.
    Eclipse: connecting tothe SVN repository ‣ menu Window - > open perspective - > SVN repository exploring ‣ view SVN repositories - > right click - > new repository location - https://geop-demo.googlecode.com/svn
  • 31.
    Sharing an existingproject to your google code account
  • 32.
    Sharing an existingproject to your google code account ‣ Perspective java
  • 33.
    Sharing an existingproject to your google code account ‣ Perspective java ‣ project right-click - > team - > share project - use specifier folder name trunk/your.project.name
  • 34.
    ‣ username &password from google page ‣ save password check box
  • 35.
    Commit the project ‣At this stage, the project is only created on the remote server - check with SVN repository exploring perspective - or browse source code from google page
  • 36.
    Commit the project ‣At this stage, the project is only created on the remote server - check with SVN repository exploring perspective - or browse source code from google page ‣ Mark generated file & folder to be ignored from svn - e.g. target/
  • 37.
    Commit the project ‣At this stage, the project is only created on the remote server - check with SVN repository exploring perspective - or browse source code from google page ‣ Mark generated file & folder to be ignored from svn - e.g. target/ ‣ Right-click > team > add to svn:ignore
  • 40.
    All eclipse functionalities canbe replaced by shell commands
  • 41.
    SVN command line:share project ‣ Import original project demo.svn to the repository ‣ cd workspace directory svn import -m “initial import” --non-recursive demo.svn https://geop-demo.googlecode.com/svn/trunk/demo.svn ‣ Directory itself is not imported, so checkout (with force) svn checkout --force https://geop-demo.googlecode.com/svn/ trunk/demo.svn
  • 42.
    SVN command line:share project (cont’d) cd demo.svn ‣ Add target/ directory to svn:ignore svn propset svn:ignore target . ‣ Add other directories to svn svn add $(ls | grep -v target) ‣ Commit files svn commit -m "adding all initial files" ‣ Back to eclipse, F5 (refresh in package explorer view)
  • 43.
  • 44.
    From google codesource page 25
  • 45.
    SVN for adaily use
  • 46.
    SVN for adaily use minutely
  • 47.
    SVN: flow use ‣Checkout out or share an existing project to contribute
  • 48.
    SVN: flow use ‣Checkout out or share an existing project to contribute ‣ Commit changes to the repository
  • 49.
    SVN: flow use ‣Checkout out or share an existing project to contribute ‣ Commit changes to the repository ‣ Update changes from repository
  • 50.
    SVN: flow use ‣Checkout out or share an existing project to contribute ‣ Commit changes to the repository ‣ Update changes from repository ‣ Eclipse: - select project - > right-click - > team - > Synchronize with repository - commit/update/manage conflict
  • 51.
    SVN: flow use (cont’d) ‣ Command line svn status svn update svn commit -m “my message to describe changes”
  • 52.
  • 53.
  • 54.
    SVN is more ‣History ‣ See contribution from others
  • 55.
    SVN is more ‣History ‣ See contribution from others ‣ Tag / branch versions
  • 56.
    SVN is more ‣History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution
  • 57.
    SVN is more ‣History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server
  • 58.
    SVN is more ‣History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server ‣ File locking :(
  • 59.
    SVN is more ‣History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server ‣ File locking :( ‣ Integration with tickets
  • 60.
    SVN is more ‣History ‣ See contribution from others ‣ Tag / branch versions ‣ Conflict resolution ‣ Continuous integration / testing on dedicated server ‣ File locking :( ‣ Integration with tickets ‣ Windows integration: http://tortoisesvn.tigris.org/
  • 61.
    Back to grails...and proteins isoforms
  • 62.
    Problem: uniprot AC➙ isoform list in a web application
  • 63.
    Grails: including athird parties libraries ‣ Library is available as a jar (export ➙ .jar)
  • 64.
    Grails: including athird parties libraries ‣ Library is available as a jar (export ➙ .jar) ‣ Copy jar in lib/
  • 65.
    Grails: including athird parties libraries ‣ Library is available as a jar (export ➙ .jar) ‣ Copy jar in lib/ ‣ For eclipse completion - right-click - build path - add to build path
  • 66.
    Get is formsfor ac (00:44:01.975) Q70Z44 List >Q70Z44-1 MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT >Q70Z44-2 MASMSIVKATSNTISQCGWSASANWTPSISPSMDRAERSPSALSPTQVAIRRRCRPSPYV VNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASL VRPHPSRDQKRGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQ GRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQK QHSVELWVQFSHAMDALLFRLYLLFMASSIITVICLWNT
  • 67.
    Isoforms_v1 -> v5same controller different views (gsp) for different rendering interaction
  • 68.
    Isoforms_v1 -> v5same controller different views (gsp) for different rendering interaction
  • 69.
    Isoforms_vXController ⇒ views/isoforms_vX/ direcgtory with gsp’s
  • 70.
    IsoformController_v?.groovy def list= { def ac=params.ac def xml=new XmlSlurper() .parseText("http://pir.uniprot.org/uniprot/$ {ac}.xml".toURL().text).entry UniprotEntrySplicer splicer=[entryXml:xml] def proteins=splicer.buildAllIsoforms().values() as List [proteins: proteins] }
  • 71.
  • 72.
    isoforms_v1/list.gsp <html> <body> <h2>Get is forms for ac (${String.format('%tH:%<tM: %<tS.%<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> <h3>List</h3> <g:each in="${proteins}" var="prot"> <pre> ${prot} </pre> </g:each> </body> </html>
  • 73.
  • 74.
  • 75.
  • 76.
    isoforms_v2: add index.gsp <html> <body> <h1>Isoform list application</h1> <h2>Get is forms for ac (${String.format('%tH:%<tM: %<tS.%<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> </body> </html>
  • 77.
    Problem: <g:form> isduplicated (DRY!)
  • 78.
    isoform_v3: use template ‣_form.gsp <h2>Get is forms for ac (${String.format('%tH:%<tM:%<tS. %<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form>
  • 79.
    isoform_v3: use template ‣_form.gsp <h2>Get is forms for ac (${String.format('%tH:%<tM:%<tS. %<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> ‣ In index.gsp and list.gsp <g:render template="form" />
  • 80.
    isoform_v3: use template ‣_form.gsp <h2>Get is forms for ac (${String.format('%tH:%<tM:%<tS. %<tL', new Date())})</h2> <g:form action="list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:form> ‣ In index.gsp and list.gsp <g:render template="form" />
  • 81.
    Problem: all thepage is reloaded totally
  • 82.
  • 83.
    Ajax: asynchronous load web browser Q70Z44 submit server isoform/list 47
  • 84.
    Ajax: asynchronous load web browser Q70Z44 submit server isoform/list 47
  • 85.
    Ajax: asynchronous load web browser Q70Z44 submit server List isoform/list >Q70Z44-1 MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT >Q70Z44-2 MASMSIVKATSNTISQCGWSASANWTPSISPSMDRAERSPSALSPTQVAIRRRCRPSPYV VNFLVPSGILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASL VRPHPSRDQKRGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQ GRCCPTAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQK QHSVELWVQFSHAMDALLFRLYLLFMASSIITVICLWNT 47
  • 86.
    isoform_v4/index.gsp <html> <head> <g:javascript library="prototype" /> </head> <body> <h2>Get is forms for ac (${String.format('%tH:%<tM: %<tS.%<tL', new Date())})</h2> <!-- g:formRemote stands for an ajax form --> <g:formRemote name="listForm" url="[action:'list']" update="isoforms-list"> <g:textField name="ac" value="${params.ac}" /> <g:submitButton name="submit" /> </g:formRemote> <!-- the target element of the form --> <div id="isoforms-list"/> </body> </html>
  • 87.
  • 88.
  • 89.
    People post messagesand follow others
  • 90.
    database (domain) + controller(actions) + views (web)
  • 91.
  • 92.
    Domain: bean definition+ database storage
  • 93.
    Person domain ‣ Createthe database entry + bean class grails create-domain-class Person project > right-click > grails > create-domain-class Person
  • 94.
    Person domain ‣ Createthe database entry + bean class grails create-domain-class Person project > right-click > grails > create-domain-class Person ‣ Files created: ./grails-app/domain/eop/lec10/twitter/Person.groovy ./test/unit/eop/lec10/twitter/PersonTests.groovy
  • 95.
    Person.groovy ‣ Created class package eop.lec10.twitter class Person { static constraints = { } }
  • 96.
  • 97.
    Person.groovy ‣ Enriched withfields package eop.lec10.twitter class Person { String username String firstName String lastName String email Date dateCreated static constraints = { } }
  • 98.
    run-app ⇒ database+ table created
  • 99.
    Web access: needcontroller + views
  • 100.
  • 101.
  • 102.
  • 103.
    PersonController.groovy create-controller Person ‣grails-app/controller/PersonController.groovy: package eop.lec10.twitter class PersonController { def scaffold = true } ‣ scaffold generate all default action & view implicitely
  • 104.
    PersonController.groovy create-controller Person ‣grails-app/controller/PersonController.groovy: package eop.lec10.twitter class PersonController { def scaffold = true } ‣ scaffold generate all default action & view implicitely
  • 105.
  • 106.
  • 107.
  • 108.
  • 109.
  • 110.
  • 111.
    http://localhost:8080/eop.lec10.twitter/person ‣ Back tolist - view all - edit - delete - sort
  • 112.
  • 113.
    Person.groovy class Person { String username String firstName String lastName String email Date dateCreated //firstName is compulsory //email field has an email format //username cannot be null, is unique and is between 6 and 20 characters static constraints = { firstName(blank:false) email(email:true, blank:false) username(blank:false, unique:true, matches:/w{6,20}/) } }

Editor's Notes