SlideShare a Scribd company logo
1 of 21
Learning from the innovative open
practices of three international health
projects: IACAPAP, VCPH and
Physiopedia
Tony Coughlan
Faculty of Health and Social Care, The Open University (UK),
t.coughlan@open.ac.uk
Leigh-Anne Perryman
Institute of Educational Technology, The Open University (UK),
leigh.a.perryman@open.ac.uk
Presented at OE Global 2015 Conference
Banff, Canada, 21-25 April 2015
Global shortfall of healthcare workers
‘A crisis in human
resources’
● 2013: 7.2 million
shortfall
● 2035: 12.9 million
shortfall
Source: World Health Organisation. Photo: Exceed Worldwide CC-BY-NC:
● Focus on specific
health professions
● Have links with
professional bodies
● Use volunteers and
are non-profit
● Aim to share
expertise
● Play an
international role
including in LICs
● Are based outside
HE
● Use CC licenses
● Use social media
The projects...
The projects... Collaborative open
textbook
International
Association for Child
and Adolescent
Psychiatry and Allied
Professions
● Est. 75 years ago
● 63 member
organisations
The projects... The Virtual Campus of
Public Health (VCPH)
● Launched 2003
● 140+ partner
institutions in
Central & S.
America
The projects... Physiopedia
● Est. 2009
● At its heart - wiki
developed by a
community of
physiotherapists
Evaluation methods
Prof. Joseph M. Rey
Head of Psychiatry at
Sydney Medical School,
Notre Dame University,
Australia.
Founder of IACAPAP
textbook.
Edgardo de
Gracia
System analyst
& designer at
Ministry of
Health,
Panama
VCPH national
consultant
Rachael Lowe
Physiotherapist
Physiopedia
co-founder &
Executive
Director
● CC-BY
● 49 Chapters
● English & French
● Fully interactive
● 60,000 visits in
first 3 years
● Facebook
IACAPAP
Textbook
IACAPAP
Textbook
Innovation
• Collaborative,
cross-continent
textbook
production
• 100+ authors, 24
countries, 5
continents
• Dynamic –
ongoing updating
and feedback
IACAPAP
Textbook
“The main thing is that it
facilitates access. In many
countries, if child
psychiatrists don’t have
access to open resources
like our textbook they
don’t have access to any
resources at all. It’s not
merely a case of saving
money. It’s having
nothing, or having
something.”
● 100+ institution
collaboration
● 190,000 item
multilingual
online library
(5800 OER)
● 14 open courses
● MOOCs
● Open policies
● Facebook
VCPH
VCPH Innovation
• Multilingual:
Spanish,
Portuguese &
English
• Localised for
culture and
language
• Open policies
VCPH “We use open
practices to promote
equity in health, to
combat disease and
improve the quality of
lives of people of the
Americas. While
openness is not all-
pervasive in public-
health institutions in
Central and Southern
America VCPH hopes
to change the culture.”
● Wiki: 1400
articles; 150,000+
users from 200+
countries per
month
● Open badges
● Open courses
● MOOC
● GFDL + CC-BY-
NC-SA
Physiopedia
Physiopedia Innovation
• Health
profession
capitalising on
Web 2.0
• Professional
wiki
• Open badging
• Big impact/very
small team
Physiopedia “A lot of people who
use our content don’t
otherwise have any
access to this kind of
information - they’re in
low-income
countries…Being open
enables these people to
use up-to-date
resources and achieve
impact on clinical
practice”
Implications
• Existing conception of open
educational practices is too embedded
in universities and individual students
• These projects: OEP = vocational
learning & institutional collaboration
• Need for new frameworks to capture
this, plus impact and localisation.
• Is this unique to health?
Thank you for listening
Tony Coughlan
Faculty of Health and Social Care, The Open University (UK),
t.coughlan@open.ac.uk @tjcoughlan
Leigh-Anne Perryman
Institute of Educational Technology, The Open University (UK),
leigh.a.perryman@open.ac.uk @laperryman

More Related Content

Viewers also liked

Meeting the needs of disabled students through OER and OEP: insights from the...
Meeting the needs of disabled students through OER and OEP: insights from the...Meeting the needs of disabled students through OER and OEP: insights from the...
Meeting the needs of disabled students through OER and OEP: insights from the...Leigh-Anne Perryman
 
Collaborating across borders: OER use and open educational practices within t...
Collaborating across borders: OER use and open educational practices within t...Collaborating across borders: OER use and open educational practices within t...
Collaborating across borders: OER use and open educational practices within t...Leigh-Anne Perryman
 
Learning from the innovative open practices of three international health pro...
Learning from the innovative open practices of three international health pro...Learning from the innovative open practices of three international health pro...
Learning from the innovative open practices of three international health pro...Leigh-Anne Perryman
 
OE Global - Women's Empowerment through OER and OEP
OE Global - Women's Empowerment through OER and OEPOE Global - Women's Empowerment through OER and OEP
OE Global - Women's Empowerment through OER and OEPLeigh-Anne Perryman
 
Tess india presentation open ed14 slideshare
Tess india presentation open ed14 slideshareTess india presentation open ed14 slideshare
Tess india presentation open ed14 slideshareLeigh-Anne Perryman
 
The role of OER localisation in building a knowledge partnership for developm...
The role of OER localisation in building a knowledge partnership for developm...The role of OER localisation in building a knowledge partnership for developm...
The role of OER localisation in building a knowledge partnership for developm...Leigh-Anne Perryman
 
Patavarayan ota-digitalmarketing
Patavarayan ota-digitalmarketingPatavarayan ota-digitalmarketing
Patavarayan ota-digitalmarketingpatavarayan
 

Viewers also liked (8)

Meeting the needs of disabled students through OER and OEP: insights from the...
Meeting the needs of disabled students through OER and OEP: insights from the...Meeting the needs of disabled students through OER and OEP: insights from the...
Meeting the needs of disabled students through OER and OEP: insights from the...
 
Collaborating across borders: OER use and open educational practices within t...
Collaborating across borders: OER use and open educational practices within t...Collaborating across borders: OER use and open educational practices within t...
Collaborating across borders: OER use and open educational practices within t...
 
Learning from the innovative open practices of three international health pro...
Learning from the innovative open practices of three international health pro...Learning from the innovative open practices of three international health pro...
Learning from the innovative open practices of three international health pro...
 
OE Global - Women's Empowerment through OER and OEP
OE Global - Women's Empowerment through OER and OEPOE Global - Women's Empowerment through OER and OEP
OE Global - Women's Empowerment through OER and OEP
 
ardiles
ardilesardiles
ardiles
 
Tess india presentation open ed14 slideshare
Tess india presentation open ed14 slideshareTess india presentation open ed14 slideshare
Tess india presentation open ed14 slideshare
 
The role of OER localisation in building a knowledge partnership for developm...
The role of OER localisation in building a knowledge partnership for developm...The role of OER localisation in building a knowledge partnership for developm...
The role of OER localisation in building a knowledge partnership for developm...
 
Patavarayan ota-digitalmarketing
Patavarayan ota-digitalmarketingPatavarayan ota-digitalmarketing
Patavarayan ota-digitalmarketing
 

Similar to Learning from the innovative open practices of three international health projects: IACAPAP, VCPH and Physiopedia

7 mach 12.20 exploring global issues wendy nicholson
7 mach 12.20 exploring global issues wendy nicholson7 mach 12.20 exploring global issues wendy nicholson
7 mach 12.20 exploring global issues wendy nicholsonNHS England
 
Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018
Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018
Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018Biocat, BioRegion of Catalonia
 
2016-04-17 NuGO2015 FINAL HQ
2016-04-17 NuGO2015 FINAL HQ2016-04-17 NuGO2015 FINAL HQ
2016-04-17 NuGO2015 FINAL HQFre Pepping
 
Science & Community Public Engagement Workshop
Science & Community Public Engagement WorkshopScience & Community Public Engagement Workshop
Science & Community Public Engagement Workshopwellcome.trust
 
PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016
PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016
PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016ipposi
 
Kingston teaching excellence event
Kingston teaching excellence eventKingston teaching excellence event
Kingston teaching excellence eventVivien Rolfe
 
Clinical Trials Event , Mansion House, Dublin, 10052018
Clinical Trials Event , Mansion House, Dublin, 10052018Clinical Trials Event , Mansion House, Dublin, 10052018
Clinical Trials Event , Mansion House, Dublin, 10052018ipposi
 
UKSG webinar: Focus on the South: access to, production and use of research i...
UKSG webinar: Focus on the South: access to, production and use of research i...UKSG webinar: Focus on the South: access to, production and use of research i...
UKSG webinar: Focus on the South: access to, production and use of research i...UKSG: connecting the knowledge community
 
Amgen Teach - How to promote health by facilitating scientific reasoning, cri...
Amgen Teach - How to promote health by facilitating scientific reasoning, cri...Amgen Teach - How to promote health by facilitating scientific reasoning, cri...
Amgen Teach - How to promote health by facilitating scientific reasoning, cri...Go-Lab Initiative
 
Ben Hannigan - Cumulative insights from the study of mental health systems [J...
Ben Hannigan - Cumulative insights from the study of mental health systems [J...Ben Hannigan - Cumulative insights from the study of mental health systems [J...
Ben Hannigan - Cumulative insights from the study of mental health systems [J...benhannigan
 
Zoë Gray: INVOLVE: Learning from 21 years at the helm of public involvement
Zoë Gray: INVOLVE: Learning from 21 years at the helm of public involvementZoë Gray: INVOLVE: Learning from 21 years at the helm of public involvement
Zoë Gray: INVOLVE: Learning from 21 years at the helm of public involvementkoradk
 
Nhs Sustainability Day 2016 Liverpool Road Show
Nhs Sustainability Day 2016 Liverpool Road ShowNhs Sustainability Day 2016 Liverpool Road Show
Nhs Sustainability Day 2016 Liverpool Road Show4 All of Us
 
Chief Allied Health Professions Officer’s Conference 2016: Main stage present...
Chief Allied Health Professions Officer’s Conference 2016: Main stage present...Chief Allied Health Professions Officer’s Conference 2016: Main stage present...
Chief Allied Health Professions Officer’s Conference 2016: Main stage present...NHS England
 
Ueda2016 idf in the coming years,what are the global priorities- nam cho
Ueda2016 idf in the coming years,what are the global priorities- nam choUeda2016 idf in the coming years,what are the global priorities- nam cho
Ueda2016 idf in the coming years,what are the global priorities- nam choueda2015
 

Similar to Learning from the innovative open practices of three international health projects: IACAPAP, VCPH and Physiopedia (20)

7 mach 12.20 exploring global issues wendy nicholson
7 mach 12.20 exploring global issues wendy nicholson7 mach 12.20 exploring global issues wendy nicholson
7 mach 12.20 exploring global issues wendy nicholson
 
Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018
Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018
Presentation Moebio & d·HEALTH Barcelona & CRAASH 2018
 
Práticas Avançadas em Enfermagem no Reino Unido
Práticas Avançadas em Enfermagem no Reino UnidoPráticas Avançadas em Enfermagem no Reino Unido
Práticas Avançadas em Enfermagem no Reino Unido
 
Rémi quirion
Rémi quirionRémi quirion
Rémi quirion
 
2016-04-17 NuGO2015 FINAL HQ
2016-04-17 NuGO2015 FINAL HQ2016-04-17 NuGO2015 FINAL HQ
2016-04-17 NuGO2015 FINAL HQ
 
Science & Community Public Engagement Workshop
Science & Community Public Engagement WorkshopScience & Community Public Engagement Workshop
Science & Community Public Engagement Workshop
 
PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016
PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016
PMI Masterclass - Derick Mitchell IPPOSI - October 19th 2016
 
Kingston teaching excellence event
Kingston teaching excellence eventKingston teaching excellence event
Kingston teaching excellence event
 
Clinical Trials Event , Mansion House, Dublin, 10052018
Clinical Trials Event , Mansion House, Dublin, 10052018Clinical Trials Event , Mansion House, Dublin, 10052018
Clinical Trials Event , Mansion House, Dublin, 10052018
 
UKSG webinar: Focus on the South: access to, production and use of research i...
UKSG webinar: Focus on the South: access to, production and use of research i...UKSG webinar: Focus on the South: access to, production and use of research i...
UKSG webinar: Focus on the South: access to, production and use of research i...
 
Amgen Teach - How to promote health by facilitating scientific reasoning, cri...
Amgen Teach - How to promote health by facilitating scientific reasoning, cri...Amgen Teach - How to promote health by facilitating scientific reasoning, cri...
Amgen Teach - How to promote health by facilitating scientific reasoning, cri...
 
Ben Hannigan - Cumulative insights from the study of mental health systems [J...
Ben Hannigan - Cumulative insights from the study of mental health systems [J...Ben Hannigan - Cumulative insights from the study of mental health systems [J...
Ben Hannigan - Cumulative insights from the study of mental health systems [J...
 
Zoë Gray: INVOLVE: Learning from 21 years at the helm of public involvement
Zoë Gray: INVOLVE: Learning from 21 years at the helm of public involvementZoë Gray: INVOLVE: Learning from 21 years at the helm of public involvement
Zoë Gray: INVOLVE: Learning from 21 years at the helm of public involvement
 
Open Access in Latin America
Open Access in Latin AmericaOpen Access in Latin America
Open Access in Latin America
 
Nhs Sustainability Day 2016 Liverpool Road Show
Nhs Sustainability Day 2016 Liverpool Road ShowNhs Sustainability Day 2016 Liverpool Road Show
Nhs Sustainability Day 2016 Liverpool Road Show
 
How to Get Global Recognition: the Global Healthy Workplace Awards
How to Get Global Recognition: the Global Healthy Workplace AwardsHow to Get Global Recognition: the Global Healthy Workplace Awards
How to Get Global Recognition: the Global Healthy Workplace Awards
 
Chief Allied Health Professions Officer’s Conference 2016: Main stage present...
Chief Allied Health Professions Officer’s Conference 2016: Main stage present...Chief Allied Health Professions Officer’s Conference 2016: Main stage present...
Chief Allied Health Professions Officer’s Conference 2016: Main stage present...
 
Open Access in Latin America
Open Access in Latin AmericaOpen Access in Latin America
Open Access in Latin America
 
Ueda2016 idf in the coming years,what are the global priorities- nam cho
Ueda2016 idf in the coming years,what are the global priorities- nam choUeda2016 idf in the coming years,what are the global priorities- nam cho
Ueda2016 idf in the coming years,what are the global priorities- nam cho
 
Presentation Moebio 2018
Presentation Moebio 2018Presentation Moebio 2018
Presentation Moebio 2018
 

Recently uploaded

Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Educationpboyjonauth
 
Introduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxIntroduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxpboyjonauth
 
URLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppURLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppCeline George
 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfsanyamsingh5019
 
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Celine George
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...EduSkills OECD
 
Accessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactAccessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactdawncurless
 
PSYCHIATRIC History collection FORMAT.pptx
PSYCHIATRIC   History collection FORMAT.pptxPSYCHIATRIC   History collection FORMAT.pptx
PSYCHIATRIC History collection FORMAT.pptxPoojaSen20
 
mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docxPoojaSen20
 
Science 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsScience 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsKarinaGenton
 
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdfssuser54595a
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introductionMaksud Ahmed
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformChameera Dedduwage
 
Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxNirmalaLoungPoorunde1
 
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Krashi Coaching
 
Solving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxSolving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxOH TEIK BIN
 
Organic Name Reactions for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions  for the students and aspirants of Chemistry12th.pptxOrganic Name Reactions  for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions for the students and aspirants of Chemistry12th.pptxVS Mahajan Coaching Centre
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeThiyagu K
 

Recently uploaded (20)

Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Education
 
Introduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptxIntroduction to AI in Higher Education_draft.pptx
Introduction to AI in Higher Education_draft.pptx
 
URLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website AppURLs and Routing in the Odoo 17 Website App
URLs and Routing in the Odoo 17 Website App
 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdf
 
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
Incoming and Outgoing Shipments in 1 STEP Using Odoo 17
 
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
Presentation by Andreas Schleicher Tackling the School Absenteeism Crisis 30 ...
 
Accessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impactAccessible design: Minimum effort, maximum impact
Accessible design: Minimum effort, maximum impact
 
PSYCHIATRIC History collection FORMAT.pptx
PSYCHIATRIC   History collection FORMAT.pptxPSYCHIATRIC   History collection FORMAT.pptx
PSYCHIATRIC History collection FORMAT.pptx
 
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Tilak Nagar Delhi reach out to us at 🔝9953056974🔝
 
mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docx
 
Science 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsScience 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its Characteristics
 
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
 
microwave assisted reaction. General introduction
microwave assisted reaction. General introductionmicrowave assisted reaction. General introduction
microwave assisted reaction. General introduction
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy Reform
 
Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptx
 
Model Call Girl in Bikash Puri Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Bikash Puri  Delhi reach out to us at 🔝9953056974🔝Model Call Girl in Bikash Puri  Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Bikash Puri Delhi reach out to us at 🔝9953056974🔝
 
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
Kisan Call Centre - To harness potential of ICT in Agriculture by answer farm...
 
Solving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptxSolving Puzzles Benefits Everyone (English).pptx
Solving Puzzles Benefits Everyone (English).pptx
 
Organic Name Reactions for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions  for the students and aspirants of Chemistry12th.pptxOrganic Name Reactions  for the students and aspirants of Chemistry12th.pptx
Organic Name Reactions for the students and aspirants of Chemistry12th.pptx
 
Measures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and ModeMeasures of Central Tendency: Mean, Median and Mode
Measures of Central Tendency: Mean, Median and Mode
 

Learning from the innovative open practices of three international health projects: IACAPAP, VCPH and Physiopedia

  • 1. Learning from the innovative open practices of three international health projects: IACAPAP, VCPH and Physiopedia Tony Coughlan Faculty of Health and Social Care, The Open University (UK), t.coughlan@open.ac.uk Leigh-Anne Perryman Institute of Educational Technology, The Open University (UK), leigh.a.perryman@open.ac.uk Presented at OE Global 2015 Conference Banff, Canada, 21-25 April 2015
  • 2. Global shortfall of healthcare workers ‘A crisis in human resources’ ● 2013: 7.2 million shortfall ● 2035: 12.9 million shortfall Source: World Health Organisation. Photo: Exceed Worldwide CC-BY-NC:
  • 3. ● Focus on specific health professions ● Have links with professional bodies ● Use volunteers and are non-profit ● Aim to share expertise ● Play an international role including in LICs ● Are based outside HE ● Use CC licenses ● Use social media The projects...
  • 4. The projects... Collaborative open textbook International Association for Child and Adolescent Psychiatry and Allied Professions ● Est. 75 years ago ● 63 member organisations
  • 5. The projects... The Virtual Campus of Public Health (VCPH) ● Launched 2003 ● 140+ partner institutions in Central & S. America
  • 6. The projects... Physiopedia ● Est. 2009 ● At its heart - wiki developed by a community of physiotherapists
  • 8. Prof. Joseph M. Rey Head of Psychiatry at Sydney Medical School, Notre Dame University, Australia. Founder of IACAPAP textbook.
  • 9. Edgardo de Gracia System analyst & designer at Ministry of Health, Panama VCPH national consultant
  • 11. ● CC-BY ● 49 Chapters ● English & French ● Fully interactive ● 60,000 visits in first 3 years ● Facebook IACAPAP Textbook
  • 12. IACAPAP Textbook Innovation • Collaborative, cross-continent textbook production • 100+ authors, 24 countries, 5 continents • Dynamic – ongoing updating and feedback
  • 13. IACAPAP Textbook “The main thing is that it facilitates access. In many countries, if child psychiatrists don’t have access to open resources like our textbook they don’t have access to any resources at all. It’s not merely a case of saving money. It’s having nothing, or having something.”
  • 14. ● 100+ institution collaboration ● 190,000 item multilingual online library (5800 OER) ● 14 open courses ● MOOCs ● Open policies ● Facebook VCPH
  • 15. VCPH Innovation • Multilingual: Spanish, Portuguese & English • Localised for culture and language • Open policies
  • 16. VCPH “We use open practices to promote equity in health, to combat disease and improve the quality of lives of people of the Americas. While openness is not all- pervasive in public- health institutions in Central and Southern America VCPH hopes to change the culture.”
  • 17. ● Wiki: 1400 articles; 150,000+ users from 200+ countries per month ● Open badges ● Open courses ● MOOC ● GFDL + CC-BY- NC-SA Physiopedia
  • 18. Physiopedia Innovation • Health profession capitalising on Web 2.0 • Professional wiki • Open badging • Big impact/very small team
  • 19. Physiopedia “A lot of people who use our content don’t otherwise have any access to this kind of information - they’re in low-income countries…Being open enables these people to use up-to-date resources and achieve impact on clinical practice”
  • 20. Implications • Existing conception of open educational practices is too embedded in universities and individual students • These projects: OEP = vocational learning & institutional collaboration • Need for new frameworks to capture this, plus impact and localisation. • Is this unique to health?
  • 21. Thank you for listening Tony Coughlan Faculty of Health and Social Care, The Open University (UK), t.coughlan@open.ac.uk @tjcoughlan Leigh-Anne Perryman Institute of Educational Technology, The Open University (UK), leigh.a.perryman@open.ac.uk @laperryman

Editor's Notes

  1. Who we are… academics with UKOU. For some years we’ve been researching OER and OEP outside academia, partly in connection with our development of the public open scholar role. I’m OERRH fellow, specialising in OER in developing countries. Tony’s specialism is health & social care. Developed and runs cyp-media.org – site curating digital open resources for the children and young people’s workforce sector. This presentation reports our research on three international health projects engaged in innovative open practices.
  2. The impetus for this research is a real and pressing global problem….
  3. B We analysed the projects against two frameworks… OPAL OEP maturity matrix which covers…. However this wasn’t sufficiently comprehensive to cover the practices in the three global health projects. We appended it with Vrieling et al’s OEP social configuration framework which looks at: Practice: The impact on occupational activity. Domain: “The shared area in which group members work together. Collective identity: “The mutual engagement that binds the members together as a social entity, Organization: The interactional repertoire of a group of people, the geographical scope of its activities, the power relations involved, and the level of self-organisation.
  4. T
  5. T
  6. T
  7. T Collaborative, cross-continent textbook production 100+ authors, 24 countries, 5 continents Dynamic – ongoing updating and feedback
  8. T Collaborative, cross-continent textbook production 100+ authors, 24 countries, 5 continents Dynamic – ongoing updating and feedback
  9. T Collaborative, cross-continent textbook production 100+ authors, 24 countries, 5 continents Dynamic – ongoing updating and feedback
  10. T
  11. T
  12. T
  13. T
  14. T
  15. T
  16. B
  17. Our full paper is available in the conference issue of OpenPraxis.