This document discusses potential paradigm shifts in document management. It begins by defining key terms like paradigm, paradigm shift, document, and document management. It then explores factors driving paradigm shifts, such as changing user requirements, new Internet technologies, and document management becoming part of standard IT infrastructure. The document considers if these changes constitute an actual paradigm shift in document management and what implications they could have for both users and suppliers.
[EN] Breaking the Barriers of Traditional Records Management | Dr. Ulrich Kampffmeyer | DLM Forum Conference Toulouse 2008
Records, Records Management, Enterprise Content Management and MoReq2
1. Records and Records Management
2. Comparing different Records Management approaches
3. Records Management challenges in the era of 2.0
4. Where do we stand now with MoReq2?
The first keynote I delivered at #eas14 used Brookfield's notion of lenses of reflection to encourage participants to consider other roles in everyday practice. This presentation focussed on a number of examples, including visualising assessment timelines.
Managing Enterprise Content: Solutions that Fit Your Unique NeedsTy Alden Cole
Â
Our framework enables the management of information assets across an organization, and ties in relevant components and technologies. This could be Electronic Document Management, Electronic Records Management, Workflow, Business Process Management, Web Content Management, Collaboration and Digital Asset Management.
RADcube Enterprise Content Management provides the flexibility to access or deliver content over Mobile and Cloud platforms, creating a highly connected and digital workplace. It offers a robust US DoD 5015.2 certified Records Management System to ensure compliance with regulatory requirements around management of records.
This yearâs DLM-Forum has the theme of âThe Memory of the Information Societyâ. This âmemoryâ is no longer information which can be recognised and understood straightaway with the naked eye, as was the case in the past, but rather non-transparent data, stored on a computer system. Technical tools are required to find it and make it readable once more. This is not a disadvantage, however, as modern information technology tools enable us to handle efficiently the exponentially growing mountains of data and documents. The use of electronic information systems further promotes the trend of producing an increasing quantity of information by digital means, which afterwards is only available in digital form.
[EN] Breaking the Barriers of Traditional Records Management | Dr. Ulrich Kampffmeyer | DLM Forum Conference Toulouse 2008
Records, Records Management, Enterprise Content Management and MoReq2
1. Records and Records Management
2. Comparing different Records Management approaches
3. Records Management challenges in the era of 2.0
4. Where do we stand now with MoReq2?
The first keynote I delivered at #eas14 used Brookfield's notion of lenses of reflection to encourage participants to consider other roles in everyday practice. This presentation focussed on a number of examples, including visualising assessment timelines.
Managing Enterprise Content: Solutions that Fit Your Unique NeedsTy Alden Cole
Â
Our framework enables the management of information assets across an organization, and ties in relevant components and technologies. This could be Electronic Document Management, Electronic Records Management, Workflow, Business Process Management, Web Content Management, Collaboration and Digital Asset Management.
RADcube Enterprise Content Management provides the flexibility to access or deliver content over Mobile and Cloud platforms, creating a highly connected and digital workplace. It offers a robust US DoD 5015.2 certified Records Management System to ensure compliance with regulatory requirements around management of records.
This yearâs DLM-Forum has the theme of âThe Memory of the Information Societyâ. This âmemoryâ is no longer information which can be recognised and understood straightaway with the naked eye, as was the case in the past, but rather non-transparent data, stored on a computer system. Technical tools are required to find it and make it readable once more. This is not a disadvantage, however, as modern information technology tools enable us to handle efficiently the exponentially growing mountains of data and documents. The use of electronic information systems further promotes the trend of producing an increasing quantity of information by digital means, which afterwards is only available in digital form.
EDF2014: Christian Lindemann, Wolters Kluwer Germany & Christian Dirschl, Wol...European Data Forum
Â
Invited Talk by Christian Lindemann, Wolters Kluwer Germany & Christian Dirschl, Wolters Kluwer Germany at the European Data Forum 2014, 20 March 2014 in Athens, Greece: Linked Data and Open Government Data as part of the business strategy of Wolters Kluwer Germany.
Presentation "Trends in Records, Document and Enterprise Content Management" at the S.E.R. Conference, Vizegrad, Hungary, 28th September 2004 by Dr. Ulrich Kampffmeyer, PROJECT CONSULT. (c) CopyRight and Authorship Rights: Dr. Ulrich Kampffmeyer, PROJECT CONSULT Unternehmensberatung GmbH, hamburg, 2003-2004. http://www.PROJECT-CONSULT.com
Approach in Spain to the implementation of electronic documents and electroni...Miguel A. Amutio
Â
Spain is developing all the issues about the electronic document as a collective and multidisciplinary effort along the time, including an exhaustive legal framework with lower level regulations and supporting documents, governance, cooperation and collaboration between the public and private sectors, with the engagement of all interested stakeholders, professional or institutional, and the deployment of services for the management of administrative electronic documents and for electronic archiving.
The Momentum of Open Standards - a Pragmatic Approach to Software Interoperab...ePractice.eu
Â
Authors: Trond Arne Undheim, Jochen Friedrich.
Software is increasingly embedded in society. Fewer and fewer solutions are stand-alone, hence interoperability amongst software from different vendors is crucial to governments, industry and the third sector.
This white paper written by Heckman Consulting overviews the functional and financial benefits of electronic document management. Small to enterprise companies can use document management software to better manage their paper documents, helping to create workflow efficiencies, improve employee productivity and reduce labour costs.
Why We Are Open Sourcing ContraxSuite and Some Thoughts About Legal Tech and ...Daniel Katz
Â
Why We Are Open Sourcing ContraxSuite and Some Thoughts About Legal Tech and the Modern Information Economy - By Michael Bommarito + Daniel Martin Katz from LexPredict
âRecognizing Value from a Shared RM/DM Repository: Canadian Government Perspe...Cheryl McKinnon
Â
2003 ARMA Conference Proceedings paper outlining Canadian government examples in content and information management. A historical piece, with focus on Canadian Federal RDIMS initiative up to 2003 and City of Coquitlam. Background to ARMA session co-delivered by Cheryl McKinnon and Heather Gordon
Successfully Kickstarting Data Governance's Social Dynamics: Define, Collabor...Stijn (Stan) Christiaens
Â
Learn how to launch your data governance program, by answering three questions:
- What does my data mean: collect and manage business definitions and relations, taxonomies and classifications, business rules and ontologies;
- How can I involve all stakeholders: engage them across business units and geographies, with stewards, data owners, ⌠in a guiding workflow;
- How do I operationalize data governance: link MDM, DQ and BI to the business, use business-driven semantic modelling, achieve end-to end traceabilitiy. During this session we will use examples from different verticals: Finance, Government, Utilities,⌠.
We discuss their main drivers for starting a Data Governance initiative, as well as their pragmatic approach in moving from gradual roll out to support and sustain their Data Governance program.
Revisiting Open Document Format and Office Open XML: The Quiet Revolution Con...Peter O'Kelly
Â
It has been several years since the lively and highly polarized market debate about the relative merits and standards significance of the Open Document Format (ODF) and Office Open XML (OOXML) file format standards. Although ODF and OOXML have since largely faded from the mainstream technology industry press and blogosphere radar, both standards have continued to evolve and gain market support, with significant benefits for all organizations seeking to optimize their use of information contained in documents created with productivity applications.
This document provides an overview of the status and significance of ODF and OOXML. It starts with a summary of the business value of open and XML-based document formats, along with a review of the ODF/OOXML historical debate, including a recap of a widely-discussed January 2008 Burton Group report which included what were, at that time, considered provocative conclusions and market projections.
The document continues with a summary of some of the most impactful ODF- and OOXML-related industry changes during recent years, including Microsoftâs (surprising, to many market observers) commitment to support and contribute to both ODF and OOXML, as well as Oracleâs acquisition of Sun Microsystems, and the acquisitionâs ramifications for OpenOffice.org (which served as the starting point for ODF, in 2000).
The analysis concludes with some market projections about likely next steps, as both ODF and OOXML continue to evolve.
Adoption of Open Standards by European Public Administrations - The Case of D...MaĂŤl Brunet
Â
Presentation made at the Open World Forum in Paris on October 31, 2014 http://www.openworldforum.paris/en/tracks/open-standards-and-public-policy#talk_437
DITA, Semantics, Content Management, Dynamic Documents, and Linked Data â A M...Paul Wlodarczyk
Â
DITA was conceived as a model for improving reuse through topic-oriented modularization of content. Instead of creating new content or copying and pasting information which may or may not be current and authoritative, organizations manage a repository of content assets â or DITA topics â that can be centrally managed, maintained and reused across the enterprise. This helps to accelerate the creation and maintenance of documents and other deliverables and to ensure the quality and consistency of the content organizations publish. But the next frontier of DITA adoption is leveraging semantic technologiesâtaxonomies, ontologies and text analyticsâto automate the delivery of targeted content. For example, a service incident from a customer is automatically matched with the appropriate response, which is authored and managed as a DITA topic. Learn how organizations can leverage DITA, semantics, content management, dynamic documents, and linked data to fully utilize the value of their information.
SER Expertentalk 2021: Mit ECM zu effektiver Information Governance
mit Dr. Ulrich Kampffmeyer & Stefan Krannich vom 11.03.2021
Agenda
- Einblick
- Was ist Information Governance?
- Information Governance und ganzheitliches Information Management
- Automatisierung als Disruptor und Enabler
- Kann eine Information Governance dem Ansturm der Automatisierung standhalten?
- Ausblick
Die Videoaufzeichnung des Webinars: https://www.youtube.com/watch?v=lO8NZ82Q0TE
Das PROJECT CONSULT Seminar "Update Information Management" findet dieses Jahr aufgrund der aktuellen Pandemie Situation nicht mehr wie gewohnt statt.
"Die 10 PROJECT CONSULT Trends fĂźr das Information Management des aktuellen Jahres" sind eine Tradition des PROJECT CONSULT Seminars "Update Information Management" welche in dem Kapitel "Trends" vorgestellt werden.
Wie immer wurden die 10 Trends gemeinsam mit unseren Beratern und Beraterinnen beschlossen und nach Gewichtung in den Vortrag aufgenommen.
Alle Informationen der Folien beziehen sich auf die im Webcast gezeigten Inhalte.
http://bit.ly/PCWebcast003
More Related Content
Similar to [EN] Paradigm Shifts in Document Management | Dr. Ulrich Kampffmeyer | Hamburg 1999
EDF2014: Christian Lindemann, Wolters Kluwer Germany & Christian Dirschl, Wol...European Data Forum
Â
Invited Talk by Christian Lindemann, Wolters Kluwer Germany & Christian Dirschl, Wolters Kluwer Germany at the European Data Forum 2014, 20 March 2014 in Athens, Greece: Linked Data and Open Government Data as part of the business strategy of Wolters Kluwer Germany.
Presentation "Trends in Records, Document and Enterprise Content Management" at the S.E.R. Conference, Vizegrad, Hungary, 28th September 2004 by Dr. Ulrich Kampffmeyer, PROJECT CONSULT. (c) CopyRight and Authorship Rights: Dr. Ulrich Kampffmeyer, PROJECT CONSULT Unternehmensberatung GmbH, hamburg, 2003-2004. http://www.PROJECT-CONSULT.com
Approach in Spain to the implementation of electronic documents and electroni...Miguel A. Amutio
Â
Spain is developing all the issues about the electronic document as a collective and multidisciplinary effort along the time, including an exhaustive legal framework with lower level regulations and supporting documents, governance, cooperation and collaboration between the public and private sectors, with the engagement of all interested stakeholders, professional or institutional, and the deployment of services for the management of administrative electronic documents and for electronic archiving.
The Momentum of Open Standards - a Pragmatic Approach to Software Interoperab...ePractice.eu
Â
Authors: Trond Arne Undheim, Jochen Friedrich.
Software is increasingly embedded in society. Fewer and fewer solutions are stand-alone, hence interoperability amongst software from different vendors is crucial to governments, industry and the third sector.
This white paper written by Heckman Consulting overviews the functional and financial benefits of electronic document management. Small to enterprise companies can use document management software to better manage their paper documents, helping to create workflow efficiencies, improve employee productivity and reduce labour costs.
Why We Are Open Sourcing ContraxSuite and Some Thoughts About Legal Tech and ...Daniel Katz
Â
Why We Are Open Sourcing ContraxSuite and Some Thoughts About Legal Tech and the Modern Information Economy - By Michael Bommarito + Daniel Martin Katz from LexPredict
âRecognizing Value from a Shared RM/DM Repository: Canadian Government Perspe...Cheryl McKinnon
Â
2003 ARMA Conference Proceedings paper outlining Canadian government examples in content and information management. A historical piece, with focus on Canadian Federal RDIMS initiative up to 2003 and City of Coquitlam. Background to ARMA session co-delivered by Cheryl McKinnon and Heather Gordon
Successfully Kickstarting Data Governance's Social Dynamics: Define, Collabor...Stijn (Stan) Christiaens
Â
Learn how to launch your data governance program, by answering three questions:
- What does my data mean: collect and manage business definitions and relations, taxonomies and classifications, business rules and ontologies;
- How can I involve all stakeholders: engage them across business units and geographies, with stewards, data owners, ⌠in a guiding workflow;
- How do I operationalize data governance: link MDM, DQ and BI to the business, use business-driven semantic modelling, achieve end-to end traceabilitiy. During this session we will use examples from different verticals: Finance, Government, Utilities,⌠.
We discuss their main drivers for starting a Data Governance initiative, as well as their pragmatic approach in moving from gradual roll out to support and sustain their Data Governance program.
Revisiting Open Document Format and Office Open XML: The Quiet Revolution Con...Peter O'Kelly
Â
It has been several years since the lively and highly polarized market debate about the relative merits and standards significance of the Open Document Format (ODF) and Office Open XML (OOXML) file format standards. Although ODF and OOXML have since largely faded from the mainstream technology industry press and blogosphere radar, both standards have continued to evolve and gain market support, with significant benefits for all organizations seeking to optimize their use of information contained in documents created with productivity applications.
This document provides an overview of the status and significance of ODF and OOXML. It starts with a summary of the business value of open and XML-based document formats, along with a review of the ODF/OOXML historical debate, including a recap of a widely-discussed January 2008 Burton Group report which included what were, at that time, considered provocative conclusions and market projections.
The document continues with a summary of some of the most impactful ODF- and OOXML-related industry changes during recent years, including Microsoftâs (surprising, to many market observers) commitment to support and contribute to both ODF and OOXML, as well as Oracleâs acquisition of Sun Microsystems, and the acquisitionâs ramifications for OpenOffice.org (which served as the starting point for ODF, in 2000).
The analysis concludes with some market projections about likely next steps, as both ODF and OOXML continue to evolve.
Adoption of Open Standards by European Public Administrations - The Case of D...MaĂŤl Brunet
Â
Presentation made at the Open World Forum in Paris on October 31, 2014 http://www.openworldforum.paris/en/tracks/open-standards-and-public-policy#talk_437
DITA, Semantics, Content Management, Dynamic Documents, and Linked Data â A M...Paul Wlodarczyk
Â
DITA was conceived as a model for improving reuse through topic-oriented modularization of content. Instead of creating new content or copying and pasting information which may or may not be current and authoritative, organizations manage a repository of content assets â or DITA topics â that can be centrally managed, maintained and reused across the enterprise. This helps to accelerate the creation and maintenance of documents and other deliverables and to ensure the quality and consistency of the content organizations publish. But the next frontier of DITA adoption is leveraging semantic technologiesâtaxonomies, ontologies and text analyticsâto automate the delivery of targeted content. For example, a service incident from a customer is automatically matched with the appropriate response, which is authored and managed as a DITA topic. Learn how organizations can leverage DITA, semantics, content management, dynamic documents, and linked data to fully utilize the value of their information.
Similar to [EN] Paradigm Shifts in Document Management | Dr. Ulrich Kampffmeyer | Hamburg 1999 (20)
SER Expertentalk 2021: Mit ECM zu effektiver Information Governance
mit Dr. Ulrich Kampffmeyer & Stefan Krannich vom 11.03.2021
Agenda
- Einblick
- Was ist Information Governance?
- Information Governance und ganzheitliches Information Management
- Automatisierung als Disruptor und Enabler
- Kann eine Information Governance dem Ansturm der Automatisierung standhalten?
- Ausblick
Die Videoaufzeichnung des Webinars: https://www.youtube.com/watch?v=lO8NZ82Q0TE
Das PROJECT CONSULT Seminar "Update Information Management" findet dieses Jahr aufgrund der aktuellen Pandemie Situation nicht mehr wie gewohnt statt.
"Die 10 PROJECT CONSULT Trends fĂźr das Information Management des aktuellen Jahres" sind eine Tradition des PROJECT CONSULT Seminars "Update Information Management" welche in dem Kapitel "Trends" vorgestellt werden.
Wie immer wurden die 10 Trends gemeinsam mit unseren Beratern und Beraterinnen beschlossen und nach Gewichtung in den Vortrag aufgenommen.
Alle Informationen der Folien beziehen sich auf die im Webcast gezeigten Inhalte.
http://bit.ly/PCWebcast003
Der Vortrag "Knowledge Management, eBusiness & Enterprise Content Management - Neue Herausforderungen fuer die Bankenbranche" von Dr. Ulrich Kampffmeyer fand am 07. Semptember 2001 in Wiesbaden statt.
Agenda
- Zum Teufel mit der babylonischen Sprachverwirrung der DMS-Marketiers...
- Document Related Technologies & ihre Einsatzbereiche bei Finanzdienstleistern
- Die neuen Martktrends
- Change Management als generelle Strategie
Der Vortrag "Staffware Process Suite â Delivering the Process of Business" von Dr. Ulrich Kampffmeyer fand am 19. Februar 2002 in Frankfurt statt.
Agenda
- PROJECT CONSULT
- Was ist Business Process Management?
- Marktentwicklung
- Einsatzgebiete
- Nutzen von Workflow-Management-Systemen
- Trends
Transkript from the presentation "Decisions and Timing, a Practical Guide" by Dr. Ulrich Kampffmeyer at the IMC Congress, Cannes 1995
Contents
1. Changing Markets
2. User Needs
3. Problems of document standards and DMS architecture
4. Problems of Document Management System Architecture
5. Migration - Chances for Technology Change
6. New standards on the horizon
6.1 DMA Document Management Alliance
6.2 WfMC Workflow Management Coalition
7. Decisions and Timing
Transkript des Vortrages "Planung und Projektmanagement zur EinfĂźhrung komplexer Informationssysteme mit digitalen optischen Speichern" von dem KongreĂ E.D.O.K. '93 welcher am 1. Dezember 1993 in Mainz stattfand.
Diese Dokumentation ist die Mitschrift des Vortrages "Planung und Projektmanagement zur EinfĂźhrung komplexer Informationssysteme mit digitalen, optischen Speichern" von Herrn Dr. Ulrich Kampffmeyer und der anschlieĂenden
Diskussion auf dem KongreĂ E.D. O.K. '93.
Das PROJECT CONSULT Seminar "Update Information Management" findet dieses Jahr aufgrund der aktuellen Pandemie Situation sowie fehlender Nachfragen nicht mehr wie gewohnt statt.
Dennoch sollen die zukĂźnftigen Entwicklung bis 2026 sowie der bisherige Stand seit 2017 des Themas ECM und allem was dazu gehĂśrt, in online Form nicht zu knapp kommen.
Zum Video
https://bit.ly/PCWebcast-002
Eine Keynote von Dr. Ulrich Kampffmeyer zum Thema "Records Management".
Der Vortrag fand am 29. Oktober 2008 in Berlin, im Rahmen des SAPERION User Group Events statt.
Die Agenda zum Vortrag
- Was, Wie, Wo, Wieso, Warum
- Definitionen
- Standards
- MoReq2
- Markt
- Nutzen
- Ausblick
"Aktuelles zu den rechtlichen Anforderungen an die Archivierung und Verfahrensdokumentation"
Ein Vortrag von Dr. Ulrich Kampffmeyer bei dem Docuvita Partnertag 2020 in Hamburg
Agenda
⢠EinfĂźhrung âAktuelle rechtliche Anforderungen im Umfeld von Handels- und Steuerrechtâ
- Die GoBD 2019
- GoBD: wesentliche Ănderungen und Ergänzungen
- GoBD und Scannen
- GoBD und elektronische Rechnung
- GoBD und Aufbewahrung
⢠GoBD & Verfahrensdokumentation
- Ziele und Zweck von Verfahrensdokumentationen
- Struktur, Aufbau und Umfang von Verfahrensdokumentationen
- Inhalte von Verfahrensdokumentation
- Benutzung von Muster-Verfahrungsdokumentationen und Tools
- Vorgehen bei der Erstellung einer Verfahrensdokumentation
- Pflege und Nachhaltung von Verfahrensdokumentationen
⢠Ausblick âWas muss noch alles dokumentiert werden â Strategien zum Umgang mit Dokumentationenâ
Ein Vortrag von Dr. Ulrich Kampffmeyer auf der CENIT Innovation Konferenz in BĂśblingen am 22. Juni 2017
Gliederung:
(1) EinfĂźhrung: Alles dreht sich um digitale Information
(2) Enterprise Content Management: Status Quo und Krise
(3) ECM neu gedacht: Enterprise Information Management
(4) Paradigmenwechsel: Warum wir nur noch von Information
Management sprechen sollten
(5) Einmal anders: Aktuelle Trends im Information Management
(6) Ausblick: Digitalisierung ohne Information Management â
geht das Ăźberhaupt?
Zum Beitrag auf unserer Website
http://bit.ly/KffCENIT2017-PCWeb
Das PROJECT CONSULT Seminar "Update Information Management" findet dieses Jahr aufgrund der aktuellen Pandemie Situation sowie fehlender Nachfragen nicht mehr wie gewohnt statt.
Da die Trends immer mit das Highlight des Seminars waren, stehen hier die Top 10 Neuerungen im Information Management online in Form eines PROJECT CONSULT Webcasts zur VerfĂźgung.
Alle Informationen der Folien beziehen sich auf die im Webcast gezeigten Inhalte.
https://bit.ly/PCWebcast-001
AIIM Conference @ DMS-EXPO
Essen, 05. September 2002 Š PROJECT
Agenda:
- Sichere elektronische Archivierung
-- Was ist Sicherheit?
-- Was ist elektronische Archivierung? -
- Rechtliche Situation
-- Deutschland
-- Europa
-- Codes of Practice
- Standards
-- Nutzen, Relevanz, Einhaltung
- Herausforderungen
-- Produkte
-- Migration
-- Trends
Zum Video
https://bit.ly/eArch-vonBredow
Part 2 von 2
Vogel Business Media
Der gesamte Vortrag
"E-Mail-Archivierung richtig gestalten â Rechtliche Grundlagen, Management und Loesungen fĂźr die IT-Praxis" von Dr. Ulrich Kampffmeyer aus dem Jahre 2011
Agenda
- Einfuehrung
- Definitionen
- Rechtsfragen
- Funktionalität
- Archivierungsverfahren
- Besondere Problembereiche
- Ausblick
Part 1 von 2
Vogel Business Media
Der gesamte Vortrag
"E-Mail-Archivierung richtig gestalten â Rechtliche Grundlagen, Management und Loesungen fĂźr die IT-Praxis" von Dr. Ulrich Kampffmeyer aus dem Jahre 2011
Agenda
- Einfuehrung
- Definitionen
- Rechtsfragen
- Funktionalität
- Archivierungsverfahren
- Besondere Problembereiche
- Ausblick
Ein Artikel von Dr. Ulrich Kampffmeyer, PROJECT CONSULT Unternehmensberatung
"Effizienter Einsatz von Dokumenten-Technologien = noch mehr Arbeitslose?" aus dem Jahre 2004
Was ist eigentlich der Wert der Information? Welchen Stellenwert hat Information als solche fĂźr uns heute, aber auch als Mensch im Allgemeinen? Wie kann sie im digitalen Zeitalter erhalten bleiben? Wie kann Informationsverarbeitung besser an den Menschen angepasst werden? Die Frage nach dem Wert der Information wirft viele weitere auf, fĂźhrt uns aber auf die Spur des eigentlichen Kerns der Information.
Zum Beitrag auf der PROJECT CONSULT Website
https://bit.ly/WertInfo14
More from PROJECT CONSULT Unternehmensberatung Dr. Ulrich Kampffmeyer GmbH (20)
RMD24 | Debunking the non-endemic revenue myth Marvin Vacquier Droop | First ...BBPMedia1
Â
Marvin neemt je in deze presentatie mee in de voordelen van non-endemic advertising op retail media netwerken. Hij brengt ook de uitdagingen in beeld die de markt op dit moment heeft op het gebied van retail media voor niet-leveranciers.
Retail media wordt gezien als het nieuwe advertising-medium en ook mediabureaus richten massaal retail media-afdelingen op. Merken die niet in de betreffende winkel liggen staan ook nog niet in de rij om op de retail media netwerken te adverteren. Marvin belicht de uitdagingen die er zijn om echt aansluiting te vinden op die markt van non-endemic advertising.
Business Valuation Principles for EntrepreneursBen Wann
Â
This insightful presentation is designed to equip entrepreneurs with the essential knowledge and tools needed to accurately value their businesses. Understanding business valuation is crucial for making informed decisions, whether you're seeking investment, planning to sell, or simply want to gauge your company's worth.
Skye Residences | Extended Stay Residences Near Toronto Airportmarketingjdass
Â
Experience unparalleled EXTENDED STAY and comfort at Skye Residences located just minutes from Toronto Airport. Discover sophisticated accommodations tailored for discerning travelers.
Website Link :
https://skyeresidences.com/
https://skyeresidences.com/about-us/
https://skyeresidences.com/gallery/
https://skyeresidences.com/rooms/
https://skyeresidences.com/near-by-attractions/
https://skyeresidences.com/commute/
https://skyeresidences.com/contact/
https://skyeresidences.com/queen-suite-with-sofa-bed/
https://skyeresidences.com/queen-suite-with-sofa-bed-and-balcony/
https://skyeresidences.com/queen-suite-with-sofa-bed-accessible/
https://skyeresidences.com/2-bedroom-deluxe-queen-suite-with-sofa-bed/
https://skyeresidences.com/2-bedroom-deluxe-king-queen-suite-with-sofa-bed/
https://skyeresidences.com/2-bedroom-deluxe-queen-suite-with-sofa-bed-accessible/
#Skye Residences Etobicoke, #Skye Residences Near Toronto Airport, #Skye Residences Toronto, #Skye Hotel Toronto, #Skye Hotel Near Toronto Airport, #Hotel Near Toronto Airport, #Near Toronto Airport Accommodation, #Suites Near Toronto Airport, #Etobicoke Suites Near Airport, #Hotel Near Toronto Pearson International Airport, #Toronto Airport Suite Rentals, #Pearson Airport Hotel Suites
Putting the SPARK into Virtual Training.pptxCynthia Clay
Â
This 60-minute webinar, sponsored by Adobe, was delivered for the Training Mag Network. It explored the five elements of SPARK: Storytelling, Purpose, Action, Relationships, and Kudos. Knowing how to tell a well-structured story is key to building long-term memory. Stating a clear purpose that doesn't take away from the discovery learning process is critical. Ensuring that people move from theory to practical application is imperative. Creating strong social learning is the key to commitment and engagement. Validating and affirming participants' comments is the way to create a positive learning environment.
Discover the innovative and creative projects that highlight my journey throu...dylandmeas
Â
Discover the innovative and creative projects that highlight my journey through Full Sail University. Below, youâll find a collection of my work showcasing my skills and expertise in digital marketing, event planning, and media production.
Buy Verified PayPal Account | Buy Google 5 Star Reviewsusawebmarket
Â
Buy Verified PayPal Account
Looking to buy verified PayPal accounts? Discover 7 expert tips for safely purchasing a verified PayPal account in 2024. Ensure security and reliability for your transactions.
PayPal Services Features-
đ˘ Email Access
đ˘ Bank Added
đ˘ Card Verified
đ˘ Full SSN Provided
đ˘ Phone Number Access
đ˘ Driving License Copy
đ˘ Fasted Delivery
Client Satisfaction is Our First priority. Our services is very appropriate to buy. We assume that the first-rate way to purchase our offerings is to order on the website. If you have any worry in our cooperation usually You can order us on Skype or Telegram.
24/7 Hours Reply/Please Contact
usawebmarketEmail: support@usawebmarket.com
Skype: usawebmarket
Telegram: @usawebmarket
WhatsApp: +1âŞ(218) 203-5951âŹ
USA WEB MARKET is the Best Verified PayPal, Payoneer, Cash App, Skrill, Neteller, Stripe Account and SEO, SMM Service provider.100%Satisfection granted.100% replacement Granted.
What is the TDS Return Filing Due Date for FY 2024-25.pdfseoforlegalpillers
Â
It is crucial for the taxpayers to understand about the TDS Return Filing Due Date, so that they can fulfill your TDS obligations efficiently. Taxpayers can avoid penalties by sticking to the deadlines and by accurate filing of TDS. Timely filing of TDS will make sure about the availability of tax credits. You can also seek the professional guidance of experts like Legal Pillers for timely filing of the TDS Return.
Premium MEAN Stack Development Solutions for Modern BusinessesSynapseIndia
Â
Stay ahead of the curve with our premium MEAN Stack Development Solutions. Our expert developers utilize MongoDB, Express.js, AngularJS, and Node.js to create modern and responsive web applications. Trust us for cutting-edge solutions that drive your business growth and success.
Know more: https://www.synapseindia.com/technology/mean-stack-development-company.html
Attending a job Interview for B1 and B2 Englsih learnersErika906060
Â
It is a sample of an interview for a business english class for pre-intermediate and intermediate english students with emphasis on the speking ability.
The world of search engine optimization (SEO) is buzzing with discussions after Google confirmed that around 2,500 leaked internal documents related to its Search feature are indeed authentic. The revelation has sparked significant concerns within the SEO community. The leaked documents were initially reported by SEO experts Rand Fishkin and Mike King, igniting widespread analysis and discourse. For More Info:- https://news.arihantwebtech.com/search-disrupted-googles-leaked-documents-rock-the-seo-world/
LA HUG - Video Testimonials with Chynna Morgan - June 2024Lital Barkan
Â
Have you ever heard that user-generated content or video testimonials can take your brand to the next level? We will explore how you can effectively use video testimonials to leverage and boost your sales, content strategy, and increase your CRM data.đ¤Ż
We will dig deeper into:
1. How to capture video testimonials that convert from your audience đĽ
2. How to leverage your testimonials to boost your sales đ˛
3. How you can capture more CRM data to understand your audience better through video testimonials. đ
Improving profitability for small businessBen Wann
Â
In this comprehensive presentation, we will explore strategies and practical tips for enhancing profitability in small businesses. Tailored to meet the unique challenges faced by small enterprises, this session covers various aspects that directly impact the bottom line. Attendees will learn how to optimize operational efficiency, manage expenses, and increase revenue through innovative marketing and customer engagement techniques.
Cracking the Workplace Discipline Code Main.pptxWorkforce Group
Â
Cultivating and maintaining discipline within teams is a critical differentiator for successful organisations.
Forward-thinking leaders and business managers understand the impact that discipline has on organisational success. A disciplined workforce operates with clarity, focus, and a shared understanding of expectations, ultimately driving better results, optimising productivity, and facilitating seamless collaboration.
Although discipline is not a one-size-fits-all approach, it can help create a work environment that encourages personal growth and accountability rather than solely relying on punitive measures.
In this deck, you will learn the significance of workplace discipline for organisational success. Youâll also learn
⢠Four (4) workplace discipline methods you should consider
⢠The best and most practical approach to implementing workplace discipline.
⢠Three (3) key tips to maintain a disciplined workplace.
[EN] Paradigm Shifts in Document Management | Dr. Ulrich Kampffmeyer | Hamburg 1999
1. Paradigm Shifts in Document
Management
Industry White Papers
Dr. Ulrich Kampffmeyer
P R O J E C T C O N S U L T
Unternehmensberatung Dr. Ulrich Kampffmeyer GmbH
Hamburg 1999
2. Paradigm Shifts in Document Management
Paradigm Shifts in Document Management
Von Dr. Ulrich Kampffmeyer
Geschäftsfßhrer der PROJECT CONSULT Unternehmensberatung GmbH
Managing Partner der PROJECT CONSULT International Ltd.
Mitglied des Executive Committee und des Board of Directors der AIIM Europe
Mitglied des DLM-Monitoring Committee der Europäischen Kommission
Inhalt
Introduction
Paradigm
Documents
Document management in the wider sense
A paradigm shift in document management?
Causes of paradigm shifts
User requirements are changing
Internet technology is revolutionizing document management
Document management becomes part of the infrastructure
Reactions to preserve the existing paradigm
Standards
Convergence of functionality and technologies
Product diversification
Market consolidation
The future of document management
The boom in 2000
Knowledge management - the new paradigm?
Information acquisition
Back to the source: recentralization
New user groups
An alternative paradigm:
Wll document management survive only as an organizational service?
Final remarks
To potential users
To the suppliers of document management systems
Introduction
Before you can address the question of âparadigm shifts in document managementâ,
you must first consider the individual components of this title more closely and arrive
at definitions: What is a âparadigmâ, what is a âparadigm shiftâ, what is a âdocumentâ,
and what is âdocument managementâ - has there actually been a âparadigm shift in
document managementâ?
Paradigm
⢠The original definition of paradigm
The term âparadigmâ originally came from the Greek and means an âexampleâ. The
term âparadigmâ generally means a structure presented as an example or a pattern.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 2 von 26
3. Paradigm Shifts in Document Management
In linguistics, a paradigm is an example indicating the declination of a noun or
conjugation of a verb or even linguistic units between which a choice is to be made in
a particular context (e.g.: He is standing here, there, up there, down there).
⢠The concept of paradigm in the philosophy of science
T.S. Kuhn introduced the concept of a paradigm into the philosophy of science to
describe a constellation of beliefs, values and methods which are shared and
accepted by the practitioners of a particular branch of science. In a particular area of
science, a paradigm comprises the general theoretical assumptions and laws on
which the theories of these paradigms are based. Newtonian mechanics or Einstein's
approach to physics are examples of scientific paradigms.
⢠The concept of paradigm shift
Thomas Kuhn characterized the dynamics of science as a cyclic process:
Normal situation-> crisis -> revolution -> installation of a new paradigm -> normal
situation -> ...
Processes can undermine a paradigm and precipitate a crisis. As a result,
mechanisms to preserve the existing paradigm come into effect. A profusion of
theories are then produced in this area of science. If a paradigm cannot be saved, it
will be replaced by a new paradigm as a result of a scientific revolution.
The economy also has comparable development cycles which make it possible to
transfer the concept of a paradigm shift to this area. A prerequisite for a paradigm is,
however, a closed, self-contained entity which uses its own methods and considers
itself to be an independent branch or discipline with respect to the âoutside worldâ.
Documents
⢠The conventional concept of a document
The concept of a document often denotes a text on paper but also has a connotation
of legality. Certificates, contracts and business letters are referred to as documents in
this sense. In Germany, for example, the legal character of documents is further
underlined by the stipulations of the Handelsgesetzbuch, the BĂźrgerliches
Gesetzbuch and other regulations.
In the English-speaking world, at least in the field of electronic data processing, the
term âdocumentâ has other connotations. Even the famous appendage â.DOCâ shows
that these are texts which have been created on a text processing system. American
suppliers of document management systems simply handle all files on an electronic
system as âdocumentsâ.
Even today, many potential customers think of document management systems as a
means of scanning in existing paper documents. Because of the archiving of list
output and other data from operative systems, this conception has changed little.
Only when files from office applications were stored was the concept of âdocumentâ
generalized to electronic documents with arbitrary contents.
⢠Documents on an electronic system could be almost anything ...
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 3 von 26
4. Paradigm Shifts in Document Management
Today, the contents of electronic documents could be practically anything:
Files, facsimiles, list output, digitized speech, digitized videos, frozen frames,
protocol data or any combination of these
Basically, anything on an edp system that is a file or a well-defined component of a
file in a structured or unstructured form and which, at a particular point in time, can
be considered to be an authentic entity, consistent both from the point of view of
content and formally, is a document. Electronic documents have to meet stringent
requirements as data can be modified in a variety of ways on edp systems. They
must precisely reproduce the status, composition, form and content which they had
at the time of their intentional creation. Dynamic links, automatic updates in
documents, modification of the context, composition of documents from separate
components, the dependence of formats and run-time environments and other
factors mean that systems for administrating documents of this kind have to meet
special requirements.
Many suppliers, therefore, back a special form of electronic document. Not only is the
content stored simply as a file, but also a document object which contains all the
descriptive features and management information necessary for finding the
document, restoring contexts and reproduction.
This approach has already been adopted in the past in standards such as ODA/ODIF
or DFR, but these standards could not establish themselves on the market however.
In SGML, the field of structured text documents has a standard which, thanks to
HTML, is currently experiencing a renaissance. Last but not least, object-oriented
software development environments are reviving the idea of the self-descriptive, self-
contained document object.
⢠Electronic documents and digital signatures
Digital signatures endow the concept of a document with a special quality.
The digital signature is a security standard for the exchange of electronic documents
and guarantees the authenticity of the sender and the integrity of the contents of an
electronic document. A digital signature is intended to have the same legal force as
the signature on a paper document. In Germany, the âSignaturgesetzâ (Signature
Law) has created a basic legal framework for one digital signature. The Signature
Law, however, does not preclude the use of other methods for digital signatures.
The digital signature defined in the Signature Law is generated with a private key
which is known only to the key owner and a public key which is managed by
certification bodies and is then attached to an electronic document. The sender signs
and encrypts electronic documents with his private key which is stored on a chip
card. The recipient only has access to the public key but can open and read the
document. He also receives information about the sender and about the authenticity
of the document contents.
The public key can, therefore, be used to check a signature and any modification to
the signed document is obvious immediately. The public key is certified by authorized
bodies. Certification bodies store the data which is required to identify the owners of
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 4 von 26
5. Paradigm Shifts in Document Management
private keys. It is, therefore, possible to discover the identity of the owner of a private
key via the certification body.
Italy too has implemented an approach which is similar to the German Signature
Law. This law puts digital signatures and conventional signatures on the same legal
footing. This law contains only enabling legislation and regulations - there are no
technical descriptions of the procedure and consequently no certification. In Europe,
other approaches are at present being adopted by countries such as France and
Great Britain, etc. Attempts are being made to harmonize these approaches within
the European Union, the German approach being used as the basis. The OECD has
published eight basic principles relating to digital signatures and the UN has
developed a âmodel lawâ to promote the standardization of further international
activity in this area.
As the identity of the sender of a document with a digital signature is only indirectly
guaranteed - a situation comparable with the misuse of EC cards and the card owner
denying the removal of funds from his account - the âdigital identityâ of a document
encompasses procedures with which a card owner himself can identify himself using
his card, e.g. by examining his finger prints, or similar features, which are can also be
stored as a private key on the card.
Files with digital signatures are increasingly being accepted as originals - they are on
their way to being recognized by the law. This means that contracts can be
completed without paper originals, orders made and other business conducted. The
digital original is, therefore, a decisive breakthrough for document management. New
user groups are opened up and new storage and management requirements for
these documents have to be met. Restrictions of the past when a scanned facsimile
or the reconstruction of an electronically generated letter from the data could only be
treated as a copy of the original, have been overcome by documents with digital
signatures which represent entirely authentic originals. When the legal and technical
uncertainties that still exist have been removed, the digitally signed document will
become the principal foundation of E-commerce on the Internet.
Document management in the wider sense
A number of implications for the concept of document management flow from the
definition of âdocumentâ, given previously. Today, it is the term used for the whole
range of DMS (Document Management System, EDM Electronic Document
Management) suppliers and their numerous solutions.
With the increasing overlap and integration of the different document management
technologies, the term is also being applied to other systems and their interaction as
well as to classic document management. These other systems are:
⢠Document imaging
Scanning, displaying, printing, and managing facsimile documents
⢠Electronic archiving
Archiving data, images and/or list output, with database-supported access, remote
storage, auditability
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 5 von 26
6. Paradigm Shifts in Document Management
⢠Document management in the narrower sense
Management of files or file documents in electronic systems with control mechanisms
for version management, composite documents or check in or check out
⢠E-forms
Electronic forms for the entry, display, publishing, and management of variable
information
⢠Output management
Creation, management and print output for professional printing
⢠Office communication/office suites
Individual modules like word processing, spreadsheets, graphics, databases,
calendars, mail, and fax, with active control by the user
⢠Groupware
Cooperative working, database-supported data and file administration, replication,
group functions such as calendar and mail, linkage and integration of individual
components
⢠Workflow
Structured processes, status and action monitoring, rule-based control, CI and NCI
document processing, controlled forwarding of documents and procedures
There is almost no limit to terms such as âmulti-media databasesâ, âdocument
warehousesâ or âknowledge managementâ which can be added to the list. However,
delimitation and classification are becoming increasingly difficult due to the creativity
of the product and marketing managers.
Terms like âdocument managementâ or âworkflowâ which are the habitual choice of
suppliers no longer create any interest. They are clichĂŠs which have actually taken
on negative connotations to some extent; they are associated with large, complex
and expensive projects. On the other hand, they mean nothing to a broad range of
new potential users. Major companies have now reached the stage where they think
that they have enough information about this topic. This is also shown by a drop in
interest for congresses and seminars, for example. However, it must be stated that
frequently neither of the user groups that have been outlined has a clear idea of the
implications of the use of document management. The organizational dimension,
implementation in the company, is usually underestimated or even ignored.
In the past, the document management sector, every supplier, put a lot into informing
- you could even say educating - potential users. This investment is, however, being
nullified to an ever greater extent by a plethora of differing terms and definitions, by
the lack of any clear delimitation from other topics and in the emergence of new,
interesting trends such as the Internet. Describing existing technologies with new
buzz words like âintegrated document managementâ, âenterprise document
managementâ or âknowledge managementâ will not work. The products must meet
the requirements which are becoming more exacting and a coherent image must be
presented on the market.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 6 von 26
7. Paradigm Shifts in Document Management
A paradigm shift in document management?
The crucial question is: Are the developments on the document management market
so crucial, so radical, that the use of the term paradigm shift is justified?
To answer this question, we must first take a brief look at the history of document
management. First of all came special solutions - such as the use of digital optical
disks which could only be written to once - which were not compatible with
conventional magnetic-disk-oriented operating systems. The development of optical
filing started in the early 80s. Systems which introduced uncoded information, and
scanned facsimiles into the system worlds which were previously purely data-
oriented were a parallel development. This created the discipline of âimagingâ.
FileNET was the first to go a step further and turned imaging into workflow by routing
and distributing uncoded information.
Special applications such as electronic archiving, COLD, forms processing, OCR/ICR
and others developed from the approaches of the 80s. The 90s saw the emergence
of âclassic document managementâ, the handling of files from file systems, ad-hoc
workflow to compensate for the inadequacies of conventional E-mail, and solutions
such as groupware. At first, all these approaches were stand-alone applications for
special tasks. They provided solutions for problems which conventional operating
systems and operative systems like business applications could not handle. Using
the tools for these products, independent, specific applications were then developed
with the objective of managing, using, visualizing and storing data and documents.
Frequently, however, they ran parallel to applications in which data and documents
were generated and processed. If common usage of information was required,
existing applications of this kind would have to be integrated to an ever greater
extent.
Technological innovations of recent years like the Internet and the integration of
document management functions into operating systems, business application
software and tool boxes mean that document management system manufacturers
now have to take difficult decisions crucial to the survival of products, companies and
an independent document management sector. On the one hand, document
management products have reached maturity, but on the other hand their
independent existence is under threat from new trends and developments.
Reason enough to be thinking in terms of paradigm shifts.
Causes of paradigm shifts
If you follow Thomas Kuhnâs approach, the causes of a paradigm shift do not always
occur in the sequence ânormal situation - crisis - revolution - installation of a new
paradigm - normal situationâ. This sequence from science applies to processes of
change that are intrinsic to a system.
With our paradigm shift in the world of document management, it is primarily external
causes which play a decisive role. In this case, the events âcrisisâ and ârevolutionâ
coincide. The crisis arises because too many suppliers do the same thing with their
products - in a market with long-term consequences such as the storage of
information for decades - a high decision risk for the potential user. In contrast with
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 7 von 26
8. Paradigm Shifts in Document Management
the situation with operating systems, with large business applications or with office
applications, where a handful of major suppliers are relied on for a certain measure
of product reliability and future product availability, the number of suppliers of
document management products is simply too great. Even the totality of all
developers of all DMS suppliers does not reach the potential which is provided by
major software companies for the further development of products. Anyone who
continues to just specialize in electronic archiving, is by definition hanging a mill
stone around his own neck, as the availability of data and documents is to be
guaranteed for decades.
This means that the DMS sector is simply running after the major trends - in the case
of integration projects, it is customer-driven, when it is adapting to operating systems,
standard applications and platforms, it is other software companies that are calling
the tune. This continuous pressure from the customer and the competition is one of
the factors that causes the crisis of the existing paradigm. There are only isolated
signs of a revolution originating in the document management sector itself that will
provide the impetus to make a leap forward. It seems rather as if the innovations and
independent features of the DMS sector are being used by others and that the store
of distinguishing features which define the sector is continually being diminished.
Even though the products are becoming even more reliable, even more multi-faceted
and rich in functions - breakthroughs which could secure survival as an independent
sector are few and far between. There are plenty of opportunities: for example, E-
commerce, documents with digital signatures, the combination of information from a
wide variety of sources to obtain knowledge management solutions or opening up the
content of uncoded documents. Only when terms like âdocument warehouseâ,
âmanagement information systemâ and âknowledge managementâ can be backed up
with practical products, can a new paradigm be established. In economics, the
situation differs from that in science as the end of a paradigm shift process can also
result in the complete disappearance of a paradigm as an independent entity - not
necessarily the appearance of a new paradigm.
At present, there are three factors determining the paradigm shift which are
especially important for the document management sector:
User requirements are changing
When document management solutions were overcoming technical inadequacies in
software and hardware systems that were already in use, and it was also possible to
obtain competitive advantages from the one-off use of a technology of this kind,
island solutions were acceptable. An electronic archive could operate independently
alongside groupware or alongside an operative host application.
The time of island solutions is nearing its end.
Nowadays, the user does not want to constantly change between windows to find
information. He is no longer willing to click through confusing file trees which, in the
final analysis, merely represent an inadequate, monolithic paper store. The user does
not want to have to think all the time âIs this message an E-mail in the E-mail
directory or is it a fax on the fax server or has it come from the Internet and is now in
my Compuserve download directory - and where is the reply: in the secretaryâs
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 8 von 26
9. Paradigm Shifts in Document Management
directory, in the entry cache or already in the project directory under protocol
annexes?â The idea of a standardized in-basket for mail with an automatic document
database system in the background is now arousing considerably more interest than
the questions âHow do I scan a document into an imaging systemâ or âNow do I store
on TrueWORM or SoftWORMâ. Basically, the user does not want any additional, let
alone any separate systems. Access to the correct document should be automated if
at all possible and should be performed in its usual software environment from an E-
mail program, a text processing program, a business application or from an office
automation system.
In this context, two concepts, âenablingâ and âengineâ, are playing a more and more
significant role.
As far as enabling at the client level is concerned, only the document management
functionality is integrated into an existing software interface. The existing software
environment can now handle, search for and find documents, display, classify, send
and print them out. By importing from the enabling module, a document can be
processed further.
The âengineâ on the other hand is on the server, or rather at the service level. It is a
service which other applications use to manage and to store documents. Basically,
the user is not aware of it and can keep within his usual environment. If an engine of
this kind is to be used, the availability of standardized interfaces is of critical
importance.
Even if enabling and engines provide the user with documents in the environment
that he is familiar with, one of the most important user requirements is not met - a
facility for finding documents. Everyone is talking about search engines, but what the
user really needs is an intelligent âfind engineâ which will help him find even âmislaidâ
documents, will help him to link features and contents and adapt to his way of
working. The development trend for databases is increasingly tending to constrict
intelligent document management. Neither conventional SQL databases nor
conventional full-text databases will be able to meet requirements. As the document
management sector generally uses retrieval systems from third-source
manufacturers - a few exceptions prove the rule - again, it would seem that the
necessary breakthrough is more likely to occur outside the existing paradigm of
document management.
The requirements of the user exert a permanent pressure on the manufacturers of
document management software. As this pressure always exists, it cannot be
equated with the ârevolutionâ of the Kuhnian paradigm shift. In turn, customer
requirements are changes, only an imitation of technological revolutions, which occur
outside the paradigm of document management. In this case, the suppliers are
frequently addressing only the effects of the revolution and not its causes.
Internet technology is revolutionizing document management
The true revolution for document management is the Internet.
IBM mastered and controlled the first paradigm of electronic data processing.
Centralized systems also permitted the exchange of information in closed user
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 9 von 26
10. Paradigm Shifts in Document Management
groups for the first time. However, the technology had no provisions for document
management. On the other hand, it did provide the stimulus for a few innovative
companies to develop new solutions.
The first paradigm shift in edp technology was the PC which began to supersede
mainframes in the 80s, free users from the restrictions of character-oriented terminals
and, networked as client/server solutions, created a gigantic market for the
subsequent software industry. It made graphical user interfaces and the plethora of
software products with which we are now familiar possible - not to mention the
games industry. There is no doubt who the winner of this era was: Bill Gates. The PC
and its technological possibilities has made its mark on the document management
industry. PC networking laid the foundations for workflow, groupware and classic
document management as we know it today.
The second major paradigm shift that had a comparable, if not greater, global effect
was the Internet. The Internet democratized information - it can be accessed any
time anywhere on the globe. This aspect is more important than the role of the
browser. Although the browser provides a standard user interface - as long as one
supplier does not have overall control of the market - the development of browsers,
and so the various ways in which information is presented, will readily go in different
directions. Even though the Internet is a free, unstructured, networked and distributed
infrastructure, it has given birth to a new latent trend - recentralization.
Not only did the Internet shock directly affect Microsoft, it also hit the document
management sector. âA free browser to view documents? - No, thatâs impossible, our
full-function document imaging viewer client costs $ 1000 per workstationâ. It was not
too long ago that statements like these were being made.
Accessing a standard document management system with a browser is something
that almost any supplier can now do. The challenge is elsewhere. The Internet also
saw the creation of a new document concept, networked pages with moving
graphics, links and, depending on the environment and user attitude, with different
representations. The concept of a static document as exemplified by scanned
facsimiles, was of no interest to the creators of the World Wide Web. They focused
on content and not on form. Thinking about how easy the information on the Internet
was to change made the legal expertâs hair stand on end. At present, it is almost
impossible to imagine that these documents could provide legal proof or be used as
a legal document. If the legislature had problems with scanned documents, they are
now facing a much greater challenge.
The Internet has also seen the creation of new ways of capturing information,
âcrawlersâ, âspidersâ, âagentsâ, âself-optimizing search enginesâ. These systems were
developed to help cope with the chaos caused by an overwhelming supply of
information. They differ fundamentally from the beautifully ordered structures of
document management solutions where the management systems knows at any time
the location and status of a document. Internet search engine approaches are only
haltingly finding their way into conventional DMS products. True Internet document
management systems, whether it be Intranet or Extranet, are however unthinkable
without new approaches of this kind to capturing information.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 10 von 26
11. Paradigm Shifts in Document Management
Essentially, the Internet is the Kuhnian revolution which is causing the paradigm shift
in todayâs document management sector. As it is not yet clear who will emerge
victorious from this era which is only just beginning, the document management
industry still has a sufficiently large playing field to compete on.
Document management becomes part of the infrastructure
Apart from the continual pressure from customers and the competition, apart from the
technological and intellectual revolution that is the Internet, there is a third force
which will determine the future development of the document management industry.
It is not as obvious as the Internet, a true innovation. You could say that document
management is being taken over by stealth.
Document management is losing more and more of its unique selling points (USPs).
A example to illustrate three important aspects of this takeover.
⢠Integration of document management functionality into operating systems
At the start of their development, as has already been outlined above, the
document management sector based their existence on being able to put âdifficult
document typesâ like faxes onto edp systems or digital optical storage media,
which by their very nature were not compatible with the dynamic, magnetic-disk-
oriented operating systems. Many of these functions have now already been
transferred to operating systems or additional standard services. On the client
there are free viewers for the documents and hierarchical storage management
systems (HSM), also managing jukeboxes with write once optical memory, are
integrated on the server side. New services like resource directories solve the
problem of independent, user management facilities which also have to be
maintained.
⢠As the inadequacies of hierarchical file managers are no secret and conventional
directory structures are already becoming a problem in smaller organizations
because they do not provide a clear overview, it seems likely that, in the short-
term, the basic technologies of document management such as database-
supported management, virtual directories in which multiple visualization of a
document is possible in spite of single storage and mechanisms like check-in or
check-out, will soon be found again in an environment which is like an operating
system. Although these solutions will not be capable of satisfying all the
requirements of major users who now use classic professional document
management systems, a large number of users will back the standard products as
they are practically being given away in the price of the package together with the
operating system from the leading software suppliers. It is only a question of time
before programs like Outlook, in combination with Back-Office-Services or Lotus
Notes Domino, develop into a complete document management system in the
narrower sense - and also provide the advantages of a general functionality that is
thought of in wider terms. This puts great pressure on suppliers who have made
this market segment their only specialization.
⢠In the future, the same will apply to E-mail. Today, it is usually still the case that
when a message is sent, it is no longer possible to exert any control over what
happens to the content of the message or the attached documents. Future
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 11 von 26
12. Paradigm Shifts in Document Management
versions of E-mail will be more like current ad-hoc workflow products. In this case
too, initially only simple tools which do not meet the special requirements of true
process control should be expected. However, they will exert a considerable
pressure on the suppliers of straight workflow tools due to the ongoing integration
with other office applications, âdelivery in the same boxâ as the basic software and
their wide distribution.
Integration into business applications
⢠While the standard functions which have been integrated into the operating system
or back-office threaten only the âsimple solutionâ market, the danger for
professional, large-scale solutions in the field of classic document management in
the narrower sense, and for the workflow suppliers is from large software system
providers, whether they are called SAP, BAAN, IBM, Computer Associates or
something else. Their software systems are applications which manage and
process the critical business data of companies. They provide the interface of
habitual use for most office workers. Only functionality that permits document
display or that allows documents to be passed on to subsystems for storage or to
be called from subsystems must be added on to these products. Most of todayâs
applications already have document management and workflow functionality -
even if these concepts are not mentioned explicitly in advertising brochures.
Because of the competition to push rivalsâ large, standard software applications
from the market, these suppliers are integrating the whole range of document
management functionality to an ever greater extent.
⢠It is, therefore, becoming increasingly difficult for DMS suppliers, say, to establish
a parallel workflow system alongside an operative system of that kind if all critical
data, the work procedures or the central user management are implemented in the
business application system. This only succeeds if the users employ other
platforms or environments which are to be integrated by workflow or groupware in
addition to the operative business or legacy application.
Database systems
⢠There is a further challenge from suppliers of databases and special search
engines. Today, databases are used by the document management sector to
manage documents in separate repository or library systems via pointers. These
are referred to as index or reference databases. The main arguments for using this
architecture were the large quantity of data and documents that often needed to
be stored, the scalability of the servers and the high cost of magnetic disk storage.
⢠Databases are now capable of storing even documents in their own structure and
the reorganization, scaling and performance problems associated with these
systems are not far from being solved, be it by means of new software strategies
or simply through the availability of more powerful hardware. When dynamic
documents, which are still subject to modification and are even generated digitally
in the software applications, are managed, they play an increasingly more
important role. It does not matter whether they are used as a stand-alone system
or as a groupware component like Lotus Notes. This development has already led
to a differentiation of the concept of an archive system. One now refers to a
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 12 von 26
13. Paradigm Shifts in Document Management
dynamic store and a static long-term archive. Only when large quantities of data,
distributed solutions and the previously referred to class of archive systems are
involved, will the reference database architectures remain significant in the long-
term. As far as dynamic stores are concerned, the databases themselves take
over the management of documents. As the DMS sector is largely dependent on
management and search engines of this kind from third-source suppliers, the
market threat comes from the partner one has selected oneself.
Reactions to preserve the existing paradigm
Naturally, no discipline simply âfoldsâ under a threatening crisis or revolution. This
also applies to the document management sector. Initially, its reaction is drawn from
within the existing paradigm, before it gets to grips with a âleap forwardsâ. The
attitude of the sector can be gauged from the large number of articles that have been
published. To quote just one example, this can be seen in share prospectuses from
suppliers who have recently ventured onto the stock exchange. All the statements
about the growth and direction of these companies are confined to the existing
paradigm - new approaches that would break the mold are expressed in terms of
buzz words which conceal the lack of current products and vision of any kind. This
applies not only to the suppliers that have been referred to, but also to many others.
Under these circumstances, it is sometimes easier for companies which are not
solely fixated on document management as the existing diversification provides a
greater potential for future developments. Innovation itself, or in Kuhnian terms
ârevolutionâ, is brought about by small, new companies which are not held back by
the inertia of large enterprises or by the âbaggageâ of existing solutions.
How successful suppliers react to the paradigm shift? We will now discuss four
important aspects:
Standards
Standards often stipulate the lowest common denominator or the âstate of the artâ.
When they are completed, they are frequently overtaken by new developments. DMS
standards like ODMA were only finally accepted because they were backed by
Microsoft, a leading software supplier - naturally without stopping its own proprietary
developments for a standard of this kind. A standard like the one relating to TIFF
compression for group 4 faxes could only establish itself because every fax machine
in the world operates on this principle. Standardization was effected by the
telecommunication industry and not by the document management sector. The
implementation of the sectorâs own standards, for example the WfMC Workflow
Management Coalition or the DMA Document Management Alliance is under threat
before they have even been completed. For the same functionality, simple, Internet-
based standards like JFLOW or SWAP are being created on topics such as workflow.
They do not have the same depth or comfort as the âmajor standardsâ, but do,
however, increase the pressure on standardization bodies to not only finally complete
their work at long last but also to address new technological developments. At
present, it is not easy for the standardization bodies for the document management
sector to embrace such independent aspirations of that kind again. Even the creation
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 13 von 26
14. Paradigm Shifts in Document Management
of codes of practice that stipulate how, say, documents should be archived or
exchanged contribute to the consolidation of the existing paradigm.
When it standardizes its products - of critical importance for further modularization
and interoperability - the sector exposes itself to pressure from the large software
suppliers. SAP has no problems pushing through a proprietary standard like
Archivelink. Platform suppliers like Microsoft or IBM/Lotus will always tailor their
products and interfaces to suit their own requirements - they will take no interest in
the requirements of âsubordinate subsystemsâ such as electronic archiving.
Standards therefore âcut both waysâ for the document management sector - on the
one hand they can impede technological progress but on the other they are essential
for survival as they at least ensure inclusion as a service or module in larger
solutions.
Standards are also an indication that document management actually exists as an
independent phenomenon or paradigm. For the document management industry,
they are analogous to the independent methods of a science.
Convergence of functionality and technologies
One reaction to the pressure of competition, customer requirements and the new
technologies is to enhance the functionality of products. If there were once
specialized solutions for list output archiving, facsimile archiving, records
management, document management in the narrower sense, workflow etc., the
characteristics of these products have now merged and are even supplemented by
functions from office communication.
On the one hand, this occurs through the further development of existing products.
The functionality of workflow is enhanced with archiving and document management,
E-forms develops into workflow, workflow integrates archiving, archives are
enhanced with multi-media functionality etc. The aim is to support the whole life-cycle
of documents, the acquisition, processing and representation of all forms of
documents, data and objects. Also included is the consideration of all imaginable
checking, forwarding and control functionality. Functions which were previously
independent applications, like say fax, E-mail, text-data integration, text template
management, groupware functionality and so on. Increasingly, functionality of this
kind is being directly integrated into DMS products - unfortunately it is sometimes
ârediscoveredâ, instead of existing, widely-available products being used. The latent
reasons for this development are, say, fundamental strategies like âonly one
incoming mail basket â for all types of application and document from conventional E-
mail through Internet, fax and voice-mail to production workflow.
An extension of this strategy is the creation of âsuitesâ, in other words combining
existing products to form a single product. Then they only have a single client not one
for each subapplication. There is just one user management facility which is used
across the board for Workflow, Archiv, COLD and DMS. Suites are an approach
particularly favored by large suppliers like IBM or FileNET, but also by newcomers on
the market such as PcDOCS. Other suppliers prefer to buy in modules and products
to extend their own portfolio. However, these approaches are often difficult to
implement. This is especially so when products with different architectures and
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 14 von 26
15. Paradigm Shifts in Document Management
approaches to use are to be combined. Frequently, therefore, these suites do not
have the character of self-contained products - instead they must first of all be
combined by integrating and combining a variety of modules to create a solution
which is again individual in character.
The prospectuses of suppliers are now overflowing with add-on modules, add-on
functionality and options. Increasingly, the user is deprived of a clear overview and
the standards to make an assessment, as products are becoming more and more
similar as far as function range is concerned. The suitability of the implementation
partner and his experience- âsoft decision-criteriaâ -are becoming more important
than straight product functionality. The future-proofness, modularity, migration-
proofness and simplicity of maintenance of products are gaining in importance as
yardsticks.
Product diversification
At first glance, the trend towards product diversification seems to run counter to
product convergence. At present, a variety of strategies can be observed on the
market.
Specialized engines and services
⢠Some suppliers are going increasingly for specialized services like workflow
engines or archive-system servers which can be integrated into other applications.
Using standardized interfaces, they perform specialized tasks so that the
manufacturer of a standard application does not have to do the programming
himself. They are a response to the pressure exerted by business software
packages and, in the meantime, have covered the whole sector for standardized
application software packages.
Component ware, tools and kits
⢠Other suppliers back the programming of highly specialized functions and modules
which are integrated directly into applications. Now, modules of this kind are to be
found in almost all products from document management software suppliers.
There is hardly a supplier of a âmajor productâ who still programs the drivers for
jukeboxes and scanners or image enhancement algorithms themselves. The
manufacturers of these tools, on the one hand, cover the requirements of the
document management sector itself but on the other have expanded their
business into all areas of software development a longtime ago.
⢠As they are easy to integrate, say as VBX modules, Applets or libraries, they make
it possible to rapidly âcobble togetherâ a solution using rudimentary resources.
Professional suppliers are often confronted with âgarage solutionsâ of this kind and
have a difficult time arguing the case for their professional solutions which have
taken years to develop and arguing against these âquick fixesâ. Basically, any
professional user, the âpower userâ, can nowadays install components of this kind
in his programs himself. However, entrusting the knowledge base of the company
and company documents to solutions of that kind is more than questionable.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 15 von 26
16. Paradigm Shifts in Document Management
Standard products âoff-the-shelfâ
⢠Several producers of DMS software products back standard solutions which are as
easy as possible to install, do not require any adaptation and which can be
marketed in large volumes via retailers and other partners. The objective is to
maximize market share. Frequently, the problem with products like this is that they
will run on only a few platforms, are difficult to integrate into existing environments
and usually have scaling problems. Usually, they are typical island solutions,
independent products with their own clients for a defined purpose. Although this is
not the objective of the suppliers, effective quality assurance and software
development management, simple installation by third parties that are frequently
unknown, the variety of possible configurations, software environments that are
already existing at the clientâs site and numerous other factors give the product a
degree of closure to guarantee stability, availability and data security.
⢠This type of product, often originating from medium-sized companies, will be under
threat if very large software suppliers decide to enter this market or if the range of
functionality in the operating system and basic software range becomes so great
that that no additional, independent software is required.
High-performance or production systems
⢠However, most of the sector is focused on high-end business. There is a marked
differentiation between the low end with its standard products and business which
tends to be more integration-oriented. The latter has its sights on major users
where, from the outset, document management has to be integrated into software
systems that are already in use. A typical feature is production workflow which can
be used to implement complete sets of business applications. Or the list output
and data archives of millions of transactions and thousands of reports in computer
centers. As far as functionality, security and maturity are concerned, these
systems are optimal.
⢠With solutions of this kind, only a tiny fraction of income is earned from software
licenses. Approximately 90% is project and integration costs. This type of business
however assumes that stable basic products can be created separately from
application development. When product development and application development
become entwined, not only does dependency on the system and idea world of a
few major customers threaten, but there is also a negative effect on both branches
in relation to version management and further product development. Even
marketing through partners can come to grief if an approach of that kind is
adopted - whenever the âbeautiful, large projectsâ have to be implemented by the
software producer himself.
Market consolidation
A further reaction to the âcrisisâ and the ârevolutionâ in relation to the paradigm of
document management is increasing market consolidation. There are a number of
variations - not least in relation to the product strategies that were described
previously. Consolidation concentrates power, splits the market and rounds off
product portfolios.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 16 von 26
17. Paradigm Shifts in Document Management
Company takeovers and mergers
⢠The round of company takeovers continues. The most prominent merger of the
year was that of Fulcrum and PcDOCS. Takeovers have a variety of objectives.
Firstly, the strengthening of development and marketing resources - the market for
programmers and system consultants in the DMS sector has almost been swept
clean. Secondly, the aim of combining products to create new offers. A third not
unimportant aspect is to increase the customer base and market presence.
⢠Company takeovers do not always have to be successful. The risk of failure is
particularly great when companies with different cultures and national background
are brought together. This is exemplified, for example, by a case from the storage
system sector, the failed merger of ATG, France and Cygnet, USA. Other
suppliers of DMS solutions have had, and continue to have, integration problems
too. Not only does this affect employees but also the products that are to be
integrated into new solutions.
Capitalization on the share market
⢠Currently, many DMS suppliers are raising the necessary capital for company
takeovers by going to the stock exchange. The objective of the majority of
companies is to reach an adequate size to ensure that they survive the ongoing
market purge. The strategy of taking sales abroad and creating subsidiaries to
guarantee the high expenditures for the preliminary finance of an international
business is also part of the approach. In Germany and the USA, the trend for stock
exchange floatations continues unabated.
Partnerships
⢠The producers of software have a strong preference for cooperation with system
integrators who implement projects on the basis of products. It is only in this way
that they can finance their own development and obtain a satisfactory market
share. Winning over sales and integration partners is therefore currently one of the
most important tasks for product suppliers. It will be difficult for companies which
are only now coming up with a product to find suitable system integrators. As there
are still only a few functional differences, the integrators who have invested heavily
in training their employees, and who often are already capable of placing solutions
with their customers, will only change over to a new product if there are problems
with the old one or if the new product had such distinctive unique selling points
that it would open up new groups of purchasers.
Reducing the number of suppliers and range of products
⢠Even today, there are signs that many existing own software solutions are
disappearing from the market. Former software producers are going over to the
integratorsâ camp. In spite of the plethora of brand names, the number of
independent products is going down because many suppliers have OEM versions
in their program - the software is simply offered under another name. In spite of
the stream of new suppliers, the market is concentrated on a few products which
have a long-term chance of seeing off the competition thanks to their
professionalism, interfaces, good marketing and an adequate installation basis.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 17 von 26
18. Paradigm Shifts in Document Management
This concentration is, amongst other things, an indication that the DMS market is
mature.
⢠As well as its positive effects, the market purge also makes potential customers
insecure: âWhich product will survive?â This question can never be answered with
enough certainty, particularly when arguments for a 30 year storage period for
documents are proposed. This can affect both large and small suppliers. The
question must, therefore, be reformulated: âWhich products have an architecture,
interfaces and information storage that is so open that you can migrate at a later
date to other systems without any problems â.
The future of document management
In view of the plethora of changes within the framework of the paradigm shift that has
been sketched, you could be left with the impression that there are nothing but
problems in the document management sector. This is not the case.
The professional products are stabile and mature. They are economic to use. They
increase user efficiency and competitive advantages. There are sectors where
business survival already depends on the use of these technologies - the only thing
to be decided is the system variant.
One must ask in what direction will the sector develop, will it present as unified an
image as it does today?, which paradigm will replace the one that now exists?
On this topic a few thoughts about the challenges which the document management
industry - and the user - will have to face in the coming years.
The boom in 2000
The DMS sector is preparing for the great boom.
Now, many budgets and resources are being blocked by the millennium problem and
there is also the introduction of the EURO in Europe. There are uncertainties in
relation to strategic IT decisions - for example âDo I fully back the Intranet?â, âIs
client/server the right solution?â âDo I have to integrate host, C/S and Intranet?â, âDo I
go for object-oriented languages?â, âIs Corba or COM+ the right middleware?â - it will
be possible to arrive at a clearer assessment of all these questions in the near future.
Consequently, there will be nothing to stand in the way of the introduction of archive,
groupware, workflow and document management solutions.
Many companies want to participate in this boom and new companies with new
products are continually jockeying for position. However, it is already clear that
suppliers that have already established themselves and that have an adequate
number of references and the appropriate experience, will win the race.
At present, the greatest risk for suppliers is the scarcity of qualified consultants,
system integrators and application programmers - a decisive drawback for any new
supplier in the market. Bottlenecks like those associated with SAP in recent years are
in the offing. Recruitment from other companies and retraining cannot be the only
response to the problem. A new pool of employees must be built up methodically.
Universities and polytechnics are not able to satisfy the sectorâs demand and âoutputâ
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 18 von 26
19. Paradigm Shifts in Document Management
of âinformation managersâ, a relatively new field of study which has a relatively strong
focus on the DMS sector, is but âa drop in the oceanââ.
Knowledge management - the new paradigm?
Transforming todayâs collections of information and documents into productive
knowledge is the challenge that has to be met as the new millennium begins. Modern
document management systems already manage in part all kinds of information - for
example color images, video, speech, graphics, text, data, E-mails, host output,
faxes etc. and so are a companyâs âstore of knowledgeâ. Knowledge management for
the purpose of handling and increasing company knowledge, however, goes far
beyond the storage and organization of structured and unstructured information.
Knowledge management not only means the application of new technologies to
intelligently âtap intoâ the content of documents, but also the involvement of users
and processes.
Knowledge management is, therefore, much more than conventional document
management or data warehousing. It encompasses more than just the contents of
individual documents. An essential feature is that relationships between contents and
their compression are taken into account. The solutions are getting nearer to the
claims made for knowledge-based systems and expert systems of the early 80s.
A variety of definitions
As knowledge management describes a new type of software system, there is a wide
range of definitions - some of which even contradict each other. The following
examples will make this clear:
⢠Gartner Group:
Knowledge Management: A discipline that promotes an integrated approach to
identifying, capturing, evaluating and sharing all of an enterpriseâs information
assets. These assets may include databases, documents, policies and
procedures, and previously uncaptured tacit expertise and experience in individual
workersâ.
⢠CAP Ventures:
Knowledge Management encompasses management strategies, methods, and
technology for leveraging intellectual capital and know-how to achieve gains in
human performance and competitivenessâ.
⢠Delphi:
Kowledge is the information resident in peopleâs minds that is used for making
decisions in unknown contexts. Knowledge management in turn, refers to the
practices and technologies that facilitate the efficient creation and exchange of
knowledge on an organization-wide level to enhance the quality of decision
making.â
⢠KM World Journal (Knowledge Management World):
âKnowledge Management: The strategic application of corporate and external
information bases to discover transactionable knowledge that can be leveraged to
improve business performance.â
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 19 von 26
20. Paradigm Shifts in Document Management
⢠PROJECT CONSULT:
Knowledge management systems are software solutions providing features to
create, capture, process, organize, store, control, retrieve, distribute, and
reproduce any type of structured or unstructured digital information of an
enterprise with the ability to provide in-time information with respect to purpose,
description, content, structure, context, rules, and procedures for decision making
and knowledge building tasks of any user of the system.â
Looking at these definitions, you have to concede that the majority of the systems
placed on the market do not satisfy the requirements. The term âknowledge
managementâ is, therefore, often simply misused as a âlabelâ. Many users and
suppliers do not understand that knowledge âjust isnât out there somewhereâ - it is the
product of a number of complex processes.
Who occupies the concept of knowledge management?
⢠The question is - does the document management sector have any chance at all
of making the concept of knowledge management its own with its current
products?
⢠On the one hand, documents represent a new source for knowledge management
systems - on the other they are frequently just more information to be added to the
data compressed on expert systems, management information systems (MIS) or
data warehouses. There are already initial solutions on the market - for example
analysis tools and MIS solutions are combined with document management
systems. In this case, however, the document management system is usually only
the supplier of additional information.
⢠The document management sector defines its concept of knowledge management
as a collection of all its previous, different system types. To have integrated
knowledge management, all information, no matter what the origin, must be
acquired, administered and stored in an all encompassing manner. Company-wide
knowledge and document management integrates the whole knowledge base and
all of the companyâs products and applications and allows authorized users access
on a need-to-know basis.
⢠Many aspects of knowledge management - but by no means all - have already
been covered by existing solutions. Acquisition, management, distribution and
other components belong to the standard delivery scope of modern DMS
solutions. However, an area that is often deficient is that of new acquisition
strategies which help the user to get the right information at the right time from his
large archives. The standard functionality of conventional document management
systems often already provides the basis for knowledge management solutions:
⢠Retrieval functions, the common use of information and push strategies to filter
information on the Web.
⢠E-mail, routing, discussion databases, distributed document management and
electronic archives as background storage.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 20 von 26
21. Paradigm Shifts in Document Management
⢠Groupware functionalities which support cooperation and the common use of
the knowledge base within the company or between different companies
⢠Workflow forms the basis for the dissemination of knowledge via business
processes and the best distribution and control methods.
⢠Large suppliers like Microsoft, IBM, Lotus or Netscape are now building many
basic elements for managing an organizationâs documents or knowledge directly
into their products. They are, therefore, already in competition with the traditional
DMS suppliers. However, these solutions alone do not meet the requirements of a
true knowledge management system - specific applications have to be added on.
Products which have been designed at the outset for knowledge management
originate from new companies like BackWeb Technologies, CompassWare,
DataChannel, GrapeWine, Intraspect, KnowledgeX, SageWare, Semio, Thinking
Machines, WinCite, WisdomWare and others which are hardly known in Germany.
Often their approach is based on Internet-compatible solutions. Until now, these
companies have not been thought of as belonging to the DMS sector and it is unlikely
that they will be pushed into the âknowledge management pigeon-holeâ defined by
the current document management paradigm. Frequently, these new products are
limited to subsectors of knowledge management and there is a focus on tools for
improving the interworking of groups, intelligent agents, novel search engines, data-
mining or data-mapping methods.
Information acquisition
The discussion of the topics âknowledge managementâ and âdatabasesâ has already
made it clear that the true challenge of the future is to make better and more
intelligent use of the contents of documents. Considering the large volume of data
and documents in archive and DMS solutions, this problem will not exactly be easy to
solve.
Today, good OCR/ICR solutions for converting facsimiles to text which provide
adequate detection quality already exist. In the future, however, speech, video,
images etc. will be available as information sources. Novel types of document, say a
âscreen dumpâ with the storage of a screen situation comprising a host window,
displayed facsimile document, opened spreadsheet table and a personal video
display for the customer which at this point can reply âyesâ to displayed conditions,
require entirely different technologies - not only for storage but also for acquiring
content.
The âbuzz wordâ associated with new acquisition and interpretation techniques is
âpattern recognitionâ. It is not yet very well known in the circle of classic suppliers of
document management solutions. In the lab, a lot of work has already been done on
detecting the contents of photos, identifying features in video, the interpretation of
speech recordings and other topics. Information can be acquired and condensed in
conjunction with novel databases and expert systems. The trend towards voice
control of edp systems, multi-lingual use of information and the involvement of new
groups of users who, in the future, will participate in market activity from their âhome-
TV-PCâ, conceals new challenges and undreamed of business potential. Until now,
the document management industry has not seriously considered themes of this kind
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 21 von 26
22. Paradigm Shifts in Document Management
- however, they would be an essential component of the knowledge management
paradigm.
Back to the source: recentralization
At present, document management systems are largely implemented as decentral
and distributed solutions in client/server or Intranet environments. Usually,
conventional host systems are only used as database servers for referencing
documents that are held separately. In the future, there will be a strong
recentralization of document collections. Gigantic archives will be maintained
centrally and interrogated multilingually on a world-wide basis. When fast enough
lines at reasonable prices become available, concepts such as the complete
outsourcing of information acquisition and provision, âpay per viewâ or the offer of
central fallback and security solutions will shape the future.
In particular, companies which have their own line networks, communication
equipment and computer centers will compete with the conventional DMS solutions
that have already been installed for companies or users. This aspect of long-term
customer integration is of great interest to all communication service providers. Both
public content and collections internal to companies will be made available. Existing
approaches like publishing on demand, information broadcast, digital mailing and
others will be included in this general strategy.
New user groups
Typically, the present thinking about the concept of document management is in
terms of business solutions within companies. Even today, this technology is being
transferred to PC workstations in the home thanks to virtual workplaces. Document
management in all its variants for ordering, acquiring and exchanging documents is
being democratized. Document management functions will add control and provision
techniques for large quantities of information on to the standard communication
facilities of the Internet. It is less probable, however, that the majority of the new
users will become familiar with these functions in the form of independent document
management or workflow. It will be much more the case that functionality will be
concealed in novel applications which will be capable of organizing even the
workflow from empty freezers to special offers at the grocerâs.
The document management sector would, therefore, be wise to stake a claim on
these new themes in good time with ânon-technologicalâ, easy-to-understand terms
and to develop their products further under the changed user requirements. The
development of these applications is no longer forced by the edp or organization
departments in companies but by the requirements of the consumer industry. Game-
type multimedia user interfaces, functions that are simple and intuitive to use or voice
control will determine the image of future applications.
An alternative paradigm:
Wll document management survive only as an organizational service?
Regardless of software and hardware development, the demand for organization of
rational document management will still remain. The preparation and acquisition of
information is becoming more and more important because of growing volumes of
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 22 von 26
23. Paradigm Shifts in Document Management
information and information overload. In this context, other new types of profession
will be created. They will, however, not be able to compensate for the loss of office
and administrative jobs that results from the optimization of processes and the
improved utilization of information.
If document management is to be used effectively and economically - for example in
relation to holistic, case-resolving office work, the automation of incoming mail or
universal call center workstations which involve the collation of information from a
wide range of sources - wide-ranging organizational and consultative tasks still
remain - even if the discipline of document management should cease as an
independent hardware and software sector (... improbable).
Final remarks
To potential users
The previous analysis should have made it clear what changes the document
management sector is being currently subjected to. Many of the trends and indicated
possibilities are not yet available in the form of products - and this still may be the
case for the next 10 years. The most important question which every user should
now be asking himself is âWhat is the significance of information for my company and
how can I use it effectively â. It may be that tried and tested solutions are more
suitable than products which include âthe technologies of the futureâ at any price.
However, when considering the use of a technology, it is important to include the
possible future use of information - this is because an essential feature of the existing
paradigm is that information can be kept for decades with reliable systems.
To the suppliers of document management systems
It is important that manufacturers of DMS products, software in particular, position
themselves today - the market will be divided up in the next two years: âDo I have the
right strategy for a changing market, What is the best way to deal with competition?â,
âWhat are the future USPs of my product?â, âDo I want to develop my product further,
do I want to involve partners?â, or âDo I want to stop may own development and buy
in an engine and toolbox?â. You have to lean back, put day-to-day business on the
back burner, forget about customers pressurizing you for a moment and look out into
the wider world beyond the confines of your own field of activity.
This is particularly important for an industry, which
⢠has proclaimed that it will intelligently acquire the data and documents which
represent the knowledge of the company and make it available over long periods
of time,
⢠promises to provide solutions to improve business processes and so make
methods of working more economical,
⢠intends to introduce a new quality into the world of work by means of cooperative
edp-supported systems,
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 23 von 26
24. Paradigm Shifts in Document Management
⢠is positioning itself as an independent discipline within the wider field of
information technology, and
⢠takes the paradigm shift seriously - not as a threat, but as the challenge of the
future.
Anschrift des Autors
PROJECT CONSULT GmbH, BĂźro Hamburg
Oderfelder Str. 17
D-20149 Hamburg
Tel.: 040 / 460 762 20
Fax: 040 / 460 762 29
E-Mail: Presse@PROJECT-CONSULT.com
Web: www.PROJECT-CONSULT.com
Autorenrecht
Š PROJECT CONSULT GmbH 2001
Jeglicher Abdruck, auch auszugsweise oder als Zitat in anderen VerĂśffentlichungen, ist durch den
Autor vorab zu genehmigen.
Belegexemplare, auch bei auszugsweiser VerĂśffentlichung oder Zitierung, sind unaufgefordert
einzureichen.
Kunde: IMCâ98 Projekt: Autor: Kff
Thema: Paradigm shift Topic: Keynote Status: Fertig
Datei: ulrichkampffmeyerparadigmshiftsi
ndocumentmanagement1999en-
160424153705.doc
Datum: 24.04.2016 Version: 2.8
Š PROJECT CONSULT GmbH 2016 Seite 24 von 26
25. Profil des Autors
Dr. Ulrich Kampffmeyer, Jahrgang 1952, ist Geschäftsfßhrer der
PROJECT CONSULT Unternehmensberatung GmbH, eine der
fĂźhrenden produkt- und herstellerneutralen Beratungsgesellschaften
fĂźr Dokumenten-Management, elektronische Archivierung,
BĂźroautomation, Groupware, Intranet und Workflow in Deutschland.
Er ist GrĂźnder und Managing Partner der PROJECT CONSULT
International Ltd., London.
Er entwickelte das Systemdesign fĂźr mehrere Dokumenten-Management-Produkte und beriet
zahlreiche Anwender, Hersteller und Systemhäuser bei der Planung, Organisation und
Implementierung solcher Systeme. Zu den von ihm betreuten Anwendern gehĂśren namhafte deutsche
und internationale Organisationen, Konzerngruppen und Unternehmen.
Dr. Kampffmeyer ist anerkannter KongreĂleiter, Referent und Moderator zu Themen des Dokumenten-
Management-Umfeldes. Seine Vortragsaktivitäten erstrecken sich auf Veranstaltungen wie z.B. AIIM,
AWV, datakontext, dc, DMS, DLM-Forum, Documation, EUROFORUM, IMC, IIR EDOK, IIR Interflow,
Online, VOI etc. Er gehĂśrt zu den wenigen deutschen Beratern und Analysten, die auch international
anerkannt sind, wie zahlreiche Moderations-, Keynote- und Vortragseinladungen aus dem Ausland
zeigen. Seine Keynote-Vorträge âDocument Management as IT-Infrastructureâ (1995), âThe Future of
Document Managementâ (1997), âParadigm Shifts in Document Managementâ (1998), âThe Electronic
Documents Management Market in Europe: Technologies and Solutionsâ (1999), âMarket Transitions:
DRT Document Related Technologiesâ (1999) und âDokumenten-Management im Wandel â und wo
bleibt der Mensch?â (1999) gelten als richtungsweisende Beiträge fĂźr die gesamte DRT-Branche.
Dr. Kampffmeyer ist einer der Direktoren der AIIM Europe, Association for Information and Image
Management International. Als Mitglied des Executive Committee und Vice Chair des Board of
Directors der AIIM gilt er als eine der fĂźhrenden PersĂśnlichkeiten der Branche in Europa. FĂźr seine
erfolgreiche Tätigkeit im Dokumenten-Management-Umfeld wurden ihm vom IMC 1992 der âAward of
Excellenceâ, 1994 der Award âFellow of IMCâ und 1997 der âAward of Meritâ, sowie von der AIIM
International 1999 der Award âFellow of AIIMâ und 2000 die Auszeichnung âMaster of Information
Technologyâ verliehen. Er ist Mitglied des Beirat der europäischen Ausgabe der der AIIM-Zeitschrift âe-
docâ.
Als langjähriger Vorsitzender des VOI Verband Optische Informationssysteme e.V. (1991-1998)
verfĂźgt er Ăźber detaillierte Marktkenntnisse in den Bereichen Dokumenten-Management, Workflow,
Groupware, elektronische Archivierung, Intranet, digitale Signatur, Knowledge Management und
digitale optische Speicher. Er gilt nach Einschätzung der Zeitschrift Computerwoche als der Mentor
der DRT-Branche in Deutschland.
Als Autor fĂźr Zeitschriften wie Info21, DoQ, Document World, e-doc, Office Management, Bit,
Document Manager, Computerwoche, Markt & Technik, Information Week, Password,
ComputerZeitung, Management Berater, INFOdoc und zahlreiche andere deutsche und internationale
Publikationen hat er in den vergangenen Jahren ßber 230 Beiträge zu Themen des Dokumenten-
Managements verĂśffentlicht. Er ist Autor regelmäĂiger Kolumnen in Fachzeitschriften, Herausgeber
des PROJECT CONSULT Newsletter und zahlreiche seiner Publikationen werden auf WebSites
referenziert.
Er ist Autor des Buches âGrundlagen und Zukunft des Dokumenten-Managementsâ sowie Ko-Autor
der deutschen Codes of Practice âGrundsätze der elektronischen Archivierungâ und âGrundsätze der
Verfahrensdokumentation nach GoBSâ.
Dr. Kampffmeyer engagiert sich in Standardisierungsgremien wie der AIIM Association for Information
and Image Management International, WfMC Workflow Management Coalition, DMA Document
Management Alliance, ODMA Open Document Management API und anderen
Standardisierungsgremien. Er ist Mitglied des DLM Forums der Europäischen Kommission und
Mitarbeiter an den europäischen âCodes of Practiceâ und Rechtsgrundlagen zum Einsatz von
Dokumentenmanagement-Technologien.