SlideShare a Scribd company logo
CORPORATE OVERVEIW
KËTAisthetrustedandleadingmanufacturersforpremiumhardwaresolutions&servicesenablingbetterbuildings.
KËTAisamanufacturerofarchitecturalhardwareandglassfittings,whichprovidescompletesolutiontoresidentialandcommercial
structures.
Withover60yearsoftraditionbehindit,thecompanyoffersofastrong,customer-focusedapproachandcontinuousquestforworld-
classqualityhaveenabledustosustainleadership.
KËTA offers their customers a comprehensive portfolio of products, solutions and services for security and building access, so these
customerscangeteverythingrelatingtoaccessandopeningandclosingdoorsfromasinglesource.
Besides, KËTA is also an active exporter of Architectural Hardware, High Security Locking Solutions to the Middle East, Germany
andCanadaandisworkingasanOEMforsomeoftheleadingglobalbrandsintheIndustry.
KËTA have a long tradition of innovation and engineering skill. On the way to its strategic objective of innovation leadership within
the industry, it links customer requirements to technological trends and develops a continuous stream of groundbreaking solutions
thatcreateaddedvalueforcustomersandusers.
Setting on a strong foundation since its inception, and guided by its customer-centric philosophy, the company leverages the power
of complete architectural hardware solutions to enable infrastructure development partners to enrich with superior returns on their
projects. With a mission to expand our global market outreach, KËTA strives to collaborate with its clients to provide comprehensive
hardwaresolutionsforresidencesandbusinesses.
KËTA is a premier provider of an exclusive product range that includes Door Closers, Floor Springs, Glass Patch Fittings, Point Fixed
Architectural Fittings, Pull Handle, Shower Hinges, Hinges, Mortise Handle & Locks, Spider Fittings, Glass Sliding System, Premium
rangebrass&Zinchandles.
Our in house casting factory and finishing plant has helped us to creatively build strongly established product lines, since our
inception. We function with our testing and R&D facility centre, as a result, setting industry benchmarks in hardware fittings and
solutions. We are committed to partnering with its stakeholders for providing end-to-end architectural hardware products to the
Architects,Builders,Fabricators,InteriorDecorators,CorporateHouses,GovernmentContractors,andmanyothersinthedomainof
residential and commercial projects. KËTA has emerged as an influential force in the continuing advancement of architectural
hardwareindustryandhasservedformanypopularprojects,bothdomesticandinternational.
ABOUT USABOUT US
Topnotchengineeringteamstrategicallyspreadacrossgeographicalborderstoenable24/7developmentcycleandcost
effectiveprojectbudgets
Provencompetenceinhardwarefittingssolutionsforvariousmarkets
Conceptofcustomizedproductdevelopmentcapability
Morethan6decadessuccessfulexperienceintheindustry
Hydraulicandmechanicalprocessesusedtomanufacturearchitecturalhardwareproducts
TechnicaldevicesbroughttoapplicationresultingintorangeofKËTAproducts
Fromconcepttillcommercialsuccess
Endtoendhardwarefittingssolutions
Deployresourcesforreachingenergyefficiencygoals
Integratemethodslikeleanandsixsigmaforoptimalproductdevelopmentlifecycle
Haveinvestedtremendouseffortsinresearch&developmentpriortoproductionofendproducts
KËTAhasoneofthelatestandmostadvancedstateoftheartinhousetoolmakingfacilitieswhichmakesitcapableof
adheringtothelatesttechnologyfordesignandmanufacturingofproducts,tocatertothechangingrequirementsof
customers(forhigherquality&fasterturnaround).KËTA'sToolmakingfacilityensuresGlobalStandardsforDesign,which
inturnhelpsincomingupwithlatestandworldclassdesignsforArchitecturalHardware,high-endLockingSystems.
JIT,VSM,SPF,LowCostAutomationandSMEDTechniques;whichareusedduringtool-manufacturingtoachievefaster
changeoverinproduction.
InhouseFacilitiesforCNC.
ManufacturingEngineering:itservesasthelinkagebetweendesign&manufacturingdepartmentsbyintegratingproduct,
productdesignandplanning.
Ensureshighproductivityandoptimumutilizationofresources
HighendCAD-CAMsystems
ConceptDesignCellfor3DDesigning&Development,usingbesttechnologiessystems.
GroupSharedFacilityforRapidPrototyping&Tooling
FullyIntegratedDesignCellfornewDevelopment&ReverseEngineering
VastTeamofhighlyknowledgeableandexperienceddesignersandengineersoverseeingeveryaspectofmanufacturing
infrastructure.
Designing ToolManufacturing ManufacturingEngineering ComponentManufacturing
Assembly ConceptDesignCell Machining SurfaceFinishing
STATEOFARTOFMAUFACTURING
ManufacturingHighlights
Competencies
PRODUCT ENGINEERING
SUSTAINABLITY
OURCOMMITMENTTOASUSTAINABLEFUTURE
STRATEGY:
VISION
KËTA is committed to sustainable development as one of the business maxims. KËTA's aim is to ensure energy-saving and resource-
conserving production, a high recycling ratio and the longevity of our quality products. With comprehensive advice, innovative
productsandaninternationalservicecapability,KËTAisabletomakeasignificantcontributiontoenergyefficiencyandtodrivecost
savingsderivedfromsustainablebuildingconcepts.
KËTA ensures compliance with its integrity, methodology, vision and strategy through the implementation of corresponding
management systems and associated processes. KËTA's management systems contain rules governing adherence to statutory
regulations, establishedstandards, customer requirements and their own qualityspecifications,while also promoting environmental
careandconservation,efficientresourceutilizationandaproactiveapproachtooccupationalhealthandsafety.
With high-quality products and comprehensive advice
and support, KËTA contribute to energy efficiency and
costsavingsinsustainablebuildingconcepts.
KËTA satisfies customer requirements and requests
through:
resource-efficient, application-specific and solution-
alignedproductandprocessdevelopmentwork.
involvementinthedraftingoftechnicalrulesand
regulations.
reliable production processes achieved through use
ofadvancedmanufacturingsystems.
supplyoperationsonthebasisoftheverylatest
logisticalconcepts.
Together, these aspects, activitiesand attributes yieldecologicallyand economicallysound, durable solutionscharacterized by their
qualitative excellence. New processes and products are introduced on the basis of strict criteria governing quality, ecological
acceptability,energyefficiencyandoccupationalhealthandsafety.
KËTApursueopenstakeholdercommunication.
KËTA examine and assess the activities and products with respect to cost-efficiency, quality, consumption of natural resources,
environmental compatibility and pollution potential, energy efficiency and consumption, occupational health and safety, and
environmentalprotection,withthepurposeofachievingcontinuousimprovement.
To be a Global partner of choice in architectural hardware products and fittings for every selected domain in residential and
commercialprojectssoastobeamajorpartnerinthedevelopmentofthecountry.
INTEGRITY
Values
CustomerOrientation
Quality
METHODOLOGY
Research
Technology
Workmanship
Collaboration
Practice
KËTA value its customers and promise to provide them quality products at reasonable rate along with the best customer service and
theproductguarantee.KËTAiscommittedtoprovidesatisfactiontoitseachandeverycustomertheyserve.
Services centred to the needs of customers is paramount as KËTA's business principle. KËTA also recognises the richness in
diversifiedproductportfolios,customizedsolutionsandprofessionalservicesinordertocontributetothecontinuousdevelopmentof
itsbusinessprospects.
For KËTA, quality is both a philosophy and a new way of life into the products. KËTA develop and follow the best manufacturing
practicesaswellasdefinebestapproachesforsolutiondeliveryframeworksinordertofosterstrongpartnershipswithclients.
KËTA believes in strong research and development before they launch their products. KËTA also values the opinion of most
establishedarchitectsandinteriordesignerforlook,comfortandstyle.
KËTA's approach is to adopt the latest technologies in design and development of any product, innovation of green production
methodologies, combining functionality with aesthetics in their products, in the process, providing optimum solution for their clients
andcommunities.
KËTA uses excellent workmanship to manufacturer products. KËTA uses most advance systems and technology to produce
consistentproductsqualities.
KËTA collaborates with their clients and stakeholders for residential and commercial projects and strive to build a long-term
relationshipwithcommitmentfortheirvalueofmoney.
KËTA practices high degree of leadership thinking in providing solutions and product recommendation to their clients, in doing so;
KËTAadheretothehighestvaluesofquality,objectivityandintegritythathelpinthesuccessofeveryundertakenproject.
GREENMETHODANDTECHNOLOGY
FeaturesofKËTA'sproductsare:
SECURITY
Green technology and method is a program adopted
by KËTA for process optimization and production
efficiency. Implementing upon this strategy, KËTA
intends to reduce use of chemicals and energy, in
the process manufacture the most sophisticated
energy-saving products. For instance, door closers,
handles, floor springs, and other hardware
accessoriesrequirenobatteryorpowerwiring.
KËTA provides eco-friendly hardware solutions
wherein their products are temperature sensitive,
resilient and cost effective, benefitted for residential and commercial applications. KËTA's proven success of providing advanced
and reliable hardware fittings and solutions has served the architects and contractors who desires superior building technology for
their clients. With their comprehensive and progressive solutions across countless homes and businesses, KËTA has witnessed high-
performance formulation delivery that is cost-effective and environment-friendly. KËTA believes in resource conservation,
sustainable manufacture, product-recycling and waste & water management in order to conduct best environmental practices.
KËTA research ways to reduce or eliminate unhealthy compounds from their manufacturing processes. KËTA partners with green
home designers, architects, builders, interior designers and contractors to enhance our corporate environmental responsibilities and
helpsbuildingsustainableobjectivestowardsthesociety.
Advancedtechnologyandeco-friendlydesign
Craftedwithindividualcomfortandglobalsustainabilityinmind
Optimiseenergyusewhilemaintainingstructuralflexibilityandfunctionality
Emission-compliant
Contributortoenergyconservationtechnology
Sustainabletoconsumersacrosstheresidentialandcommercialspectrum
Security is the top priority for most of the people because no matter where their house or other establishments are located. Hence, it
isnecessaryforeveryonetoensurethattheirabode/establishmentsarewell-equippedwithbestsecuritymeasures.
So,keepingthedireneedforqualityanddurableLock&SecuritySystemsinmind,KËTAstrivestocome-upwithlatestandadvanced
security solutions. KËTA's locking and security products are strong, durable, computerized and based on suitable confirmation
techniques.KËTAwillgiveyouatruesenseofquality,peaceofmindandbeautyyouexpectfromtheaccessoriesyouuse.
Moreover, true to KËTA's tradition and reputation, KËTA's Locks & Security Systems are the products of deep quality and
craftsmanship and are meticulously crafted of the finest materials and with utmost attention to details and all of these are done to
providetheutmostprotectionforyourfamily.
OurState-of-the-artLockingsystemsinclude:-
MortiseLocks
NightLatches
CylindricalLocks
EuroprofileCylinders
INSPIRATION
Realtors
FABRICATOR
For the builders and realtors, KËTA participates right from the inception of any project, be it a renovation project or property
development. KËTA collaborates with the architects who are involved in realty projects and seek approval for KËTA's architectural
hardware products and fittings for construction projects. KËTA strongly believes in matching their services to every individual
client'sneedsandservesthemastheirstrategicpartnerinhardwarefittingsandsolutions.KËTAalsoprovidesmodernarchitectural
consulting for the large building structures along with post-implementation support. KËTA collaborates for clean and green
technology for socio-environmental responsibilities, with functional and structural deliverables to every client's attention.
KËTA executes their projects in an effective environment for their clients, integrating with proper definition and delivery of their
hardware fittings solutions to them. KËTA's team is involved in formulating a long-term engagement strategy with the realtors, in
the process, gaining intimate knowledge of their business operations and requirements. KËTA complies with industry standards and
frameworks, as well as engage themselves in testing and project roll out to accomplish every proposition, both residential and
commercial.
KËTA collaborates with Aluminium and Glass fabricators for architectural and structural applications, with each major function and
value to their projects. KËTA strongly believes in matching their services to every individual client needs and serve them as their
strategic partner in glass and aluminium fitting solutions. KËTA provides toughened glass with its fittings for glass windows,
partitions and other glass concepts of world class building structures. KËTA also assist with aluminium products and fittings for
railings,providingacompletesolutionportfoliotothefabricators.KËTA highlyefficientcustommanufacturingoperationshelpsthe
fabricators in all kinds of glass fittings solutions including spider fittings, slider glass door fittings, glass partitions and hinges,
rotational glass door fittings, and various others. KËTA partners in projects, participate with their product range for contributing to
energy efficiency and green practices of architectural set ups, and thereby helps to create a sustainable architectural solution for
hardwarefittings.
KËTA executes their projects in an effective environment for their clients integrating with proper definition and delivery of their
hardwarefittingssolutionstothem.KËTA'steamisinvolvedinformulatingalong-termengagementstrategywiththefabricators,in
the process, gaining intimate knowledge of their business operations and requirements. KËTA complies with industry standards and
frameworks, as well as engage ourselves in testing and project roll out to accomplish every proposition, both residential and
commercial.
SERVICES
ARCHITECT
INTERIORDESIGNER
KËTA's engagement model outlines the
relationship between their services and the
architects, with each major function and the
value it brings to their projects. KËTA strongly
believe in matching their services to every
individual client needs and serve them as their
strategic partner in hardware fittings and
solutions. KËTA prepares mock-up of building
structures based on the knowledge about the
concerned property, its interiors and exteriors,
and integrate architectural hardware solution
to provide an actual view of the outstanding
project. KËTA assist with drawings and
specifications of required hardware products,
theirdesignandspacerelatedaspects,inorder
toprovideacompletesolutionportfolio.
KËTA collaborates for projects, participate with their product range for energy efficient and green buildings, and thereby create a
sustainablearchitecturalsolutionforhardwarefittings.
KËTA executes their projects in an effective environment for their clients integrating with proper definition and delivery of their
hardware fittings solutionsto them. KËTA's team is involved in formulating a long-term engagement strategy with the architects, in
the process, gaining intimate knowledge of their business operations and requirements. KËTA comply with industry standards and
frameworks, as well as engage themselves in testing and project roll out to accomplish every proposition, both residential and
commercial.
KËTA collaborates with interior designers to showcase the interior aesthetics and setting of any location, in the process, integrates
their products with the decorative appeal of any room.
KËTA strongly believes in matching their services to every
individual client's needs and serves them as their strategic
partner in hardware fittings, accessories and solutions.
KËTA helps in product portfolio optimization for the
designers and provide delivery of products side, from
drawing to conception and positioning. KËTA helps in
spatial intelligence of interiors based on architectural
hardware accessories designs and assure quality for
operations.KËTA'sproducts are aestheticallydisposedand
are safety enabled for the users. KËTA conducts
requirements collection and analysis for the interior
designers and thereafter sets the scope of products
accordingly. KËTA provides complete solution design including a three dimensional definition, lighting effects and its integration
withthehardwareproductsinplace.
KËTA executes their projects in an effective environment for their clients integrating with proper definition and delivery of KËTA's
hardware fittingssolutionsto them. KËTA assiststhem withconsultingservices on how interior decorators can re-use materials for
sustainable practices. KËTA's team is involved in formulating a long-term engagement strategy with the designers, in the process,
gainingintimateknowledgeoftheirbusinessoperationsandrequirements.KËTAcomplieswithindustrystandardsandframeworks,
SOME OF OUR PROJECTS
GGGooovvveeerrrnnnmmmeeennnttt BBBuuuiiillldddiiinnnggg PPPrrrooojjjeeeccctttsss:::
Parliament Library Project, New Delhi.
DMRC - Delhi Metro Rail Projects, Training School, Workshop, Metro Stations,
New Delhi, Bangalore , Jaipur , Kochi
Parliament Extension Building, New Delhi.
Comman Wealh Games 2010,New Delhi. ..............................................and many others.
OOOffffffiiiccceee CCCooommmpppllleeexxxeeesss &&& IIInnnsssiiitttuuutttiiiooonnnaaalll BBBuuuiiillldddiiinnngggsss:::
Khalsa Heritage Complex , Anandpur Sahib , Punjab
Darga Chare- Sharief , Srinagar
Div.Commisionor Complex Office , Jammu
Impa Complex , Sidhra , Jammu
New Delhi City Center, Parliament Street, New Delhi.
Xansa India Ltd. , Noida.
C.I.E.T. Building, Dept.. of Space , New Delhi. ..........................................and many others.
EEEmmmbbbaaassssssyyy PPPrrrooojjjeeeccctttsss :::
U.S.S.R. Cultural Center, New Delhi.
U.S.S.R. Embassy Residences, New Delhi.
U.S.S.R. Embassy, Economic Dept.. Bldg., New Delhi.
Sri Lanka High Commission Residences, New Delhi.
Sri Lanka High Commission Pilgrimage Rest House, New Delhi. . ..............and many others.
LLLIIISSSTTT OOOFFF PPPRRREEESSSTTTIIIGGGIIIOOOUUUSSS BBBUUUIIILLLDDDIIINNNGGGSSS WWWHHHEEERRREEE OOOUUURRR PPPRRROOODDDUUUCCCTTTSSS AAARRREEE UUUSSSEEEDDD:::
OUR PRODUCTS
FFFooorrreeeiiigggnnn PPPrrrooojjjeeeccctttsss :::
Mahatma Gandhi Institute, Moka, Mauritius.
Indira Gandhi Memorial Hospital, Maldives. ............................................and many others.
UUUnnniiivvveeerrrsssiiitttiiieeesss &&& EEEddduuucccaaatttiiiooonnnaaalll IIInnnssstttiiitttuuutttiiiooonnn PPPrrrooojjjeeeccctttsss :::
MVDSB University , Katra , Jammu
Jawahar Lal Nehru University, New Delhi.
Govt. Polytechnic College , Riasi , Jammu
Guru Nanak Dev University, Amritsar.
Kumarganj University, Faizabad.(U.P.)
Hamdard Educational Campus, New Delhi. ...........................................and many others.
HHHooossspppiiitttaaalll aaannnddd MMMeeedddiiicccaaalll IIInnnssstttiiitttuuutttiiiooonnn PPPrrrooojjjeeeccctttsss :::
Dental College , Jammu
Gandhi Nagar Hospital , Jammu
Primary Health Center , Badgam , Srinagar
Sub-District Hospital , Kokernag , Srinagar
Rajindra Hospital , Patiala , Punjab
Sanjay Gandhi P.G.I. of Medical Sciences Complex, Lucknow.
Kasturba Gandhi Medical College, U.P.
Batra Hospital, Tughlaqabad, New Delhi.
Lady Hardinge Medical College , New Delhi
E.S.I. Okhla Hospital Complex, New Delhi
Rajinder Prashad Super Speciality Hospital, Kangra , Himachel Pradesh
NEIGRIHMS Project, Shillong. Meghalaya. ................................................and many others.
SOME OF OUR PROJECTS
RRReeesssiiidddeeennntttiiiaaalll TTTooowwwnnnssshhhiiipppsss,,, SSSpppooorrrtttsss aaannnddd MMMiiisssccc... PPPrrrooojjjeeeccctttsss :::
DLF SILVER OAK Apartments, Gurgoan.
DLF Qutab Enclave Township : Flats, Town Houses & Villas in Phase 1,2,3,4.
DLF CORPORATE PARK Commercial Complex, Gurgoan.
DLF Ricmond Park I, Gurgoan.
DLF Ricmond Park II, Gurgoan.
Unitech Limited, Flats, New Delhi.
Eros Charmwood Village Cottages, Surajkund.
MARUTI CHAKKARPUR Co-operative Group Housing Colony, Gurgoan. (1100 Flats)
MARUTI Employees CHANDERLOK Houses, Phase 4 DLF Qutab Enclave, Gurgoan.
Media Center Society Cottages, Gurgoan.
Nuclear Science Center, Staff Housing Colony, New Delhi.
TATA Fertilizers Officers Housing Colony, Babrala. U.P.
Housing at Afro Asian Games Site, Andrews Ganj, New Delhi.
Asian Games Village Complex, New Delhi.
ESSAR STEEL 400 nos. Sea Side Villas Township, Hazira.
Civil Aviation Trainig Centre Complex , Bamrauli , Allahabad. .................and many others.
SOME OF OUR PROJECTS
OUR PRODUCTS
Mortise Lever Handle Mortise Lock Euro Profile Cylinder
Pull Handles Floor Spring Towerbolt
Hinges Door Closer Door Stopper
OUR PRODUCTS
Patch Fittings Canopy Fittings Glass Hinges
Sliding Door Handles Glass Connectors Glass Sliding System
Spider Fittings Routel
Corp. Office : A-218, Vikas Puri, New Delhi-110018 (INDIA)
DORMAT INDIA INDUSTRIES
Web : www.keta.in Mail : info@keta.in
Contact : +91 99-1112-1234 011-4563-0841
Follow us on :
facebook.com/ketahardware twitter.com/ketahardware linkedIn.com/company/keta

More Related Content

What's hot

AD_International_Surface Treatment and Manufacturing_DEF
AD_International_Surface Treatment and Manufacturing_DEFAD_International_Surface Treatment and Manufacturing_DEF
AD_International_Surface Treatment and Manufacturing_DEFRoland Schellen
 
Trends In Sustainability 5 09
Trends In Sustainability 5 09Trends In Sustainability 5 09
Trends In Sustainability 5 09
Patrick McNamara
 
Hpe Corporate Brochure W2016
Hpe Corporate Brochure W2016Hpe Corporate Brochure W2016
Hpe Corporate Brochure W2016Meena Bains
 
ALT Technologies company presentation d1m07y21v01 carlos
ALT Technologies company presentation d1m07y21v01 carlosALT Technologies company presentation d1m07y21v01 carlos
ALT Technologies company presentation d1m07y21v01 carlos
Beata Linz (Kis)
 
Electrodynamic Vibration System | Environmental Chambers | sdyn
Electrodynamic Vibration System | Environmental Chambers | sdynElectrodynamic Vibration System | Environmental Chambers | sdyn
Electrodynamic Vibration System | Environmental Chambers | sdyn
sdyn India
 
Chris Verosky resume 1-22-17
Chris Verosky resume 1-22-17Chris Verosky resume 1-22-17
Chris Verosky resume 1-22-17Chris Verosky
 
Stratified medicine - Company Pitches
Stratified medicine  - Company PitchesStratified medicine  - Company Pitches
Stratified medicine - Company PitchesSpace IDEAS Hub
 
Steve.Ilsley
Steve.IlsleySteve.Ilsley
Steve.Ilsleyilsleys1
 
Innovation white paper uk our frugfuture
Innovation white paper uk our frugfutureInnovation white paper uk our frugfuture
Innovation white paper uk our frugfuturegautammorey
 
Siegfried Brochure
Siegfried BrochureSiegfried Brochure
Siegfried Brochureslccbrown
 
Siegfried Exclusive Presentation Final
Siegfried Exclusive Presentation FinalSiegfried Exclusive Presentation Final
Siegfried Exclusive Presentation Finalslccbrown
 
Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.
Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.
Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.VRG ArihantPlast Pvt. Ltd.
 
Quality4engineeringservices
Quality4engineeringservicesQuality4engineeringservices
Quality4engineeringservices
ramalingampam
 
Phillips Medisize Ireland 2013
Phillips Medisize Ireland 2013Phillips Medisize Ireland 2013
Phillips Medisize Ireland 2013kevinludlow
 
Phillips Medisize Ireland March 2013
Phillips Medisize Ireland March 2013Phillips Medisize Ireland March 2013
Phillips Medisize Ireland March 2013kevinludlow
 

What's hot (20)

CPC_PROFILE_COMPLETE
CPC_PROFILE_COMPLETECPC_PROFILE_COMPLETE
CPC_PROFILE_COMPLETE
 
AD_International_Surface Treatment and Manufacturing_DEF
AD_International_Surface Treatment and Manufacturing_DEFAD_International_Surface Treatment and Manufacturing_DEF
AD_International_Surface Treatment and Manufacturing_DEF
 
Trends In Sustainability 5 09
Trends In Sustainability 5 09Trends In Sustainability 5 09
Trends In Sustainability 5 09
 
Vineland_Bulletin
Vineland_BulletinVineland_Bulletin
Vineland_Bulletin
 
Hpe Corporate Brochure W2016
Hpe Corporate Brochure W2016Hpe Corporate Brochure W2016
Hpe Corporate Brochure W2016
 
Plaquette REPONSE - anglais
Plaquette REPONSE - anglaisPlaquette REPONSE - anglais
Plaquette REPONSE - anglais
 
ALT Technologies company presentation d1m07y21v01 carlos
ALT Technologies company presentation d1m07y21v01 carlosALT Technologies company presentation d1m07y21v01 carlos
ALT Technologies company presentation d1m07y21v01 carlos
 
PATHRS_QbD_Newsletter_PRESS
PATHRS_QbD_Newsletter_PRESSPATHRS_QbD_Newsletter_PRESS
PATHRS_QbD_Newsletter_PRESS
 
Electrodynamic Vibration System | Environmental Chambers | sdyn
Electrodynamic Vibration System | Environmental Chambers | sdynElectrodynamic Vibration System | Environmental Chambers | sdyn
Electrodynamic Vibration System | Environmental Chambers | sdyn
 
Chris Verosky resume 1-22-17
Chris Verosky resume 1-22-17Chris Verosky resume 1-22-17
Chris Verosky resume 1-22-17
 
Stratified medicine - Company Pitches
Stratified medicine  - Company PitchesStratified medicine  - Company Pitches
Stratified medicine - Company Pitches
 
Steve.Ilsley
Steve.IlsleySteve.Ilsley
Steve.Ilsley
 
Innovation white paper uk our frugfuture
Innovation white paper uk our frugfutureInnovation white paper uk our frugfuture
Innovation white paper uk our frugfuture
 
CV_DP
CV_DPCV_DP
CV_DP
 
Siegfried Brochure
Siegfried BrochureSiegfried Brochure
Siegfried Brochure
 
Siegfried Exclusive Presentation Final
Siegfried Exclusive Presentation FinalSiegfried Exclusive Presentation Final
Siegfried Exclusive Presentation Final
 
Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.
Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.
Plastic Custom Molding - VRG Arihant Plast Pvt Ltd.
 
Quality4engineeringservices
Quality4engineeringservicesQuality4engineeringservices
Quality4engineeringservices
 
Phillips Medisize Ireland 2013
Phillips Medisize Ireland 2013Phillips Medisize Ireland 2013
Phillips Medisize Ireland 2013
 
Phillips Medisize Ireland March 2013
Phillips Medisize Ireland March 2013Phillips Medisize Ireland March 2013
Phillips Medisize Ireland March 2013
 

Similar to Company Profile

CIP SIP System | DDE Enterprises_Brochure (1).pdf
CIP SIP System | DDE Enterprises_Brochure (1).pdfCIP SIP System | DDE Enterprises_Brochure (1).pdf
CIP SIP System | DDE Enterprises_Brochure (1).pdf
ddenterprisestech
 
Prevas Company Presentation 201207
Prevas Company Presentation 201207Prevas Company Presentation 201207
Prevas Company Presentation 201207jan_malm
 
Product Engineering - Designing Systems that Exceeds Expectations
Product Engineering - Designing Systems that Exceeds ExpectationsProduct Engineering - Designing Systems that Exceeds Expectations
Product Engineering - Designing Systems that Exceeds Expectations
Cygnet Infotech
 
Glass manufacturing plant operational excellence catalog
Glass manufacturing plant operational excellence catalogGlass manufacturing plant operational excellence catalog
Glass manufacturing plant operational excellence catalogMattcons
 
Thnk Development
Thnk DevelopmentThnk Development
Thnk Developmentmulalo24
 
Engineer Plus Company Profile
Engineer Plus Company ProfileEngineer Plus Company Profile
Engineer Plus Company ProfileDEEPAK BHANDARI
 
COMPANY PROFILE - ICO Ltd.
COMPANY PROFILE - ICO Ltd.COMPANY PROFILE - ICO Ltd.
COMPANY PROFILE - ICO Ltd.
Indore Colour Organics Ltd.
 
The best IT company Service Provider in Chandigarh .pptx
The best IT company Service Provider in Chandigarh .pptxThe best IT company Service Provider in Chandigarh .pptx
The best IT company Service Provider in Chandigarh .pptx
Kreativan Technologies
 
Company Profile
Company ProfileCompany Profile
Company Profile
DEEPAK BHANDARI
 
Sicura brochure
Sicura brochureSicura brochure
Sicura brochure
Meridian Media
 
Al Fara'a Steel Structure brochure - 2015 - 2016
Al Fara'a Steel Structure brochure - 2015 - 2016Al Fara'a Steel Structure brochure - 2015 - 2016
Al Fara'a Steel Structure brochure - 2015 - 2016nayeem seethi
 
Top 10 Best Quality Assurance Consultants In the World in 2024
Top 10 Best Quality Assurance Consultants In the World in 2024Top 10 Best Quality Assurance Consultants In the World in 2024
Top 10 Best Quality Assurance Consultants In the World in 2024
Tech Latest
 
Jacobs CQV leadership
Jacobs CQV leadershipJacobs CQV leadership
Jacobs CQV leadership
David Tyrrell
 
Product development by i4 Product design
Product development by i4 Product designProduct development by i4 Product design
Product development by i4 Product design
Sienche
 
DG Business Overview
DG Business OverviewDG Business Overview
DG Business OverviewKimberly Cox
 
Product Design Innovation
Product Design InnovationProduct Design Innovation
Product Design Innovation
gordonmiller
 

Similar to Company Profile (20)

CIP SIP System | DDE Enterprises_Brochure (1).pdf
CIP SIP System | DDE Enterprises_Brochure (1).pdfCIP SIP System | DDE Enterprises_Brochure (1).pdf
CIP SIP System | DDE Enterprises_Brochure (1).pdf
 
NCPI Brochure
NCPI BrochureNCPI Brochure
NCPI Brochure
 
Prevas Company Presentation 201207
Prevas Company Presentation 201207Prevas Company Presentation 201207
Prevas Company Presentation 201207
 
Product Engineering - Designing Systems that Exceeds Expectations
Product Engineering - Designing Systems that Exceeds ExpectationsProduct Engineering - Designing Systems that Exceeds Expectations
Product Engineering - Designing Systems that Exceeds Expectations
 
Glass manufacturing plant operational excellence catalog
Glass manufacturing plant operational excellence catalogGlass manufacturing plant operational excellence catalog
Glass manufacturing plant operational excellence catalog
 
Thnk Development
Thnk DevelopmentThnk Development
Thnk Development
 
ITPEERS
ITPEERSITPEERS
ITPEERS
 
Engineer Plus Company Profile
Engineer Plus Company ProfileEngineer Plus Company Profile
Engineer Plus Company Profile
 
COMPANY PROFILE - ICO Ltd.
COMPANY PROFILE - ICO Ltd.COMPANY PROFILE - ICO Ltd.
COMPANY PROFILE - ICO Ltd.
 
The best IT company Service Provider in Chandigarh .pptx
The best IT company Service Provider in Chandigarh .pptxThe best IT company Service Provider in Chandigarh .pptx
The best IT company Service Provider in Chandigarh .pptx
 
Company Profile
Company ProfileCompany Profile
Company Profile
 
Sicura brochure
Sicura brochureSicura brochure
Sicura brochure
 
Al Fara'a Steel Structure brochure - 2015 - 2016
Al Fara'a Steel Structure brochure - 2015 - 2016Al Fara'a Steel Structure brochure - 2015 - 2016
Al Fara'a Steel Structure brochure - 2015 - 2016
 
XS BROCHURE
XS BROCHUREXS BROCHURE
XS BROCHURE
 
XS BROCHURE
XS BROCHUREXS BROCHURE
XS BROCHURE
 
Top 10 Best Quality Assurance Consultants In the World in 2024
Top 10 Best Quality Assurance Consultants In the World in 2024Top 10 Best Quality Assurance Consultants In the World in 2024
Top 10 Best Quality Assurance Consultants In the World in 2024
 
Jacobs CQV leadership
Jacobs CQV leadershipJacobs CQV leadership
Jacobs CQV leadership
 
Product development by i4 Product design
Product development by i4 Product designProduct development by i4 Product design
Product development by i4 Product design
 
DG Business Overview
DG Business OverviewDG Business Overview
DG Business Overview
 
Product Design Innovation
Product Design InnovationProduct Design Innovation
Product Design Innovation
 

Company Profile

  • 1.
  • 2. CORPORATE OVERVEIW KËTAisthetrustedandleadingmanufacturersforpremiumhardwaresolutions&servicesenablingbetterbuildings. KËTAisamanufacturerofarchitecturalhardwareandglassfittings,whichprovidescompletesolutiontoresidentialandcommercial structures. Withover60yearsoftraditionbehindit,thecompanyoffersofastrong,customer-focusedapproachandcontinuousquestforworld- classqualityhaveenabledustosustainleadership. KËTA offers their customers a comprehensive portfolio of products, solutions and services for security and building access, so these customerscangeteverythingrelatingtoaccessandopeningandclosingdoorsfromasinglesource. Besides, KËTA is also an active exporter of Architectural Hardware, High Security Locking Solutions to the Middle East, Germany andCanadaandisworkingasanOEMforsomeoftheleadingglobalbrandsintheIndustry. KËTA have a long tradition of innovation and engineering skill. On the way to its strategic objective of innovation leadership within the industry, it links customer requirements to technological trends and develops a continuous stream of groundbreaking solutions thatcreateaddedvalueforcustomersandusers. Setting on a strong foundation since its inception, and guided by its customer-centric philosophy, the company leverages the power of complete architectural hardware solutions to enable infrastructure development partners to enrich with superior returns on their projects. With a mission to expand our global market outreach, KËTA strives to collaborate with its clients to provide comprehensive hardwaresolutionsforresidencesandbusinesses. KËTA is a premier provider of an exclusive product range that includes Door Closers, Floor Springs, Glass Patch Fittings, Point Fixed Architectural Fittings, Pull Handle, Shower Hinges, Hinges, Mortise Handle & Locks, Spider Fittings, Glass Sliding System, Premium rangebrass&Zinchandles. Our in house casting factory and finishing plant has helped us to creatively build strongly established product lines, since our inception. We function with our testing and R&D facility centre, as a result, setting industry benchmarks in hardware fittings and solutions. We are committed to partnering with its stakeholders for providing end-to-end architectural hardware products to the Architects,Builders,Fabricators,InteriorDecorators,CorporateHouses,GovernmentContractors,andmanyothersinthedomainof residential and commercial projects. KËTA has emerged as an influential force in the continuing advancement of architectural hardwareindustryandhasservedformanypopularprojects,bothdomesticandinternational. ABOUT USABOUT US
  • 3. Topnotchengineeringteamstrategicallyspreadacrossgeographicalborderstoenable24/7developmentcycleandcost effectiveprojectbudgets Provencompetenceinhardwarefittingssolutionsforvariousmarkets Conceptofcustomizedproductdevelopmentcapability Morethan6decadessuccessfulexperienceintheindustry Hydraulicandmechanicalprocessesusedtomanufacturearchitecturalhardwareproducts TechnicaldevicesbroughttoapplicationresultingintorangeofKËTAproducts Fromconcepttillcommercialsuccess Endtoendhardwarefittingssolutions Deployresourcesforreachingenergyefficiencygoals Integratemethodslikeleanandsixsigmaforoptimalproductdevelopmentlifecycle Haveinvestedtremendouseffortsinresearch&developmentpriortoproductionofendproducts KËTAhasoneofthelatestandmostadvancedstateoftheartinhousetoolmakingfacilitieswhichmakesitcapableof adheringtothelatesttechnologyfordesignandmanufacturingofproducts,tocatertothechangingrequirementsof customers(forhigherquality&fasterturnaround).KËTA'sToolmakingfacilityensuresGlobalStandardsforDesign,which inturnhelpsincomingupwithlatestandworldclassdesignsforArchitecturalHardware,high-endLockingSystems. JIT,VSM,SPF,LowCostAutomationandSMEDTechniques;whichareusedduringtool-manufacturingtoachievefaster changeoverinproduction. InhouseFacilitiesforCNC. ManufacturingEngineering:itservesasthelinkagebetweendesign&manufacturingdepartmentsbyintegratingproduct, productdesignandplanning. Ensureshighproductivityandoptimumutilizationofresources HighendCAD-CAMsystems ConceptDesignCellfor3DDesigning&Development,usingbesttechnologiessystems. GroupSharedFacilityforRapidPrototyping&Tooling FullyIntegratedDesignCellfornewDevelopment&ReverseEngineering VastTeamofhighlyknowledgeableandexperienceddesignersandengineersoverseeingeveryaspectofmanufacturing infrastructure. Designing ToolManufacturing ManufacturingEngineering ComponentManufacturing Assembly ConceptDesignCell Machining SurfaceFinishing STATEOFARTOFMAUFACTURING ManufacturingHighlights Competencies PRODUCT ENGINEERING
  • 4. SUSTAINABLITY OURCOMMITMENTTOASUSTAINABLEFUTURE STRATEGY: VISION KËTA is committed to sustainable development as one of the business maxims. KËTA's aim is to ensure energy-saving and resource- conserving production, a high recycling ratio and the longevity of our quality products. With comprehensive advice, innovative productsandaninternationalservicecapability,KËTAisabletomakeasignificantcontributiontoenergyefficiencyandtodrivecost savingsderivedfromsustainablebuildingconcepts. KËTA ensures compliance with its integrity, methodology, vision and strategy through the implementation of corresponding management systems and associated processes. KËTA's management systems contain rules governing adherence to statutory regulations, establishedstandards, customer requirements and their own qualityspecifications,while also promoting environmental careandconservation,efficientresourceutilizationandaproactiveapproachtooccupationalhealthandsafety. With high-quality products and comprehensive advice and support, KËTA contribute to energy efficiency and costsavingsinsustainablebuildingconcepts. KËTA satisfies customer requirements and requests through: resource-efficient, application-specific and solution- alignedproductandprocessdevelopmentwork. involvementinthedraftingoftechnicalrulesand regulations. reliable production processes achieved through use ofadvancedmanufacturingsystems. supplyoperationsonthebasisoftheverylatest logisticalconcepts. Together, these aspects, activitiesand attributes yieldecologicallyand economicallysound, durable solutionscharacterized by their qualitative excellence. New processes and products are introduced on the basis of strict criteria governing quality, ecological acceptability,energyefficiencyandoccupationalhealthandsafety. KËTApursueopenstakeholdercommunication. KËTA examine and assess the activities and products with respect to cost-efficiency, quality, consumption of natural resources, environmental compatibility and pollution potential, energy efficiency and consumption, occupational health and safety, and environmentalprotection,withthepurposeofachievingcontinuousimprovement. To be a Global partner of choice in architectural hardware products and fittings for every selected domain in residential and commercialprojectssoastobeamajorpartnerinthedevelopmentofthecountry.
  • 5. INTEGRITY Values CustomerOrientation Quality METHODOLOGY Research Technology Workmanship Collaboration Practice KËTA value its customers and promise to provide them quality products at reasonable rate along with the best customer service and theproductguarantee.KËTAiscommittedtoprovidesatisfactiontoitseachandeverycustomertheyserve. Services centred to the needs of customers is paramount as KËTA's business principle. KËTA also recognises the richness in diversifiedproductportfolios,customizedsolutionsandprofessionalservicesinordertocontributetothecontinuousdevelopmentof itsbusinessprospects. For KËTA, quality is both a philosophy and a new way of life into the products. KËTA develop and follow the best manufacturing practicesaswellasdefinebestapproachesforsolutiondeliveryframeworksinordertofosterstrongpartnershipswithclients. KËTA believes in strong research and development before they launch their products. KËTA also values the opinion of most establishedarchitectsandinteriordesignerforlook,comfortandstyle. KËTA's approach is to adopt the latest technologies in design and development of any product, innovation of green production methodologies, combining functionality with aesthetics in their products, in the process, providing optimum solution for their clients andcommunities. KËTA uses excellent workmanship to manufacturer products. KËTA uses most advance systems and technology to produce consistentproductsqualities. KËTA collaborates with their clients and stakeholders for residential and commercial projects and strive to build a long-term relationshipwithcommitmentfortheirvalueofmoney. KËTA practices high degree of leadership thinking in providing solutions and product recommendation to their clients, in doing so; KËTAadheretothehighestvaluesofquality,objectivityandintegritythathelpinthesuccessofeveryundertakenproject.
  • 6. GREENMETHODANDTECHNOLOGY FeaturesofKËTA'sproductsare: SECURITY Green technology and method is a program adopted by KËTA for process optimization and production efficiency. Implementing upon this strategy, KËTA intends to reduce use of chemicals and energy, in the process manufacture the most sophisticated energy-saving products. For instance, door closers, handles, floor springs, and other hardware accessoriesrequirenobatteryorpowerwiring. KËTA provides eco-friendly hardware solutions wherein their products are temperature sensitive, resilient and cost effective, benefitted for residential and commercial applications. KËTA's proven success of providing advanced and reliable hardware fittings and solutions has served the architects and contractors who desires superior building technology for their clients. With their comprehensive and progressive solutions across countless homes and businesses, KËTA has witnessed high- performance formulation delivery that is cost-effective and environment-friendly. KËTA believes in resource conservation, sustainable manufacture, product-recycling and waste & water management in order to conduct best environmental practices. KËTA research ways to reduce or eliminate unhealthy compounds from their manufacturing processes. KËTA partners with green home designers, architects, builders, interior designers and contractors to enhance our corporate environmental responsibilities and helpsbuildingsustainableobjectivestowardsthesociety. Advancedtechnologyandeco-friendlydesign Craftedwithindividualcomfortandglobalsustainabilityinmind Optimiseenergyusewhilemaintainingstructuralflexibilityandfunctionality Emission-compliant Contributortoenergyconservationtechnology Sustainabletoconsumersacrosstheresidentialandcommercialspectrum Security is the top priority for most of the people because no matter where their house or other establishments are located. Hence, it isnecessaryforeveryonetoensurethattheirabode/establishmentsarewell-equippedwithbestsecuritymeasures. So,keepingthedireneedforqualityanddurableLock&SecuritySystemsinmind,KËTAstrivestocome-upwithlatestandadvanced security solutions. KËTA's locking and security products are strong, durable, computerized and based on suitable confirmation techniques.KËTAwillgiveyouatruesenseofquality,peaceofmindandbeautyyouexpectfromtheaccessoriesyouuse. Moreover, true to KËTA's tradition and reputation, KËTA's Locks & Security Systems are the products of deep quality and craftsmanship and are meticulously crafted of the finest materials and with utmost attention to details and all of these are done to providetheutmostprotectionforyourfamily. OurState-of-the-artLockingsystemsinclude:- MortiseLocks NightLatches CylindricalLocks EuroprofileCylinders INSPIRATION
  • 7. Realtors FABRICATOR For the builders and realtors, KËTA participates right from the inception of any project, be it a renovation project or property development. KËTA collaborates with the architects who are involved in realty projects and seek approval for KËTA's architectural hardware products and fittings for construction projects. KËTA strongly believes in matching their services to every individual client'sneedsandservesthemastheirstrategicpartnerinhardwarefittingsandsolutions.KËTAalsoprovidesmodernarchitectural consulting for the large building structures along with post-implementation support. KËTA collaborates for clean and green technology for socio-environmental responsibilities, with functional and structural deliverables to every client's attention. KËTA executes their projects in an effective environment for their clients, integrating with proper definition and delivery of their hardware fittings solutions to them. KËTA's team is involved in formulating a long-term engagement strategy with the realtors, in the process, gaining intimate knowledge of their business operations and requirements. KËTA complies with industry standards and frameworks, as well as engage themselves in testing and project roll out to accomplish every proposition, both residential and commercial. KËTA collaborates with Aluminium and Glass fabricators for architectural and structural applications, with each major function and value to their projects. KËTA strongly believes in matching their services to every individual client needs and serve them as their strategic partner in glass and aluminium fitting solutions. KËTA provides toughened glass with its fittings for glass windows, partitions and other glass concepts of world class building structures. KËTA also assist with aluminium products and fittings for railings,providingacompletesolutionportfoliotothefabricators.KËTA highlyefficientcustommanufacturingoperationshelpsthe fabricators in all kinds of glass fittings solutions including spider fittings, slider glass door fittings, glass partitions and hinges, rotational glass door fittings, and various others. KËTA partners in projects, participate with their product range for contributing to energy efficiency and green practices of architectural set ups, and thereby helps to create a sustainable architectural solution for hardwarefittings. KËTA executes their projects in an effective environment for their clients integrating with proper definition and delivery of their hardwarefittingssolutionstothem.KËTA'steamisinvolvedinformulatingalong-termengagementstrategywiththefabricators,in the process, gaining intimate knowledge of their business operations and requirements. KËTA complies with industry standards and frameworks, as well as engage ourselves in testing and project roll out to accomplish every proposition, both residential and commercial. SERVICES
  • 8. ARCHITECT INTERIORDESIGNER KËTA's engagement model outlines the relationship between their services and the architects, with each major function and the value it brings to their projects. KËTA strongly believe in matching their services to every individual client needs and serve them as their strategic partner in hardware fittings and solutions. KËTA prepares mock-up of building structures based on the knowledge about the concerned property, its interiors and exteriors, and integrate architectural hardware solution to provide an actual view of the outstanding project. KËTA assist with drawings and specifications of required hardware products, theirdesignandspacerelatedaspects,inorder toprovideacompletesolutionportfolio. KËTA collaborates for projects, participate with their product range for energy efficient and green buildings, and thereby create a sustainablearchitecturalsolutionforhardwarefittings. KËTA executes their projects in an effective environment for their clients integrating with proper definition and delivery of their hardware fittings solutionsto them. KËTA's team is involved in formulating a long-term engagement strategy with the architects, in the process, gaining intimate knowledge of their business operations and requirements. KËTA comply with industry standards and frameworks, as well as engage themselves in testing and project roll out to accomplish every proposition, both residential and commercial. KËTA collaborates with interior designers to showcase the interior aesthetics and setting of any location, in the process, integrates their products with the decorative appeal of any room. KËTA strongly believes in matching their services to every individual client's needs and serves them as their strategic partner in hardware fittings, accessories and solutions. KËTA helps in product portfolio optimization for the designers and provide delivery of products side, from drawing to conception and positioning. KËTA helps in spatial intelligence of interiors based on architectural hardware accessories designs and assure quality for operations.KËTA'sproducts are aestheticallydisposedand are safety enabled for the users. KËTA conducts requirements collection and analysis for the interior designers and thereafter sets the scope of products accordingly. KËTA provides complete solution design including a three dimensional definition, lighting effects and its integration withthehardwareproductsinplace. KËTA executes their projects in an effective environment for their clients integrating with proper definition and delivery of KËTA's hardware fittingssolutionsto them. KËTA assiststhem withconsultingservices on how interior decorators can re-use materials for sustainable practices. KËTA's team is involved in formulating a long-term engagement strategy with the designers, in the process, gainingintimateknowledgeoftheirbusinessoperationsandrequirements.KËTAcomplieswithindustrystandardsandframeworks,
  • 9. SOME OF OUR PROJECTS GGGooovvveeerrrnnnmmmeeennnttt BBBuuuiiillldddiiinnnggg PPPrrrooojjjeeeccctttsss::: Parliament Library Project, New Delhi. DMRC - Delhi Metro Rail Projects, Training School, Workshop, Metro Stations, New Delhi, Bangalore , Jaipur , Kochi Parliament Extension Building, New Delhi. Comman Wealh Games 2010,New Delhi. ..............................................and many others. OOOffffffiiiccceee CCCooommmpppllleeexxxeeesss &&& IIInnnsssiiitttuuutttiiiooonnnaaalll BBBuuuiiillldddiiinnngggsss::: Khalsa Heritage Complex , Anandpur Sahib , Punjab Darga Chare- Sharief , Srinagar Div.Commisionor Complex Office , Jammu Impa Complex , Sidhra , Jammu New Delhi City Center, Parliament Street, New Delhi. Xansa India Ltd. , Noida. C.I.E.T. Building, Dept.. of Space , New Delhi. ..........................................and many others. EEEmmmbbbaaassssssyyy PPPrrrooojjjeeeccctttsss ::: U.S.S.R. Cultural Center, New Delhi. U.S.S.R. Embassy Residences, New Delhi. U.S.S.R. Embassy, Economic Dept.. Bldg., New Delhi. Sri Lanka High Commission Residences, New Delhi. Sri Lanka High Commission Pilgrimage Rest House, New Delhi. . ..............and many others. LLLIIISSSTTT OOOFFF PPPRRREEESSSTTTIIIGGGIIIOOOUUUSSS BBBUUUIIILLLDDDIIINNNGGGSSS WWWHHHEEERRREEE OOOUUURRR PPPRRROOODDDUUUCCCTTTSSS AAARRREEE UUUSSSEEEDDD:::
  • 10. OUR PRODUCTS FFFooorrreeeiiigggnnn PPPrrrooojjjeeeccctttsss ::: Mahatma Gandhi Institute, Moka, Mauritius. Indira Gandhi Memorial Hospital, Maldives. ............................................and many others. UUUnnniiivvveeerrrsssiiitttiiieeesss &&& EEEddduuucccaaatttiiiooonnnaaalll IIInnnssstttiiitttuuutttiiiooonnn PPPrrrooojjjeeeccctttsss ::: MVDSB University , Katra , Jammu Jawahar Lal Nehru University, New Delhi. Govt. Polytechnic College , Riasi , Jammu Guru Nanak Dev University, Amritsar. Kumarganj University, Faizabad.(U.P.) Hamdard Educational Campus, New Delhi. ...........................................and many others. HHHooossspppiiitttaaalll aaannnddd MMMeeedddiiicccaaalll IIInnnssstttiiitttuuutttiiiooonnn PPPrrrooojjjeeeccctttsss ::: Dental College , Jammu Gandhi Nagar Hospital , Jammu Primary Health Center , Badgam , Srinagar Sub-District Hospital , Kokernag , Srinagar Rajindra Hospital , Patiala , Punjab Sanjay Gandhi P.G.I. of Medical Sciences Complex, Lucknow. Kasturba Gandhi Medical College, U.P. Batra Hospital, Tughlaqabad, New Delhi. Lady Hardinge Medical College , New Delhi E.S.I. Okhla Hospital Complex, New Delhi Rajinder Prashad Super Speciality Hospital, Kangra , Himachel Pradesh NEIGRIHMS Project, Shillong. Meghalaya. ................................................and many others. SOME OF OUR PROJECTS
  • 11. RRReeesssiiidddeeennntttiiiaaalll TTTooowwwnnnssshhhiiipppsss,,, SSSpppooorrrtttsss aaannnddd MMMiiisssccc... PPPrrrooojjjeeeccctttsss ::: DLF SILVER OAK Apartments, Gurgoan. DLF Qutab Enclave Township : Flats, Town Houses & Villas in Phase 1,2,3,4. DLF CORPORATE PARK Commercial Complex, Gurgoan. DLF Ricmond Park I, Gurgoan. DLF Ricmond Park II, Gurgoan. Unitech Limited, Flats, New Delhi. Eros Charmwood Village Cottages, Surajkund. MARUTI CHAKKARPUR Co-operative Group Housing Colony, Gurgoan. (1100 Flats) MARUTI Employees CHANDERLOK Houses, Phase 4 DLF Qutab Enclave, Gurgoan. Media Center Society Cottages, Gurgoan. Nuclear Science Center, Staff Housing Colony, New Delhi. TATA Fertilizers Officers Housing Colony, Babrala. U.P. Housing at Afro Asian Games Site, Andrews Ganj, New Delhi. Asian Games Village Complex, New Delhi. ESSAR STEEL 400 nos. Sea Side Villas Township, Hazira. Civil Aviation Trainig Centre Complex , Bamrauli , Allahabad. .................and many others. SOME OF OUR PROJECTS
  • 12. OUR PRODUCTS Mortise Lever Handle Mortise Lock Euro Profile Cylinder Pull Handles Floor Spring Towerbolt Hinges Door Closer Door Stopper
  • 13. OUR PRODUCTS Patch Fittings Canopy Fittings Glass Hinges Sliding Door Handles Glass Connectors Glass Sliding System Spider Fittings Routel
  • 14. Corp. Office : A-218, Vikas Puri, New Delhi-110018 (INDIA) DORMAT INDIA INDUSTRIES Web : www.keta.in Mail : info@keta.in Contact : +91 99-1112-1234 011-4563-0841 Follow us on : facebook.com/ketahardware twitter.com/ketahardware linkedIn.com/company/keta