001 Controlling Corona 20201113_01 (1).pptx

Current state of Corona Research:
Missing Forest for the trees
Research is to See what everybody else
has seen,
And
To think what nobody else has thought.
------Albert Szent-Gyorgyi, A Hungarian Scientist. Nobel Laurate,
Medicine, 1937, Vitamin C.
So many saw the apple falling, But Newton said
it was The Gravity and Rest is History.
1
Drs Ashok and Padma Marwah

Corona:
Surviving without Fear
But how? : Things are easier said than done
There is an old saying
“Wanna fight your enemy!!”
Then Know thy enemy First
So let us first try to know our enemy, this
Tiny Big virus: Mr. Corona (Covid-19)
Corona : A Life-Style Disaster
Disclaimer: This pdf proposes home remedies, is not a substitute to medical advice. Do not stop any
medication, seek medical advice, as necessary. Photographs: courtesy Google unless cited.
2

Corona:
Surviving without Fear
A common-sense test for COVID Infection
Eat a little sugar/honey/jaggery every day
If it tastes sweet, We are unlikely to have corona
Smell a fragrance/flower/rose water every day
If it smells OK, We are unlikely to have corona
Have oximeter : Measure oxygen level; >97
unlikely to have corona
Disclaimer: This pdf proposes home remedies, is not a substitute to medical advice. Do not stop any
medication, seek medical advice, as necessary. Photographs: courtesy Google unless cited.
3

Summary
1. Please add a few bits of any bar soap to hand sanitizer
It may become extremely effective against corona
Always apply before going out
2. Add a spoon of salt to about one litter water, rotate a bar
soap 5 times. Boil water, please add half spoon zeera
azwain powder and a few drops of Euclyptus oil; and inhale
steam through nose as well as mouth. Once a day but if
corona positive then 3 to 4 times a day or more. Apply a few
drops of coconut oils in each nostril after steaming.
If allergic to soap-smell then add half spoon coconut oil instead of soap
before inhalation
3.Add some salt to warm water, dip a bar of soap in water and
remove immediately
Gargle with this water every day but if corona positive then 3
to 4 times a day or more
It may destroy any virus and bacteria present in the throat and will
prevent them from reaching lungs etc.
4

Summary
4. Please drink Kamlesh ji ka Kada once a day. but if corona
positive then 3 times a day
5. Please do Jal neti once or twice a week but if corona
positive then once a day
6.Please do Oil pulling once or twice a week but if corona
7. Sun bathing 10-15 mins a day and as often as possible
8.Eat as much and as many fruits as possible
9. Vitamin B complex & Vitamin C; Zinc once or twice a week
but if corona positive then once a day for one week
10. If no kada then coronil vati or denguenil vati
And this will boost immunity and may save us from all sorts
bacteria and virus and may help us in staying healthy 5

What is a Virus: a DNA or an RNA
Corona is Made of ~30,000 units (mind boggling)
6
A single unit

Nucleotides Building Blocks for RNA/DNA
These are the chemical body uses to make RNA and DNA
7
O
Same nine chemicals for All : virus , bacteria, insects , animals,
Human etc.

Naked Virus vs. Enveloped Virus
A virus encased within a lipid bilayer (phospholipids or phospho
soaps) is called an enveloped virus.
The envelope holds viral glycoproteins, which facilitate entry of
the virus into a host cell by binding host cell receptors. Once the
envelop is destroyed, the enveloped virus loses its functional
receptors and is unable to infect any more.
Corona is Enveloped Virus
Break the Envelope ! Corona is broken !!
8
Fig.: https://iowaclimate.org/2020/02/11/coronavirus-101/

9
Fig.: https://iowaclimate.org/2020/02/11/coronavirus-101/

10
Corona Virus: Electron Microscope Image
Thin, 5nm, Lipid Bilayer (envelope) is clearly seen
Image source NIAID-RML

Corona [COVID-19 ]Virus: Know thy enemy
All that we have to do is to destroy something thinner than the
thinnest soap bubble, and problem should be gone for the good.
11
Lipid Envelope, very thin; ~5 nanometer (nm)
(0.000005 mm) Soap & temperature will likely
dissolve the layer
A soap bubble, 10 to 1000 nm thick, normally
200 nm thick; a human hair ~50,000 nm thick
Corona envelope (lipid bilayer)
is thinner than the thinnest
soap bubble
should we be Scared!!!!
I hope not!!!
Fig. source Wikipedia

12
Corona envelope is thinner than the thinnest soap bubble
Fig. source Wikipedia

Know thy enemy first
Attacks persons with poor immune system
Corona virus is big and heavy for a scientist
(~30,000 bases, Mol. Wt. in millions, weight of
Oxygen is only 32). Doing research extremely
difficult and rather complicated.
It is an enveloped virus
Proteins poke out of the envelopes
S-Protein responsible for initiating
multiplication by attaching to ACE-receptor.
Too small for us (~0.1 micron), can pass through
all and any filter.
13
Image source NIAID-RML Drs Ashok and Padma Marwah

Corona [COVID-19 ]Virus: Know thy enemy
Corona virus is a Parasite and can not survive on its own.
It needs a host (Human) to survive and multiply.
It primarily enters a person through mouth and nose then
after a few days, enters the lungs to cause havoc there.
A non-vegetarian Virus
Fig. source Wikipedia , https://commons.wikimedia.org/wiki/File:Coronavirus_virion_structure.svg
14
Lipid (soap) Bilayer,
very very very thin, 5 nm
Destroyed by soap &
temperature

Fig. source Wikipedia , https://commons.wikimedia.org/wiki/File:Coronavirus_virion_structure.svg
15
Lipid (soap) Bilayer, too
thin, 5 nm only
(Destroyed by soap, Heat
Vibrations (pranayama) ?
RNA destroyed by antiviral
drugs BUT ???
Ashwagandha?
Destroyed/controlled
by Zinc, Copper
Kamlesh Kada
Ashwagandha
havan ,
Yoga
Jeera oil??
70% alcohol Destroyed by
Vaccine By
creating
antibodies
BUT ???

Corona Virus Lipid Bilayer: Know thy enemy
16
COVID-19 virus is coated with lipid bilayer. This lipid bilayer is very thin. Its
thickness is less than 5 nanometer or 0.000005 mm.
Lipids are likely to be destroyed by soap (lipid).
For Fig. MDougM -https://commons.wikimedia.org/w/index.php?curid=5560155

Corona Virus Lipid Bilayer: Know thy enemy
17
Phosphorus (P)
Soap tails

Know thy enemy :What are Lipids?
Lipids are water insoluble organic compounds rich in carbons and
hydrogens. For a layman, simplest examples are : Oils (mustard,
ground nut, coconut, til, ghee etc.
18
Figure source :Wikipedia

What are Soaps?
Soaps (Lipids) are salts often sodium (Na) of Oils (mustard, ground
nut, coconut, til, ghee etc.
19
Fig. source: Smokefoot - Own work, CC BY-SA 3.0, https://commons.wikimedia.org/w/index.php?curid=20293318
Hydrophobic portion Hydrophilic end
Hydrophobic portion inserts itself into nonpolar materials like oil or
Membrane layer of corona virus; while hydrophilic end inserts itself
into water
Replace one carbon with Phosphorus, to make corona shell

Lipid Envelope Rupture Mechanism
Break the Egg, It can not and will not hatch
20
Fighting the SARS CoV-1 2 (COVID-19) pandemic with soap, Chaudhary et al. Preprints (www.preprints.org) | Posted: 7 May 2020

Soap may disrupt Corona envelope
21
https://internewscast.com/why-soap-works/ Drs Ashok and Padma Marwah

Entrapment of COVID-19 by Soap(Sodium Stearate
22
Soap molecules surround virus completely and thus remove it from
the surface
Fighting the SARS CoV-1 2 (COVID-19) pandemic with soap, Chaudhary et al. Preprints (www.preprints.org) | Posted: 7 May 2020

Controlling COVID-19 Virus Epidemic
In absence of a vaccine , We propose the followings to build up
immune system and to prevent/Control COVID-19 virus.
[1] Sodium Stearate (Desi bar Soap) hand
sanitizer/gargle, steaming etc.
[2] Covid 19 Immuniy Booster Kit of Patanjali and/OR
Ayurvedic Kada prepared from ashwagandha, giloy,
tulsi, mulethi etc. (Kamlesh ji ka Kada)
[3] Yoga and Pranayama.
[4] Vegetarian Satvic food
[5] Vitamins and Minerals
[6] Oil Pulling with coconut oil
[7] Jal-Neti
[8] Hawan
. 23

Controlling COVID-19 with Sodium Stearate (bar soap)
In absence of a vaccine , We propose sodium stearate to
prevent/Control COVID-19 virus.
[1] Sodium Stearate (Desi bar Soap) hand
sanitizer
[2] Steaming with Sodium Stearate (Desi bar
Soap) and essential oils
[3] Sodium Stearate (Desi bar Soap) mouth wash
and gargle.
[4] Sodium Stearate (Desi bar Soap) inhaler
We are not wedded to sodium stearate. Instead of sodium stearate salts of any long
chain fatty acid (palmitic, oleic etc.) or their hydrophilic esters such as glycerides,
glycolates etc. can be used.
24

Don’t be Scared of Soap: We eat it every day
Sodium stearate; a food/beauty additive (FDA, USA; 2%).
25

Don’t be Scared of Soap: We eat it every day
Sodium stearate; a food additive, up to 2% (FDA*); Present in
processed and packed foods, Beverages, Health & Personal care
products , Pharmaceuticals, Agriculture/Animal Feed/Poultry etc.
26
We love to eat soap!! :Pastries & Cakes , bakery
(brighter in color and crispy to eat thanks to soap).
The Latest Craze: Fat-free, starch-free, low-glucose
products, ~1% soap (sodium stearate).
And the ubiquitous chewing gum, Eyeliner,
Eyeshadow, Mascara, Lipsticks, Blushers, Face
powders, Foundations. Fragrances, Deodorants,
hair & skin care Pdcts. Tooth paste, many more
uses: binder, emulsifier, anticaking agent in food.
*e-CFR (2020) Electronic code of Federal Regulations, 21.1.B.172.
https://gov.ecfr.io/cgi-bin/text-
idx?SID=dbacba7624ebbb4f3cd18fcce50925aa&mc=true&node=pt21.3.172&rgn=div5.

Like likes like. (Birds of a feather……)
Like dissolves like.
A lipid will dissolve a lipid.
Like destroys like.
A lipid will destroy a lipid.
Conclusion: Soap will likely destroy COVID-19
Since COVID-19 has an outer lipid (soap) layer of
0.000005 mm (~5 nm) thickness, its interaction with soap
(lipids) will likely destroy this layer and inactivate the
virus. The 20 seconds rule.
Increasing the temperature will exponentially speed up its rate of
inactivation and will drastically reduce the time required. It does not
survive on copper for more than four hours .
27

COVID-19: Sodium Stearate hand Sanitizer
Home Remedy
Please add a few drops of liquid hand washing soap or a
few tiny pieces of bathing soap ( Hamam, Dettol soap,
Rexona, Patanjali bath soap, Liril etc.) into hand sanitizer
bottle. Shake well. Corona Hand Sanitizer is ready
When applied , it will evaporate leaving behind a micro layer of sodium stearate
(soap).
This micro layer of soap will protect the hands, and corona virus if contacted, may
not survive for long.
This sanitizer may work till hands are washed again.
.
Recommended Frequency: As often as needed
Sodium stearate at 0.01 to 1% is completely harmless and non-toxic.
28

Alcohol in Sanitizer: What does it do?
Alcohol denatures (unfolds, kills) the proteins
instantaneously.
Alcohol Must be 70% or more
Vodka ~40% only; Tequila ~ 40% (35% to 55%)
Drinking any kind of wine will not kill Corona virus,
besides virus sits in lungs not stomach.
29
DEAD
Biologically active
>70% Alcohol

COVID-19: Sodium Stearate hand Sanitizer
Home Remedy: Alcohol Free
Please add a few drops of liquid hand washing soap or a
few small pieces of bathing soap ( Hamam, Dettol soap,
Rexona, Patanjali bath soap, Liril etc.) into one glass of
RO or boiled water; add one spoonful glycerin; shake well.
Corona Hand Sanitizer is ready
When applied , it will evaporate leaving behind a micro layer of sodium stearate
(soap).
This micro layer of soap will protect the hands, and corona virus if contacted, may
not survive for long.
This sanitizer may work till hands are washed again.
.
Recommended Frequency: As often as needed
Sodium stearate at 0.01 to 1% is completely harmless and non-toxic. 30

How to make Liquid Soap
1. Please Take one bar soap (80-100 gm) or soap scraps
2. Cut into small pieces
3. Add water (2-2.5 L) 95 gm
4. Add two spoons glycerin (25 ml)
5. Heat slowly till soap dissolves 10-15 min,
6. Stir occasionally
7. Allow to stand overnight
8. Mix well
9. Fill in bottles
10.Liquid soap is ready
If too thick, then add some boiling water mix well.
2.5 Liter hand soap prepared from 95 gm soap scraps 31

How to make Liquid Soap
32

COVID-19 Virus : Mouth Wash & Gargle Solution:
Home Remedy
Step 1:Dissolve a little soap in 300 ml water by dipping a soap bar
(Hamam, Dettol soap, Rexona, Patanjali bath soap, Liril etc.) into
luke warm water ONCE.
Step 2: Add half tea spoon common salt
Use it as mouth wash and also Gargle with this solution three to five
times.
Recommended Frequency: General public : once a day
High risk Personnel: Twice times a day
Patients: Three times a day or more under medical supervision.
33

COVID-19: Soap-Steaming , Home Remedy
Step 1: cumin seeds ( Jeera): One spoon; carom seeds (half spoon,
Azwain), freshly powdered in a mixie grinder
Step 2 :Dissolve a little soap in one liter water by rotating a
soap bar into water 5 times.
Step 3 Boil the water
Step 4: Add a little jeera azwain powder, 2-3 drops eucalyptus oil, if
available, half spoon coconut oil. Jeera contains cuminaldhyde
which may react with proteins and inactivate them.
Do steaming for 5 - 10 mins, Breathe with mouth, breathe with nose.
If allergic to soap smell in nose , then do steaming without
soap but with coconut oil, still very effective. 34

COVID-19: Soap-Steaming , Home Remedy
35
Recommended Frequency: General public : once a day
High risk Personnel: Twice a day
Patients: Three times a day or more under medical supervision.
Please discord the solution after steaming, do not use again. Drs Ashok and Padma Marwah

Bhaap (steam) and Gararey (Gargle)
A company in Bhopal, M.P. (Dogra Aromatics LLP) is marketing
pouches which contain pure sodium stearate along with other
ingredients for steaming and gargling. Anyone who may be
interested in this home remedy can contact the company directly at
94 25 01 71 21 (Mr. Sunil Dogra).
36

COVID-19 Virus : Soap Inhaler
We will have to prepare an aerosol/inhaler of ordinary Desi soap.
The aerosol should release about 25 to 50 micro gram of soap per
inhalation.
Understandably in the advanced stages , we may need a combined approach
consisting of sodium stearate, zinc and vitamin D supplements, zincum
muriaticum homeopathy, erythropoietin injections, prolonged exposure to
sunlight, blood and plasma infusion etc.
Recommended Frequency: General public : none
High risk Personnel: none or may be once a day
Patients: Three times a day or more under medical
supervision.
37

Baby shampoo kills COVID-19: In vitro
It is recently reported that a 1% solution of Baby
shampoo killed Covid virus greater than 99.9% in two min
contact times.
Detergents are known virucides, and the use of intranasal
surfactants, including 1% baby shampoo has been
demonstrated to be safe and effective as a treatment for
chronic rhinosinusitis.
Johnson's Baby Shampoo Ingradients
Citric acid; Cocamidopropyl betaine Sodium benzoate;
Decyl glucoside PEG 150 distearate , Sodium cocoyl
isethionate Sodium methyl cocoyl taurate; Lauryl glucoside
Fragrance
PEG 80 Polyquaternium 10 ; Sorbitan laurate Disodium;
EDTA; glycerin 38

Controlling COVID-19: Ayurvedic Kada
Several Ayurvedic herbs are believed to have
antiviral and immune system boosting properties. We have
found that Ayurvedic Kada prepared from a complex
combination of herbs like ashwagandha, giloy, tulsi,
mulethi etc. by Kamlesh ji (Kamlesh ji ka Kada) is a
very effective home remedy.
Please contact Mr. Kamlesh Bandekar directly for this
kada at 97 66 62 11 9 6
Coronil is good but above kada is even more potent
. 39

Kada Ingradients: Ashwagandha
40

The S-Protein of Corona virus is responsible for
initiating multiplication of virus.
S-protein has 1273 amino acid and ~13% of amino acids are zinc binding amino
acids (Cysteine 40, Histidine 17, Daspartic acid 61, Eglutamic acid 47) .
These amino acids are potent nucleophiles and are capable of
reacting with epoxides subject to proper orientation and proximity
of epoxide portion of withanolides.
So the null and alternative hypothesis is that
Gargling with Kadha (काढ़ा ) made from ashwagandha
may kill/inactivate corona virus in throat.
In vivo action (drinking) of ashwagandha kada should
be similar
More research needed using molecular modelling and
LCMS and clinical trials.
41

42
S-Protein responsible for initiating multiplication.
S-protein has 1273 amino acid with ~13% of amino acids are zinc
binding amino acids (Cysteine 40, Histidine 17, Daspartic acid 61, Eglutamic acid 47)
Mol. Formula: C6252 H9593 N1609 O1821 S57 + modifications
Molecular weight: 139036+ modifications
Cf. (Immunoglobins, ~1330 amino acids with ~9% zinc binding amino acids only.)
So we can call S-protein a Zinc Hungry Protein
Feed Zinc to the Hungry Guy (Corona virus) else it may go and
attach to iron of Haemoglobin, and may cause blood clotting.

43
S-Protein: Amino acid Sequencing
Mol. Formula: C6252 H9593 N1609 O1821 S57 + modifications
Molecular weight: 139036+ modifications
TQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSN
VVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTF
EYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGI
NITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVK
SFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYN
STFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVL
AWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYT
TTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQ
FGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTP
AWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLG
ADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRA
LSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLAD
AGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAA
LQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQ
ALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASAN
LAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGK
AYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEEL
DKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYV
WLGFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT +
Modifications ( glycosylation, sugars, sulfide bonds, metals etc.
Each alphabet is an amino acid

44
Amino acids : Chemical Structures
R H K D E
S T N Q C G P
A V I L M
F Y W

Epoxides are very reactive chemicals. They contain oxygen in a
three membered ring . They react with nucleophiles very easily.
Nucleophile are molecule or groups having electron rich groups like
amino, thiols etc. DNA, RNA proteins etc. are very rich in
nucleophiles.
Epoxides can mutate DNA, RNA, proteins and render them
useless and sometimes make them more toxic. Benzene causes cancer
via an epoxide. Paracetmol damages liver via a nucleophilic reaction.
45

Nucleotides Building Blocks for RNA/DNA have
nucleophiles
46
O

Kada Ingradients. Saunf, Fennel: An Excellent
antioxidant
Antioxidants Can deactivate S-protein
Shahat et al. Molecules 2011, 16, 1366-1377; doi:10.3390/molecules16021366

Saunf (Fennel): A Wonderful Spice
Antioxidant; Antimicrobial; Hepato (Liver) protective;
Antispasmodic; diuretic, Anti-inflammatory;
Analgesic, Said to be anti-Cancer. Emmenagogue
Galactagogue. Used for colic and respiratory
disorders
Shahat et al. Molecules 2011, 16, 1366-1377; doi:10.3390/molecules16021366

Kada Ingradients: Mulethi (Licorice, Yashtimadhu
Glycyrrhiza glabra): An awesome Herb
A potential broad-spectrum antiviral agent;
Anti-Cough, Antiulcer, Anticancer, Antidiabetic,
Anti-inflammatory. >150 preparations in Ayurveda.
Excess Use may Increase blood pressure
Sharma et al.(2018) Glycyrrhiza glabra: Chemistry & Pharmacological Activity. In: Mérillon JM., Ramawat
K. (eds) Sweeteners. Reference Series in Phytochemistry. Springer, Cham.
Glycyrrhizin Isoliquiritin Glabridin
Antitussive, Demulcent, Anti0xidant
Antioxidant
Expectorant Estrogen
like
Anti viral
Platelet protector

Kada Ingradients:Giloy, Guduchi, Amirita: The Magic Herb
A potential broad-spectrum antiviral agent; Immuno booster,
Anti-oxidant. More focused studies needed
Saha and Ghosh , Anc Sci Life. 2012 Apr-Jun; 31(4): 151–159. doi: 10.4103/0257-7941.107344:
10.4103/0257-7941.107344 Many more ingredients we are still working
a
Can interfere with
corona lipid layer

COVID-19: Oil Pulling , Home Remedy
Step 1: 5 Spoon coconut oil + 5 spoon Til oil or Mustard oil 0r olive
oil. Mix and keep in a bottle, It will not solidify..
Step 2 :Take on spoonful in mouth . Squish around in mouth for 5
min. Spit it out and wash mouth with luke-warm water.
Bacteria, virus etc. will either
die or get washed out of mouth
Enveloped virus are highly unlikely
to withstand onslaught of five mins
of oil squishing.
Oil pulling is an age-old process mentioned in Charaka Samhita and
Sushratha’s Arthashastra.
Oil pulling is observed to bring improvement in oral dental hygiene
Frequency: Once a day, preferably early morning. 51

COVID-19: Oil Pulling , Home Remedy
.
52

Supportive Therapy. Adjusting Life Style
1. Sun light (Vitamin D)
2. Veg. home cooked food, Hot drinks;
3. Fruit-salad diet,
4. Ayurvedic Herbal Products
5. Health Supplements, Homeopathy
6. Yoga, Pranayama
7. SOCIAL D I S T A N C I N G
53

SUN Light / Vitamin D
~80% Corona positive cases are vitamin D deficient
Bone growth, Calcium and phosphate.
Xenobiotic detoxification,
Stress reduction,
Neuroprotective functions
Antimicrobial defense,
Anti-inflammatory
Anticancer actions,
Cardiovascular benefits
Antiaging effects
Immune system
Corona Fighter
Drs Ashok and Padma Marwah 54

Sun light Vit. D Erythropoietin
Non-Erythroid Effects Of Erythropoietin; Murat O. Arcasoy; DOI: 10.3324/haematol.2010.030213 November 2010
Drs Ashok and Padma Marwah 55

Where Sun does not go, Doctor goes
A Recipe for Total Disaster
Vit. D level in body almost zero;
I asked God: Please Please save the Princess
God Replied: “I am Sorry, I helps those who help themselves.”
Zero Vitamin D can cause Brain Stroke, bone (stress) fractures,
Cancer, Diabetes, Kidney failure and what else not!!
56

Fruits and Salad
Please say big NO to non vegetarian food including eggs and all
packed/processed food.
Please eat as much fruits and salad as possible from morning till
3 P.M. At least one to two Kg. Wash thoroughly by dipping in water
containing a little baking soda and lime (chuna, CaO) for 15 mins.
Then wash thoroughly with water.
After 3 P.M. eat home cooked vegetarian food.
This will induce cytochrome P-450 enzyme system in the body
which will drastically boost immune system, provide energy and
fight infections and diseases.
Recommended Frequency: General public : once or twice a week;
High risk Personnel: twice a week; Patients: Every day till cured.
Drink hot liquids (water, milk, tea, coffee etc.) only; eat food while
still warm/hot; Say no to anything cold.
57

COVID-19: Immuno-Supportive therapy
Ayurveda and Homeopathy Supplements: ZINC
S-Protein responsible for initiating multiplication of virus
S-protein has 1273 amino acid with ~13% of amino acids are zinc
binding amino acids (Cysteine 40, Histidine 17, Daspartic acid 61, Eglutamic acid 47) Cf.
Immunoglobins, ~1330 amino acids with ~9% zinc binding amino acids only.
So we can call S-protein a Zinc Hungry Protein
Feed Zinc to the Hungry Guy (Corona virus)
Zinc supplement: 10 mg per week.
58
Zincum muriaticum 6x , 20 drops every day.
Cook in zinc coated brass vessels
Chickpeas, lentils and beans
Peanuts, cashews and almonds
Pumpkin seeds, whole wheat
Cheese and milk
Dark Chocolates Drs Ashok and Padma Marwah

COVID-19: Story of Zinc
Zinc by itself is not an antioxidant +2 Oxidation State
d block element, 3d level full. can’t have variable valence
But Zinc is the cause of several anti oxidant systems
NADPH oxidase and superoxide dismutase enzymes
catalyse formation of reactive oxygen species (H2O2, OH
& O2 free radicals etc.).
Zn inhibits these enzymes resulting in anti oxidation effect.
Zn also induces metallothioneins: very rich in cysteine
amino acid, an excellent anti oxidant
Zinc also activates antioxidant proteins
59

Zinc is present in thousands of proteins, binds to
histidine, cysteine etc. Part of zinc fingers.
Part of hundreds of enzymes and may be thousands of
transcription factors.
Fig.: Thomas Splettstoesser (www.scistyle.com) - self-made, based on PDB structure 1A1L, the open source molecular
visualization tool PyMol and Cinema 4D, CC BY-SA 4.0, https://commons.wikimedia.org/w/index.php?curid=3106866
60
The zinc ion (green) is coordinated
by two histidine residues and
two cysteine residues.
Zn fingers typically function as
interaction units that bind DNA,
RNA, proteins, or other small
molecules
Shape retainers

Haemoglobins (RBC) contain porphyrin ring which has four
pyrrole units, iron complexes with nitrogen of these four
pyrrole units. Therefore blood is a coordinated complex of
iron and four pyrrole units
So pyrroles are the ligands(donors) and iron is the acceptor.
By Zephyris at the English language Wikipedia, CC BY-SA 3.0, https://commons.wikimedia.org/w/index.php?curid=2300973
61

As per our understanding of coordination chemistry, any
ligand stronger than pyrrole will strip RBC of the iron,
OR
Complex with iron thus preventing oxygen from attaching to
it thereby making it incapable of transporting oxygen and/or
may cause blood clotting.
S-Protein of COVID: a very good metal complexing agent.
Zn competes with iron and copper in protein binding
This also brings into picture the importance of vit. D, the
causing factor for erryrhropoetin generation, which in turn
causes the production of RBC.
So vitamin d supplement, erryrhropoetin injections and
prolonged exposure to sunlight should be part of the
prevention/treatment protocol.
62

COVID-19: A Life-Style Disaster
Hypothesis: Zinc will bind S-protein of corona virus thus
preventing corona virus from blocking hemoglobin and or
causing blood clotting.
Feed the hungry guy zinc and hopefully it will keep
away from hemoglobin (RBC).
Prior to the advent of steel,
we were using brass utensils,
periodically coated with thin layer
of zinc, and in those olden golden
days cough cold and lungs problems
(i.e. viral infections) were
Unheard of.
63

Copper: A Virus/Microbe Killer
Copper is essential to all living organisms.
The adult human body contains ~ 100 mg (0.1 g) of copper.
Copper is a natural antimicrobial agent
Copper reduces influenza and adeno virus by 75% in one
hour and by 99.999% in six hours.
Copper has a free electron in its outer orbital shell that
causes oxidation-reduction reactions.
No wonder there is so much emphasis on
storing/drinking water from copper vessels in Indian
system 64

Copper: An Essential Micronutrient
A key constituent of the respiratory enzyme complex :
Cytochrome C Oxidase.
It is the last enzyme in the respiratory electron transport
chain of cells located in the membrane and Implicated
in synthesis of ATP: The mitochondrial power-house.
4 Fe2+-cytochrome c + 8 H+
in + O2 → 4 Fe3+-cytochrome c + 2
H2O + 4 H+
out
Facilitates iron uptake, Copper
deficiency can produce anemia- Like
symptoms.
Breathlessness is one of the symptoms
Induced by Covid virus. Enough uptake of
copper may ensure proper function of
hemoglobin in the body.
ATP: Adenosine Tri Phosphate
65

Copper: A Molecular Grenade
When a microbe lands on copper,
ions/electrons blast the pathogen
like an onslaught of missiles.
This prevents cell respiration and punches
holes in the cell membrane or viral coating
creating free radicals that accelerate the kill,
especially on dry surfaces.
Most importantly, the ions seek and destroy
the DNA and RNA inside a bacteria or virus,
preventing the mutations that create drug-
resistant superbugs.
The properties never wear off, even if copper
surface is tarnished (Jim Morrison, SMITHSONIANMAG.COM, APRIL 14, 2020)
66

Copper: A COVID Virus Killer ??
Hypothesis
Copper and its salts are capable of killing/inactivating
corona virus by bombarding it with free electrons and /or by
complexing with nucleophile rich S-Protein and /or by
incapacitating the virus itself.
Addition of cupric salts such as CuCl2 and CuSO4 at ppm
concentrations to hand sanitizer and gargling solution is
likely to help in preventing/treating corona virus infection.
Drinking water from well cleaned copper
vessels will provide this much needed
micronutrient and will boost immunity
67

Ayurveda and Homeopathy Supplements if you believe in it
Arsenic albucum 30 c once a day
Boosts immune systems indirectly by reducing anxiety and fear
caused by insecurity, digestive disorders and mucosal inflammation
Camphor 200c once a day; for one week every month.
Controls head and mind
Triphla powder one spoon mix well with one spoon honey, take with
water every day preferably at bed time.
Caps/Tabs containing Giloy, Tulsi, Papaya, Anardana, aloevera
and Ashwagandha Excellent for popping up immune system.
B complex tab alternate day
Vit D tab 0.25 micro gm (if low on Vit. D) for one week.
68

Organic Health Tonic
Ginger peeled and cut One cup
Fresh Lemon Juice One cup
Jamun Cider Vinegar One cup
Grind well in mixer grinder and filter
Add Honey 4 Cups
Haldi powder one spoon
Black pepper powder half spoon.
Mix well and store in Fridge.
Every day Morning 2-3 spoons in a glass of warm water.
Feeling tired drink a glass any time
Very energetic and loaded with antioxidants
May boost immune system thus Prevent Corona.
69

Padma Ka Immuno Halwa (5 min.)
By Dr. Padma Marwah
Badam One cup
Kaju One cup
Chhoti Ealichi ten
Grind well in a mixer grinder
Add butter or cow ghee one spoon
Cooked rice while still hot 4 spoons
Brown Sugar or Gur To taste
Mix Thoroughly. Eat fresh.
One-two spoons a day after meals
May Speed up Metabolism
May Boosts immune system.
Several variations can be prepared 70

Padma ke Immuno Laddoos
By Dr. Padma Marwah
Badam (Almonds) One cup
Kaju (Cashew) One cup
Chhoti Ealichi ten
Makhane three cups
Coconut powdered one cup
Grind well in a mixer grinder
Bhuna Atta/besan/suji as needed
Honey To taste
Mix Thoroughly, make Laddoos and store in Fridge.
One –two laddoos a day
May Speeds up Metabolism, Boosts immune system.
and Provides instant energy
Several variations can be prepared 71

Home Remedies
Whole Milk one cup, water one cup; Boil; Add ½ spoon
cow ghee, 1/8 spoon haldi and 1/8 spoon black pepper
powder. Tumble well till ghee disappears; Drink hot.
Apply cow ghee/coconut oil in both nostrils every day and
add a few drops of mustard oil in both ears twice a week
Drink hot/warm water only.
Make a mixture of equal parts of Jeera, azwain, kalonji,
saunf and methre. Boil one spoon in water for 10-15 min.
Add honey, lemon turmeric powder and drink hot. Corona
and many health problems will disappear slowly.
72

Jal Neti
Jal Neti: To clean nose and throat and to remove any bacteria
and virus hiding there. Frequency : Every day if going out
Luke warm water one glass, add common salt half spoon
And keep corona and many health problems away
73

Yoga and Pranayama.
Bhastrika to supply more oxygen to body and clean lungs.
Anulom Vilom to supply more oxygen to Brain
Bhramari and OM to create vibrations and energy in the
body.
Kapal Bhati to activate Brain, liver, kidney, spleen,
pancreas, heart, Pituitary Gland, Lungs etc.
Surya Namaskar: A sequence of dozen yoga poses to keep
body active and fit.
Recommended Frequency: General public : minimum 30 mins
per day;
High risk Personnel: minimum 2x30 mins per day
Patients: 2 to 4 hrs per day. Chant OM as much as possible.
74

75
Vibrations can cause resonance &Destruction
Gargling can control covid by destroying/dislodging virus.
Pranayama causes vibrations leading to its weakening/destruction
Vibrations caused by OM
+

ओ३म् (ॐ) Om
The human ear can hear frequencies from
20 Hz to 20 kHz.
Frequency of human speech is 85 to 255
Hz.
Om causes vibrations at multiple
frequencies covering almost all of the normal
audible range (20-2000 Hz). We can say it
creates a band of multiple frequencies.
Higher the frequency more the energy

Energy frequency spectra of waveform OM
432, 528, 186, 7.6 ???
OM sound consists of multiple frequencies, enabling it to
cause vibrations/resonance simultaneously in many things
Cf. Ion Trap Mass spectrometry
Spectral Analysis ----Omkara; Devi et al. Ind. J. Trad. Know. 3 (2) 2004, 154-161
Female
Male

Nucleotides Building Blocks for RNA/DNA
78
O

Favipiravir (A) is a similar but not same compound
Cellular enzymes of the body confuse it with nucleotide bases, and
add ribose and phosphate to it as if it was a part of a nucleoside
sequence (B).
Virus DNA/RNA while replicating use this pseudo nucleotide (B)
resulting in mutagenicity which leads to the death of the virus.
Impressive BUT
But by the same logic it can also interfere with human DNA/RNA as
well and is suspected to be a possible teratogen. 79

Favipiravir demonstrates a favorable safety profile
regarding total and serious adverse events in short term
use.
However, safety concerns remain:
Hyperuricaemia (high uric acid),
Teratogenicity and
QTc (serious irregular heart rhythms, arrhythmias)
prolongation have not yet been adequately
studied/reported.
80

Teratogenicity
A teratogen is an agent that can disturb the development of
the embryo or fetus. Teratogens halt the pregnancy or
produce a congenital malformation (a birth defect). Scary
81
What else can happen ????

Safety profile of Favipiravir has recently been reviewed
“Given the limitations of the evidence and unresolved
safety concerns, caution is warranted in the widespread
use of Favipiravir against pandemic COVID-19.”
A review of the safety of Favipiravir – a potential treatment in
the COVID-19 pandemic?
Journal of Virus Eradication 2020; 6: 45–51
Victoria Pilkington Toby Pepperrell, Andrew Hill
Faculty of Medicine, Imperial College London, London, UK
MetaVirology LTD, London, UK,
Department of Pharmacology and Therapeutics, University of
Liverpool, Liverpool, UK
82

Ribavarin , a similar drug, also suffers with
similar problems.
Common side effects include feeling tired,
headache, nausea, fever, muscle pains, and an
irritable mood.
Serious side effects include red blood cell
breakdown, liver problems, and allergies.
Use during pregnancy results in harm to the baby.
Effective birth control, for both males and
females for at least seven months
during and after use.
83

Remdesivir is an antiviral drug of said promising effects
and several clinical trials are on going to determine its
safety and effectiveness against the COVID 19.
BUT
There is an existing data of about 25% patients receiving
remdesivir having severe side effects including multiple
organ dysfunctions, septic shock, acute kidney injury and
low blood pressure. Another 23% showed evidence of liver
damage.
84

WARNING WARNING
WARNING
THIS SYSTEM [human being] IS
SUBJECT TO BREAKDOWNS
DURING PERIODS OF
CRITICAL NEEDs.

A special sensor in the humans called
“immune system” senses the person’s
emotional state in terms of how
desperate he or she is.
The “immune system” then creates a
malfunction proportional to the
desperation ( stress ) of that Person.

Getting Scared of Corona: Virus
will multiply very fast .
Depressed!!!, Oh NO! Nothing
else makes COVID happier.

Angry!! Threatening others
(family, spouse, friends) with
violence: Aggravates the
situation.
Likewise, attempts to ‘boss’ on
others may cause them to also
malfunction.

THE REMEDY
Follow Lipid (soap) therapy
Keep cool and smile,
Be positive, Say nice things,
Laugh to your heart’s content,
Regularly do Yoga and Pranayama
Take sun bath, be vegetarian etc.
And Corona will die a peaceful death.

Acknowledgements
Mr. Bhagwan Das
Dr. M. R. Marathe
Prof. Jyoti Marwah, Ph.D.
Dr. K. K. Pandey, Ph.D.
Dr. Anil Agnihotri, Ph.D.
Prof. Sudha Jain, Ph.D.
33

Any Questions or Doubts, need a copy of the presentation:
Please Contact
Dr. Ashok Marwah Ph.D., 98 34 97 64 98;
akmarwah@gmail.com
Dr. Padma Marwah Ph.D. 98 34 90 19 47;
padma.marwah@gmail.com
91

Summary
1. Please add a few bits of any bar soap to hand sanitizer
It may become extremely effective against corona
Always apply before going out
2. Add a spoon of salt to about one litter water, rotate a bar
soap 5 times. Boil water, please add half spoon zeera
azwain powder and a few drops of Euclyptus oil; and inhale
steam through nose as well as mouth. Once a day but if
corona positive then 3 to 4 times a day or more. Apply a few
drops of coconut oils in each nostril after steaming.
If allergic to soap-smell then add half spoon coconut oil instead of soap
before inhalation
3.Add some salt to warm water, dip a bar of soap in water and
remove immediately
Gargle with this water every day but if corona positive then 3
to 4 times a day or more
It may destroy any virus and bacteria present in the throat and will
prevent them from reaching lungs etc.
92

Summary
4. Please drink Kamlesh ji ka Kada once a day. but if corona
positive then 3 times a day
5. Please do Jal neti once or twice a week but if corona
6.Please do Oil pulling once or twice a week but if corona
7. Sun bathing 10-15 mins a day and as often as possible
8.Eat as much and as many fruits as possible
9. Vitamin B complex & Vitamin C; Zinc once or twice a week
but if corona positive then once a day for one week
10. If no kada then coronil vati or denguenil vati
And this will boost immunity and may save us from all sorts
bacteria and virus and may help us in staying healthy 93

001 Controlling Corona 20201113_01 (1).pptx

Recommended

Recommended

More Related Content

Similar to 001 Controlling Corona 20201113_01 (1).pptx

Similar to 001 Controlling Corona 20201113_01 (1).pptx (13)

Recently uploaded

Recently uploaded (20)

001 Controlling Corona 20201113_01 (1).pptx