SlideShare a Scribd company logo
1 of 3
1. In our openingsequence we includedthe mostimportantcreditssothatthose are theypeople
whoget the mostrecognition. The Girl withthe DragonTattoo alsousedthistechnique.Afterthe
firstfive creditsthatwere shown, whichwere the productionanddistributioncompaniesandthe
mainactors of the film,the title wasshown.Afterthis,the restof the importantcreditscontinued.
As well asthis,inbetweenthe creditswe had shortclipsof what hadhappenedpreviousto the
eventsthatwouldactuallybe happeninginthe film.Theybuiltupa storyline andmade the audience
understandaboutwhatwouldbe happeningandwhy.Thisisusedinotherfilmstooforthe exact
same reason,itquicklygivesthe viewersanunderstandingof the narrative. ‘MissionImpossible –
Ghost Protocol’ showsclipsinbetweencreditstoshow whatishappeningsothatthe filmwill start
rightaway by justcontinuingwhathasbeenshown, ratherthanstartingcompletelyfromnothing.It
alsogivesthe audience aclearunderstandingof whattype of filmitisgoingto be by containing
fightinganda burningfuse throughoutthe entire openingcredits,
(https://www.youtube.com/watch?v=GJCvU-91eAo).The motherinthe filmislookingverywornout
and as if she is witheringaway.Witha bottle of wine inone handanda syringe inthe other,the
audience canclearlytell thatshe isa severelydepressedwomanwhohashitrockbottom. The news
reporterlooksprofessional andalsotalksveryclearly.Before she evenbegantospeak,youcouldtell
that itwas aboutto be a newsreportbecause of the wayshe wasstoodin the camera shotand her
surroundings.We hada close upof the syringe aboutto be put intothe mothersarm, thishighlights
the importance of thisspecificitemand letsthe audience knowthatitwill be a bigthingthroughout
the whole film.The filmSe7en alsousedcloseupsof itemsinthe openingcreditsasit exaggerates
the importance of those specificitems,suchas blades,scrapbooksandgoryphotographs,which
makesthemseemmore dramatic. The musicthat we chose to go overthe backgroundof the
openingsequence wasslowandmeaningful.Itfitinwiththe storyline assomethingtraumatichad
happened. Itisveryoftenthatthe backgroundmusicfitsinwiththe actual storyof the filmasit
makesyouunderstandthe scenarioandalsogetsyour mindreadytowatch that certaingenre of
film.
2. As soonas you sawthe motherinthe title sequenceof ourfilmyoucouldtell thatshe wasclose
to the people whowere inthe crashsimplybecause of how muchof a badway she was in,her
drainedface andpale complexioninstantlygivesthe audiencethe ideathatshe doesn’tlook after
herself andherveryslimbuildisthe typical bodyof somebodywhohasturnedtodrugsand alcohol
duringa toughtime intheirlives. Aswell asthis,she wascompletelysurroundedbyemptywine
bottleswhichwasthe shotthat confirmedthatshe wasan alcoholic.The newsreporterhada big
luxuriouscoatonand herhair and make-upwasdone veryprofessionally,thisshowsthatshe hasa
veryimportantjobto broadcastnewsto people all overthe country andthat she iswell paidand
lookedafterbythe crewshe worksfor.
3. 20th
CenturyFox distributedthe film‘Gone Girl’whichisof a similargenre andstoryline toour
film‘Astray’.Theyare bothmysterythrillers whichare verygripping.Thiscompanywouldbe agood
one to distribute ourfilm asitalsodistributedall three of the ‘Taken’films. 20th
CenturyFox have
goodexperienceindistributingfilmsof thisgenre whichusuallyturnouttobe a huge success,this
makesthemthe bestcandidate todistribute ‘Astray’astheyknow exactlywhattheyare doing
whichmeansthat we couldtrustthemwitheverythingtomake sure thatour filmis a successrather
than a huge failure. Aswell asthis,20th
CenturyFox are alwayssearchingforsmall independentfilms
to make and distribute astheydone justfocusonhuge blockbusterfilms. The partof 20th
Century
Fox that wouldactuallydistributeoutfilmwouldbe the sistercompany,Fox SearchlightPictures. It
specializesinUSdistributionof independentandBritishfilms whichwouldbe perfectforus.
4. The targetaudience forour filmwouldbe bothmale andfemale andthe filmwouldmostlikelybe
a certificate of 15. As well asthis,the people whowouldbe attractedtoourfilmwouldbe those
whoare alreadyintothatspecificgenre of film(thriller) astheyare the oneswhoare alwayslooking
out fornewfilmssimilartothe onesthatthey’ve seenbefore astheyfoundthemgrippingand
interestingsotheyalwayswantmore. Ourmediaproductisfor people wholike all filmswhichare
somewhatgripping.If theylikeotherfilmsof the same genre,theyare mostlikelytoenjoythisone
too.Anybodywhodoesn’tandneverhashadan interestinthistype of filmtendtonot be attracted
to it as theyalreadyknowthattheyprobablywon’tenjoyit. Tofindthisoutwe askedeachof our
classmateswhetherornottheywouldwanttowatch the filmafterseeingthe openingsequence
and theywhyor whynot aftertheygave theiranswer. Ourfilmwouldprobablyappealtopeople
aged15+ and of bothgenders.The thingthat they wouldhave incommonis that theylike wracking
theirbrainstryingto solve aproblem/mystery,pickingupnew cluesasthe filmwenton. Fansof
filmslike ‘Taken’and‘Gone Girl’wouldbe sure toenjoyourfilmastheyare all verysimilarinthe
sense thattheyare odd,grippingandmysterious.
5. First,we chose a fontwhichfittedinwiththe storylineandgenre of the film.We comparedmany
and thenchose the one whichwasthe mostgripping.After thiswe decidedonthe soundtrackwhich
we wouldhave overthe openingsequence,we chose the slow versionof ‘Heaven’asitisquite
emotional.Thismade the audience know thatthe filmwasgoingtobe emotional aswell asthrilling.
Thisway the audience knowexactlywhattoexpectwhentheygotosee the film. Ontopof this,the
filmstartedmidway throughashockingevent,thismakesthe audience wanttofindoutwhythis
eventhappenedandwhatwouldbe happeningafterwards.Itmakesthemfeelasthoughtheyare
nowa part of the eventandthat theyhave to stickthroughand try and solve the mysteryof what
happenedalongwiththe othercharacters. There are several enigmacodesthroughoutthe opening
title sequenceof ourfilm.Whathas happenedthat hasbeensobad that the motherhasturnedto a
life of drugsand alcohol?Whywasthe little girl missingwhenpeople attendedthe crime scene?
Who had herand where wasshe?Using small mysterieslike thisinthe title sequence gripsthe
audience andmakesthemfeel like theyneedtocontinue watchingtofindoutthe answerstoall of
the questionsthatare spinningaroundintheirheads. Ontopof all of this,we made sure that the
storyline we usedwassimilartoothersfromfilmsof the same genre asthenthere wouldbe a
specificaudiencethatwouldturnupto watch the filmastheyare expectingittobe as enjoyable as
the otherfilmstheyhave seenandliked.Todothiswe showedthe mainmysteryatthe very
beginningandalsouseddarkandgritty colouringandfonts,thiswaytheywouldhave beenable to
almostjudge the actual filmbefore ithadevenstarted.
6. We useda lot of differenttechnologiesduringthe processof makingourmediaproduct.Google
was usedmainlyforresearch,withthis we founddifferentfonts,lookedatseveral filmsof the same
genre as the one we were makingtocompare themandtake notesabout themsothat our film
wouldbe as correct as itcouldbe inthe sense thatit representagoodthrillerfilm.Aswell as
Google,we usedYouTube.We searchedforlotsof differentclipsandtitlessequencesof thrillerfilms
so that we couldcompare themand thenmake sure that ourswas similarsothat itfitin withthat
particulargenre.We alsogot our backingmusicfromYouTube by convertingittoand MP3 file.
Bloggerwasusedfor usto keepa note on everythingthatwe didincludingbothfilmingand
research.Thiswaywe couldkeeptrack of ourprogressso that we knew exactlywhatournextstep
wouldneedtobe.The most usedthingthatwas a part of our makingwasAdobe , withthiswe
editedall of ourfilmedpartstogetheraswell asaddingcreditslidesandthe backingmusic.We
couldcrop our clipsto howwe neededthemandwe couldalsodrag anddrop themto whereverwe
neededthemsothattheywouldflowtogetherwell.
7. With our preliminarytaskwe were quite shakywiththe cameraaswe were justgettingusedto
the way that we hadto use it.Whenwe didthe filmingforourfinal mediaproduct,we usedatripod
some of the time andalsohad somebodyguidingthe personwhowasholdingthe camerasothat
theyonlyhadto thinkabout keepingthe camerastill ratherthanthatand where theywere moving
to, thismade our filmingalotsmoother. Aswell asthis,we didn’tplanandprepare verywell before
the preliminarytaskwasfilmedasitdidn’tcountfor anythingandwasjust like apractice film.For
our actual filmwe made detailedscripts,storyboards andevenfilmedpartsmore thanonce so that
we got the sectionsexactlyhowwe neededthemtobe. The storyboardshelpedusvisualise what
our filmwould sortof looklike whenwe actuallygotitactedout forthe real thing.

More Related Content

What's hot

Evaluation 3 finished
Evaluation 3 finishedEvaluation 3 finished
Evaluation 3 finishedCallum Fisher
 
Evaluation Question Four
Evaluation Question FourEvaluation Question Four
Evaluation Question Fourthedayismyenxmy
 
Evaluation Question 4
Evaluation Question 4Evaluation Question 4
Evaluation Question 4jparker98
 
Review of the force awakens trailer
Review of the force awakens trailerReview of the force awakens trailer
Review of the force awakens trailerBrad190801
 
The blair witch project campaign 2
The blair witch project campaign 2The blair witch project campaign 2
The blair witch project campaign 2emeliacrocker
 
Media Campaign Analysis
Media Campaign AnalysisMedia Campaign Analysis
Media Campaign Analysisemeliacrocker
 
The stages of a film
The stages of a filmThe stages of a film
The stages of a filmsean ramsden
 
Evaluation Task 3 - Who would distribute my Thriller
Evaluation Task 3 - Who would distribute my ThrillerEvaluation Task 3 - Who would distribute my Thriller
Evaluation Task 3 - Who would distribute my Thrilleralex00112233
 
Inception Promotional Campaign
Inception Promotional CampaignInception Promotional Campaign
Inception Promotional CampaignConorFay
 
Evaluation question five
Evaluation question fiveEvaluation question five
Evaluation question fivethaliajade
 
Film campaign
Film campaignFilm campaign
Film campaignJamieleek
 
Toy story 3 media campaign analysis
Toy story 3 media campaign analysisToy story 3 media campaign analysis
Toy story 3 media campaign analysisJamesGMedia
 
Marketing of Inception
Marketing of InceptionMarketing of Inception
Marketing of InceptionSianLynes
 
Evaluation question 4
Evaluation question 4Evaluation question 4
Evaluation question 4SeyiiO
 
Harry Potter and the Deathly Hallows: The Marketing Campaign
Harry Potter and the Deathly Hallows: The Marketing CampaignHarry Potter and the Deathly Hallows: The Marketing Campaign
Harry Potter and the Deathly Hallows: The Marketing Campaignlatymermedia
 

What's hot (20)

Evaluation 3 finished
Evaluation 3 finishedEvaluation 3 finished
Evaluation 3 finished
 
High Budget vs Low budget
High Budget vs Low budget High Budget vs Low budget
High Budget vs Low budget
 
Evaluation Question Four
Evaluation Question FourEvaluation Question Four
Evaluation Question Four
 
Evaluation Question 4
Evaluation Question 4Evaluation Question 4
Evaluation Question 4
 
Review of the force awakens trailer
Review of the force awakens trailerReview of the force awakens trailer
Review of the force awakens trailer
 
The blair witch project campaign 2
The blair witch project campaign 2The blair witch project campaign 2
The blair witch project campaign 2
 
Media Campaign Analysis
Media Campaign AnalysisMedia Campaign Analysis
Media Campaign Analysis
 
The stages of a film
The stages of a filmThe stages of a film
The stages of a film
 
Intended audience
Intended audienceIntended audience
Intended audience
 
Evaluation Task 3 - Who would distribute my Thriller
Evaluation Task 3 - Who would distribute my ThrillerEvaluation Task 3 - Who would distribute my Thriller
Evaluation Task 3 - Who would distribute my Thriller
 
Inception Promotional Campaign
Inception Promotional CampaignInception Promotional Campaign
Inception Promotional Campaign
 
Evaluation question five
Evaluation question fiveEvaluation question five
Evaluation question five
 
Blockbusters PR6
Blockbusters PR6 Blockbusters PR6
Blockbusters PR6
 
Me and my movies
Me and my moviesMe and my movies
Me and my movies
 
Film campaign
Film campaignFilm campaign
Film campaign
 
Toy story 3 media campaign analysis
Toy story 3 media campaign analysisToy story 3 media campaign analysis
Toy story 3 media campaign analysis
 
Marketing of Inception
Marketing of InceptionMarketing of Inception
Marketing of Inception
 
LO4
LO4LO4
LO4
 
Evaluation question 4
Evaluation question 4Evaluation question 4
Evaluation question 4
 
Harry Potter and the Deathly Hallows: The Marketing Campaign
Harry Potter and the Deathly Hallows: The Marketing CampaignHarry Potter and the Deathly Hallows: The Marketing Campaign
Harry Potter and the Deathly Hallows: The Marketing Campaign
 

Viewers also liked

PRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOS
PRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOSPRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOS
PRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOSUp Castuera
 
Las vegas + baja california
Las vegas + baja californiaLas vegas + baja california
Las vegas + baja californiaABUCVIAJES
 
Export House Certificate
Export House CertificateExport House Certificate
Export House CertificateR. B. LAHOTI
 
Main Task - Pre-Product
Main Task - Pre-ProductMain Task - Pre-Product
Main Task - Pre-Productsarahhurleyas
 
Base de datos informatica ii
Base de datos   informatica iiBase de datos   informatica ii
Base de datos informatica iiangelvegarivera
 

Viewers also liked (8)

01 utama
01 utama01 utama
01 utama
 
PRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOS
PRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOSPRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOS
PRESENTACION U.P. CASTUERA EN EDUCAR ENTRE TODOS
 
Armenian Food
Armenian Food Armenian Food
Armenian Food
 
Las vegas + baja california
Las vegas + baja californiaLas vegas + baja california
Las vegas + baja california
 
02 berita utama
02 berita utama02 berita utama
02 berita utama
 
Export House Certificate
Export House CertificateExport House Certificate
Export House Certificate
 
Main Task - Pre-Product
Main Task - Pre-ProductMain Task - Pre-Product
Main Task - Pre-Product
 
Base de datos informatica ii
Base de datos   informatica iiBase de datos   informatica ii
Base de datos informatica ii
 

Similar to Final Evaluation

Project Evaluation
Project EvaluationProject Evaluation
Project Evaluationmattnmat
 
Target Audience Member profile
Target Audience Member profileTarget Audience Member profile
Target Audience Member profileSam Benzie
 
Media Evaluation
Media EvaluationMedia Evaluation
Media EvaluationLucy Ford
 
Media evaluation draft
Media evaluation draftMedia evaluation draft
Media evaluation draftjacoobdale
 
Media powerpoint evaluation final
Media powerpoint evaluation finalMedia powerpoint evaluation final
Media powerpoint evaluation finalsophiamusmarmedia
 
Smc Media Studies Self Evaluation
Smc Media Studies Self EvaluationSmc Media Studies Self Evaluation
Smc Media Studies Self Evaluationjoel
 
Smc Media Studies Self Evaluation
Smc Media Studies Self EvaluationSmc Media Studies Self Evaluation
Smc Media Studies Self Evaluationjoel
 
As media studies film opening evaluation
As media studies film opening evaluationAs media studies film opening evaluation
As media studies film opening evaluationRosie_Buzz
 
AS media studies film opening evaluation
AS media studies film opening evaluationAS media studies film opening evaluation
AS media studies film opening evaluationRosie_Buzz
 
Media evaluation presentation
Media evaluation presentationMedia evaluation presentation
Media evaluation presentationemmadavisas
 
Meida evaluation
Meida   evaluationMeida   evaluation
Meida evaluationLouis
 
Meida evaluation
Meida   evaluationMeida   evaluation
Meida evaluationLouis
 
Evaluation question 1
Evaluation question 1Evaluation question 1
Evaluation question 1katiegravett
 
Evaluation presn
Evaluation presnEvaluation presn
Evaluation presn..
 
Evaluation question 5
Evaluation question 5Evaluation question 5
Evaluation question 5jassy0121
 
In what ways does you media product use, develop or challenge forms and conve...
In what ways does you media product use, develop or challenge forms and conve...In what ways does you media product use, develop or challenge forms and conve...
In what ways does you media product use, develop or challenge forms and conve...Daniel Fotheringham
 

Similar to Final Evaluation (20)

Project Evaluation
Project EvaluationProject Evaluation
Project Evaluation
 
Target Audience Member profile
Target Audience Member profileTarget Audience Member profile
Target Audience Member profile
 
Evaluation
EvaluationEvaluation
Evaluation
 
Evaluation 3
Evaluation 3Evaluation 3
Evaluation 3
 
Media Evaluation
Media EvaluationMedia Evaluation
Media Evaluation
 
Media evaluation draft
Media evaluation draftMedia evaluation draft
Media evaluation draft
 
Media powerpoint evaluation final
Media powerpoint evaluation finalMedia powerpoint evaluation final
Media powerpoint evaluation final
 
Smc Media Studies Self Evaluation
Smc Media Studies Self EvaluationSmc Media Studies Self Evaluation
Smc Media Studies Self Evaluation
 
Smc Media Studies Self Evaluation
Smc Media Studies Self EvaluationSmc Media Studies Self Evaluation
Smc Media Studies Self Evaluation
 
Question 1
Question 1Question 1
Question 1
 
Jess media evaluation
Jess media evaluationJess media evaluation
Jess media evaluation
 
As media studies film opening evaluation
As media studies film opening evaluationAs media studies film opening evaluation
As media studies film opening evaluation
 
AS media studies film opening evaluation
AS media studies film opening evaluationAS media studies film opening evaluation
AS media studies film opening evaluation
 
Media evaluation presentation
Media evaluation presentationMedia evaluation presentation
Media evaluation presentation
 
Meida evaluation
Meida   evaluationMeida   evaluation
Meida evaluation
 
Meida evaluation
Meida   evaluationMeida   evaluation
Meida evaluation
 
Evaluation question 1
Evaluation question 1Evaluation question 1
Evaluation question 1
 
Evaluation presn
Evaluation presnEvaluation presn
Evaluation presn
 
Evaluation question 5
Evaluation question 5Evaluation question 5
Evaluation question 5
 
In what ways does you media product use, develop or challenge forms and conve...
In what ways does you media product use, develop or challenge forms and conve...In what ways does you media product use, develop or challenge forms and conve...
In what ways does you media product use, develop or challenge forms and conve...
 

More from XantheHymus13

Credit Sequence Genres
Credit Sequence GenresCredit Sequence Genres
Credit Sequence GenresXantheHymus13
 
Films of the Same Genre. Description, Trailer, Title Sequence.
Films of the Same Genre. Description, Trailer, Title Sequence.Films of the Same Genre. Description, Trailer, Title Sequence.
Films of the Same Genre. Description, Trailer, Title Sequence.XantheHymus13
 
Films of the same genre. Description, Trailer, Title Sequence.
Films of the same genre. Description, Trailer, Title Sequence.Films of the same genre. Description, Trailer, Title Sequence.
Films of the same genre. Description, Trailer, Title Sequence.XantheHymus13
 
The Girl with the Dragon Tattoo - Opening Scene Analysis
The Girl with the Dragon Tattoo - Opening Scene AnalysisThe Girl with the Dragon Tattoo - Opening Scene Analysis
The Girl with the Dragon Tattoo - Opening Scene AnalysisXantheHymus13
 

More from XantheHymus13 (10)

Credit Sequence Genres
Credit Sequence GenresCredit Sequence Genres
Credit Sequence Genres
 
Filming schedule
Filming scheduleFilming schedule
Filming schedule
 
Filming schedule
Filming scheduleFilming schedule
Filming schedule
 
Filming Schedule
Filming ScheduleFilming Schedule
Filming Schedule
 
Films of the Same Genre. Description, Trailer, Title Sequence.
Films of the Same Genre. Description, Trailer, Title Sequence.Films of the Same Genre. Description, Trailer, Title Sequence.
Films of the Same Genre. Description, Trailer, Title Sequence.
 
Films of the same genre. Description, Trailer, Title Sequence.
Films of the same genre. Description, Trailer, Title Sequence.Films of the same genre. Description, Trailer, Title Sequence.
Films of the same genre. Description, Trailer, Title Sequence.
 
The Girl with the Dragon Tattoo - Opening Scene Analysis
The Girl with the Dragon Tattoo - Opening Scene AnalysisThe Girl with the Dragon Tattoo - Opening Scene Analysis
The Girl with the Dragon Tattoo - Opening Scene Analysis
 
Star Wars
Star Wars Star Wars
Star Wars
 
Star Wars
Star Wars Star Wars
Star Wars
 
Screenplay
ScreenplayScreenplay
Screenplay
 

Final Evaluation

  • 1. 1. In our openingsequence we includedthe mostimportantcreditssothatthose are theypeople whoget the mostrecognition. The Girl withthe DragonTattoo alsousedthistechnique.Afterthe firstfive creditsthatwere shown, whichwere the productionanddistributioncompaniesandthe mainactors of the film,the title wasshown.Afterthis,the restof the importantcreditscontinued. As well asthis,inbetweenthe creditswe had shortclipsof what hadhappenedpreviousto the eventsthatwouldactuallybe happeninginthe film.Theybuiltupa storyline andmade the audience understandaboutwhatwouldbe happeningandwhy.Thisisusedinotherfilmstooforthe exact same reason,itquicklygivesthe viewersanunderstandingof the narrative. ‘MissionImpossible – Ghost Protocol’ showsclipsinbetweencreditstoshow whatishappeningsothatthe filmwill start rightaway by justcontinuingwhathasbeenshown, ratherthanstartingcompletelyfromnothing.It alsogivesthe audience aclearunderstandingof whattype of filmitisgoingto be by containing fightinganda burningfuse throughoutthe entire openingcredits, (https://www.youtube.com/watch?v=GJCvU-91eAo).The motherinthe filmislookingverywornout and as if she is witheringaway.Witha bottle of wine inone handanda syringe inthe other,the audience canclearlytell thatshe isa severelydepressedwomanwhohashitrockbottom. The news reporterlooksprofessional andalsotalksveryclearly.Before she evenbegantospeak,youcouldtell that itwas aboutto be a newsreportbecause of the wayshe wasstoodin the camera shotand her surroundings.We hada close upof the syringe aboutto be put intothe mothersarm, thishighlights the importance of thisspecificitemand letsthe audience knowthatitwill be a bigthingthroughout the whole film.The filmSe7en alsousedcloseupsof itemsinthe openingcreditsasit exaggerates the importance of those specificitems,suchas blades,scrapbooksandgoryphotographs,which makesthemseemmore dramatic. The musicthat we chose to go overthe backgroundof the openingsequence wasslowandmeaningful.Itfitinwiththe storyline assomethingtraumatichad happened. Itisveryoftenthatthe backgroundmusicfitsinwiththe actual storyof the filmasit makesyouunderstandthe scenarioandalsogetsyour mindreadytowatch that certaingenre of film. 2. As soonas you sawthe motherinthe title sequenceof ourfilmyoucouldtell thatshe wasclose to the people whowere inthe crashsimplybecause of how muchof a badway she was in,her drainedface andpale complexioninstantlygivesthe audiencethe ideathatshe doesn’tlook after herself andherveryslimbuildisthe typical bodyof somebodywhohasturnedtodrugsand alcohol duringa toughtime intheirlives. Aswell asthis,she wascompletelysurroundedbyemptywine bottleswhichwasthe shotthat confirmedthatshe wasan alcoholic.The newsreporterhada big luxuriouscoatonand herhair and make-upwasdone veryprofessionally,thisshowsthatshe hasa veryimportantjobto broadcastnewsto people all overthe country andthat she iswell paidand lookedafterbythe crewshe worksfor. 3. 20th CenturyFox distributedthe film‘Gone Girl’whichisof a similargenre andstoryline toour film‘Astray’.Theyare bothmysterythrillers whichare verygripping.Thiscompanywouldbe agood one to distribute ourfilm asitalsodistributedall three of the ‘Taken’films. 20th CenturyFox have goodexperienceindistributingfilmsof thisgenre whichusuallyturnouttobe a huge success,this makesthemthe bestcandidate todistribute ‘Astray’astheyknow exactlywhattheyare doing
  • 2. whichmeansthat we couldtrustthemwitheverythingtomake sure thatour filmis a successrather than a huge failure. Aswell asthis,20th CenturyFox are alwayssearchingforsmall independentfilms to make and distribute astheydone justfocusonhuge blockbusterfilms. The partof 20th Century Fox that wouldactuallydistributeoutfilmwouldbe the sistercompany,Fox SearchlightPictures. It specializesinUSdistributionof independentandBritishfilms whichwouldbe perfectforus. 4. The targetaudience forour filmwouldbe bothmale andfemale andthe filmwouldmostlikelybe a certificate of 15. As well asthis,the people whowouldbe attractedtoourfilmwouldbe those whoare alreadyintothatspecificgenre of film(thriller) astheyare the oneswhoare alwayslooking out fornewfilmssimilartothe onesthatthey’ve seenbefore astheyfoundthemgrippingand interestingsotheyalwayswantmore. Ourmediaproductisfor people wholike all filmswhichare somewhatgripping.If theylikeotherfilmsof the same genre,theyare mostlikelytoenjoythisone too.Anybodywhodoesn’tandneverhashadan interestinthistype of filmtendtonot be attracted to it as theyalreadyknowthattheyprobablywon’tenjoyit. Tofindthisoutwe askedeachof our classmateswhetherornottheywouldwanttowatch the filmafterseeingthe openingsequence and theywhyor whynot aftertheygave theiranswer. Ourfilmwouldprobablyappealtopeople aged15+ and of bothgenders.The thingthat they wouldhave incommonis that theylike wracking theirbrainstryingto solve aproblem/mystery,pickingupnew cluesasthe filmwenton. Fansof filmslike ‘Taken’and‘Gone Girl’wouldbe sure toenjoyourfilmastheyare all verysimilarinthe sense thattheyare odd,grippingandmysterious. 5. First,we chose a fontwhichfittedinwiththe storylineandgenre of the film.We comparedmany and thenchose the one whichwasthe mostgripping.After thiswe decidedonthe soundtrackwhich we wouldhave overthe openingsequence,we chose the slow versionof ‘Heaven’asitisquite emotional.Thismade the audience know thatthe filmwasgoingtobe emotional aswell asthrilling. Thisway the audience knowexactlywhattoexpectwhentheygotosee the film. Ontopof this,the filmstartedmidway throughashockingevent,thismakesthe audience wanttofindoutwhythis eventhappenedandwhatwouldbe happeningafterwards.Itmakesthemfeelasthoughtheyare nowa part of the eventandthat theyhave to stickthroughand try and solve the mysteryof what happenedalongwiththe othercharacters. There are several enigmacodesthroughoutthe opening title sequenceof ourfilm.Whathas happenedthat hasbeensobad that the motherhasturnedto a life of drugsand alcohol?Whywasthe little girl missingwhenpeople attendedthe crime scene? Who had herand where wasshe?Using small mysterieslike thisinthe title sequence gripsthe audience andmakesthemfeel like theyneedtocontinue watchingtofindoutthe answerstoall of the questionsthatare spinningaroundintheirheads. Ontopof all of this,we made sure that the storyline we usedwassimilartoothersfromfilmsof the same genre asthenthere wouldbe a specificaudiencethatwouldturnupto watch the filmastheyare expectingittobe as enjoyable as the otherfilmstheyhave seenandliked.Todothiswe showedthe mainmysteryatthe very beginningandalsouseddarkandgritty colouringandfonts,thiswaytheywouldhave beenable to almostjudge the actual filmbefore ithadevenstarted.
  • 3. 6. We useda lot of differenttechnologiesduringthe processof makingourmediaproduct.Google was usedmainlyforresearch,withthis we founddifferentfonts,lookedatseveral filmsof the same genre as the one we were makingtocompare themandtake notesabout themsothat our film wouldbe as correct as itcouldbe inthe sense thatit representagoodthrillerfilm.Aswell as Google,we usedYouTube.We searchedforlotsof differentclipsandtitlessequencesof thrillerfilms so that we couldcompare themand thenmake sure that ourswas similarsothat itfitin withthat particulargenre.We alsogot our backingmusicfromYouTube by convertingittoand MP3 file. Bloggerwasusedfor usto keepa note on everythingthatwe didincludingbothfilmingand research.Thiswaywe couldkeeptrack of ourprogressso that we knew exactlywhatournextstep wouldneedtobe.The most usedthingthatwas a part of our makingwasAdobe , withthiswe editedall of ourfilmedpartstogetheraswell asaddingcreditslidesandthe backingmusic.We couldcrop our clipsto howwe neededthemandwe couldalsodrag anddrop themto whereverwe neededthemsothattheywouldflowtogetherwell. 7. With our preliminarytaskwe were quite shakywiththe cameraaswe were justgettingusedto the way that we hadto use it.Whenwe didthe filmingforourfinal mediaproduct,we usedatripod some of the time andalsohad somebodyguidingthe personwhowasholdingthe camerasothat theyonlyhadto thinkabout keepingthe camerastill ratherthanthatand where theywere moving to, thismade our filmingalotsmoother. Aswell asthis,we didn’tplanandprepare verywell before the preliminarytaskwasfilmedasitdidn’tcountfor anythingandwasjust like apractice film.For our actual filmwe made detailedscripts,storyboards andevenfilmedpartsmore thanonce so that we got the sectionsexactlyhowwe neededthemtobe. The storyboardshelpedusvisualise what our filmwould sortof looklike whenwe actuallygotitactedout forthe real thing.