sp1_human x egr1_human October 10, 2001 10:50 ..
. . . . .
526 RGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575
| | ...
SP1 at swissprot
EGR1 at swissprot
Вывод
• Оба белка имеют «общей» только небольшую зону
похожих последовательностей. Поэтому
использование bestfit больше по...
Bl2Seq at NCBI
Bl2seq results
Bl2seq оценка
• Bits score – оценка выравнивания в
соответствии с количеством совпадений,
«похожести» и т.д.
• Expected-sc...
Оптимизация времени вычислений
при парном выравнивании
Алгоритм FASTA
Нахождение оптимального выравнивания требует значите...
• Basic Local Alignment Search Tool
• Чувствителен также, как FastA, но намного
быстрее.
• Также, как FASTA, требует парам...
1. Поиск идентичныхпохожих участков
2. Попытка «удлинить» эти участки насколько
возможно (т.е. пока score растёт)
В резуль...
Попытка соединить соседние HSPs путем
выравнивания последовательностей
между ними:
THEFIRSTLINIHAVEADREA____M_ESIRPATRICKR...
Blast
• Blast – это семейство программ: BlastN, BlastP,
BlastX, tBlastN
• BlastN - ДНК vs ДНК
• BlastP – белок vs белок
• ...
Поиск гомологов
По ДНК или по белку?
Какой поиск предпочтительней?
ДНК или белок?
Какая последовательность более
постоянна в эволюционном плане?
UCAUAC
Or
Serine -Tyrosine
ДНК
O
O=P-O
O
Фосфатная группаФосфатная группа
N
Азотистое основаниеАзотистое основание
(A, G, C, or T)(A, G, C, or T)
CH2
O
C...
ДНК
ДНК состоит из двух цепей нуклеотидов,ДНК состоит из двух цепей нуклеотидов,
соединённых попарносоединённых попарно::
...
Двойная спиральДвойная спираль
P
P
P
O
O
O
1
2
3
4
5
5
3
3
5
P
P
P
O
O
O
1
2 3
4
5
5
3
5
3
G C
T A
ДНК, дальнейшая упаковка.
ДНК
Функции ДНК — наследственность и
изменчивость.
Репликация ДНК
Репликация ДНК
• Генетический код избыточен – почти все
аминокислоты кодируются более, чем 1 кодоном
(тройка нуклеотидов)
• Последователь...
• Нуклеотиды – 4-х буквенный алфавит.
• Аминокислоты – 20-и буквенный алфавит
Две случайные последовательности ДНК будут
и...
Матрицы для сравнения белков более
чувствительны, чем матрицы для ДНК.
Базы данных ДНК намного больше белковых
→ будут слу...
Использование белковых
последовательностей более
предпочтительно при поиске гомологов
Поиск гомологов
Множественное выравнивание
последовательностей (MSA)
VTISCTGSSSNIGAG-NHVKWYQQLPG
VTISCTGTSSNIGS--ITVNWYQQLPG
LRLSCSSSGFIFSS--YAMYWVRQAPG
LSLTCTVSGTSFDD--YYSTWVRQPPG
PEVTCVVVDV...
Основные предположения
• Гены фиксированы, сохранены у очень
широкого круга биологических видов, у
совершенно различных пр...
Например:
• Гистоны: небольшие белки,
присутствуют у всех
эукариот.
Демонстрируют выраженное
постоянство последовательност...
Почему множественное выравнивание?
Позволяет дать характеристику семействам
белков, найти общие участки, гомологов.
Наприм...
• MSA – это первый, предварительный шаг к
анализу в области молекулярной эволюции и
построения эволюционных деревьев.
• Ба...
Подходы в MSA
2 разных подхода:
– 1D sequence based – сравнение
последовательностей.
– 2D-3D based – выравнивание, базирую...
MSA algorithm
• Попарное выравнивание всех последовательностей
(pairwise alignment).
• Кластерный анализ данных парного вы...
Multiple Alignment - алгоритм
(1) Парное выравнивание (подготовка guide tree)
6 pairwise alignments
then cluster analysis
...
Комментарии
• Парное выравнивание - оптимальный алгоритм.
• Множественное выравнивание не является
оптимальным алгоритмом....
GCG
Pileup: глобальный MSA.
pileup @[list of sequence names]
pileup @hemoglobin_list
1. The @ sign means that the file con...
GCG
Пример входного файла
..
sw:hbb_human
sw:hbb_rat
sw:hbb_mouse
Hemoglobin_Alpha
Hemoglobin_Gamma
Hemogolibin_Delta
Synt...
GCG
PileUp creates a multiple sequence alignment from a group of related
sequences using progressive, pairwise alignments....
GCG
!!AA_MULTIPLE_ALIGNMENT 1.0
PileUp of: @ipns.fil
Symbol comparison table: GenRunData:blosum62.cmp CompCheck: 1102
GapW...
GCG
Prettybox: генерирует графический файл из
файла MSA
prettybox [MSA file]{*}
prettybox hemoglobins.msf{*}
1. The “{*}” ...
GCG
ClustalW
• Очень известная и широко распространённая
программа: UNIX, Internet, Windows.
• Выполняет MSA; может строить фи...
ClustalW
• tofasta @list
>IPNS_STRJU P18286
MPILMPSAEVPTIDISPLSGDDAKAKQRVAQEINKAARGSGFFYASNHGVDVQLLQDVVN
EFHRNMSDQEKHDLAIN...
ClustalW
CLUSTAL W (1.7) multiple sequence alignment
IPNS_STRJU -MPILMPSAEVPTIDISPLSGDDAKAKQRVAQEINKAARGSGFFYASNHGVDVQLLQD...
ClustalW на EMBL
ClustalW на EMBL - результат
ClustalW at EMBL - Jalview
Conservation
Consensus Sequence
Мы можем вывести consensus sequence из
результатов MSA.
The consensus sequence содержит наиболее
часто ...
Профиль (Profile)
Также возможно вывести статистическую модель,
описывающую MSA. Профиль содержит
информацию о символах в ...
Profile vs. Consensus
Consensus: каждая позиция отражает
наиболее часто встречающийся символ.
Profile: каждая позиция отра...
Profile vs. Consensus
Данный MSA будет иметь одинаковый
consensus
A A C T T G C
A A G T C G T
C A C T T C T
A A C T T G T
...
Profile vs. Consensus
Но разный профиль
A A C T T G C
A A G T C G T
C A C T T C T
A A C T T G T
A A C T T G T
A A C T T C ...
Psi Blast (NCBI)
Position Specific Iterated –
автоматизированный поиск по профилю
Regular blast
Construct profile from
bla...
PSI-Blast
Psi-Blast вывод
Проблема формулировки выводов при
использовании МSA:
1. Сайт выглядит общим (фиксированным)
из-за того, что это – близкоро...
Филогенез
Эволюция – случайный
процесс с неслучайным
результатом
Цели филогенетического исследования
• Реконструкция корректных генеалогических связей
между биологическими объектами
• Оце...
Формат Newick
((A,(B,C)),(D,E))
Типы данных ?
Molecular (DNA, RNA, proteins)
Morphological (soft tissue, hard tissue,
extant, extinct)
Преимущества молекулярных данных
• Наследуемость.
• Недвусмысленность в описании молекулярных характеристик
• Поддаются ко...
Древо видов и генов
• Древо видов – эволюционные взаимосвязи
между видами (видообразование).
• Древо генов.
Page, R.D.M. a...
Ортологи и паралоги
• Гены-паралоги –
событие дупликация
(α and β)
• Гены-ортологи –
событие
видообразования (α in
the two...
Шаги реконструирования филогенетического
древа
1. Выбор последовательностей и поиск
гомологов
2. MSA
3. Матрица белков
4. ...
Филогенетическое дерево
Филогения - раздел биологии, изучающий
родственные взаимоотношения разных
групп живых организмов. ...
Зачем нужны филогенетические
деревья?
Биологические задачи:
 сравнение 3-х и более объектов
(кто на кого более похож .......
Терминология
Узел (node) — точка разделения предковой последовательности
(вида, популяции) на две независимо эволюционирую...
OTU
HTU (hypotetical taxonomic unit)
Какие бывают деревья?
Бинарное (разрешённое)
(в один момент времени может
произойти только одно событие )
Небинарное (нера...
Какие бывают деревья?
Укорененное дерево (rooted tree)
отражает направление эволюции
Неукорененное (бескорневое) дерево
(u...
Rooting
A C B B C AA B C
3 OTUs3 OTUs ⇒⇒ 1 неукорененное дерево1 неукорененное дерево
3 укорененных деревьев3 укорененных деревьев...
D
CA
B
4 OTUs4 OTUs ⇒⇒ 33 неукорененных филогенетическихнеукорененных филогенетических
деревьевдеревьев
D
BA
C C
BA
D
4 OTUs ⇒
15 укорененных
деревьев
Количество Количество Количество
OTU укорененных неукорененных
2 1 1
3 3 1
4 15 3
5 105 15
6 954 105
7 10,395954
8 135,135...
Рутинная процедура, или как строят деревья?
Составление выборки последовательностей
Множественное выравнивание
Построение ...
GCGGCTCA TCAGGTAGTT GGTG-G Spinach
GCGGCCCA TCAGGTAGTT GGTG-G Rice
GCGTTCCA TC--CTGGTT GGTGTG Mosquito
GCGTCCCA TCAGCTAGTT...
GCGGCTCA TCAGGTAGTT GGTG-G Spinach
GCGGCCCA TCAGGTAGTT GGTG-G Rice
GCGTTCCA TC--CTGGTT GGTGTG Mosquito
GCGTCCCA TCAGCTAGTT...
GCGGCTCA TCAGGTAGTT GGTG-G Spinach
GCGGCCCA TCAGGTAGTT GGTG-G Rice
GCGTTCCA TC--CTGGTT GGTGTG Mosquito
GCGTCCCA TCAGCTAGTT...
Seq 1 A G C G A GSeq 1 A G C G A G
Seq 2 G C G G A CSeq 2 G C G G A C
Шаг 3. Перевод количества расхождений в
индексы замен
Distance Matrix*
** Units: количество замен нуклеотидов на 1000
Spinach Rice Mosquito Monkey Human
Spinach 0.0 9 106 91 86...
Шаг 4: построение филогенетического дерева
Spinach Rice Mosquito Monkey Human
Spinach 0.0 9 106 91 86
Rice 0.0 118 122 122
Mosquito 0.0 55 51
Monkey 0.0 3
Human 0.0
Mon-Hum
MonkeyHumanSpinachMosquito Rice
Дистанция между человеком и обезьяной минимальна. Эти
группы объединяются в Monkey...
Spinach Rice Mosquito Mon-Hum
Spinach 0.0 9 106 88.5
Rice 0.0 118 122
Mosquito 0.0 53
Mon-Hum 0.0
Редуцированная матрица д...
Mon-Hum
MonkeyHumanSpinachMosquito Rice
Spi-Ric
HumanMosquito
Mon-Hum
MonkeySpinachRice
Mos-Mon-Hum
Spi-Ric
Mos-Mon-Hum-Spi-Ric
Как выбирать последовательности для дерева?
 Кроме случаев очень близких последовательностей,
проще работать с белками (а...
Самое главное – хорошее
выравнивание!
Максимальный вклад в финальное дерево:
нельзя построить хорошее дерево по
плохому в...
Основные алгоритмы построения
филогенетических деревьев
Методы, основанные на
оценке
расстояний (матричные
методы):
• UPGM...
Пример матрицы расстояний
1 2 3 4 5 6 7 8
0.00 10.53 9.77 12.78 12.03 16.54 13.53 25.00 HUMAN 1
0.00 9.02 12.03 9.77 15.79...
Как понимать расстояние между объектами?
• Как время, в течение которого они эволюционировали
• Как число «эволюционных со...
Гипотеза «молекулярных часов»
(E.Zuckerkandl, L.Pauling, 1962)
За равное время во всех ветвях эволюции
данного генабелка н...
UPGMA
Unweighted Pair Group Method with Arithmetic Mean
разновидность кластерного метода
Расстояние между кластерами вычис...
Недостатки UPGMA
Алгоритм строит ультраметрическое дерево – скорость эволюции
предполагается одинаковой для всех ветвей де...
Метод ближайших соседей
(Neighbor-joining, NJ)
 Строит неукоренённое дерево
 Может работать с большим количеством данных...
Метод Neighbor-joining
Рисуем «звездное» дерево и будем «отщипывать» от него по паре
листьев
Пусть ui = Σk Mik/(n-2) — сре...
Метод ближайших соседей (Neighbor-joining, NJ)
2. Кластер (i, j) – новый узел дерева
Расстояние от i или от j до узла (i,j...
Input:
MSA для n последовательностей,
одна последовательность для каждого
вида.
AAAAATC
AAAAAAG
CCCCCCG
AAAAATC
AAAAAAG
CC...
Как изобразить дерево?
Топология дерева
Топология дерева — только листья, узлы, (корень)
и связывающие их ветви
(топология...
Bacterium 1
Bacterium 3
Bacterium 2
Eukaryote 1
Eukaryote 4
Eukaryote 3
Eukaryote 2
Bacterium 1
Bacterium 3
Bacterium 2
Eu...
Какие on-line программы строят
деревья?
ClustalW. “Tree type” – nj, phylip: строит
только методом NJ, но результат – в
ра...
MEGA: филогенетический анализ
последовательностей
http://www.megasoftware.net/
Эволюция – исторический процесс.
Из 8,200,794,532,637,891,559,375 деревьев для 20 OTUs, 1
является верным и 8,200,794,532,...
Какое из 8,200,794,532,637,891,559,375
деревьев истинно?
Мы не знаем. Можно применить иные критетии:
Например, “похожесть=...
GCG
• Строковый поиск: простой текстовый
поиск по локальной базе данных.
• Поиск в определениях или в аннотациях.
• Опреде...
Vvedenie v bioinformatiku_2
Vvedenie v bioinformatiku_2
Upcoming SlideShare
Loading in …5
×

Vvedenie v bioinformatiku_2

356 views

Published on

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
356
On SlideShare
0
From Embeds
0
Number of Embeds
17
Actions
Shares
0
Downloads
4
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide
  • מיהו ה true tree ?
  • Vvedenie v bioinformatiku_2

    1. 1. sp1_human x egr1_human October 10, 2001 10:50 .. . . . . . 526 RGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCG 575 | | | .: : | :: | : : :. | |:| |||::|| | | 327 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQC..RICM 374 . . . . . 576 KRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTH...QNK 622 : |.||| | | ||||||| ||| | ::| ||| :| | | ..| 375 RNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDK 424 . . . 623 KGGPGVALSVGTLPLDSGAGSEGSGTATPSALITT 657 | | | | | | |. || . |. 425 KADKSVVASSATSSLSSYPSP..VATSYPSPVTTS 457 Bestfit Output
    2. 2. SP1 at swissprot
    3. 3. EGR1 at swissprot
    4. 4. Вывод • Оба белка имеют «общей» только небольшую зону похожих последовательностей. Поэтому использование bestfit больше подходит для построения локального выравнивания. • Мы нашли такое локальное выравнивание, которое соответствует возможному структурному выравниванию. • Структурная «похожесть» может свидетельствовать о domain/function similarity.
    5. 5. Bl2Seq at NCBI
    6. 6. Bl2seq results
    7. 7. Bl2seq оценка • Bits score – оценка выравнивания в соответствии с количеством совпадений, «похожести» и т.д. • Expected-score (E) – Вероятность случайности выравнивания. Чем ближе к 0, тем больше вероятность, что наше выравнивание верно.
    8. 8. Оптимизация времени вычислений при парном выравнивании Алгоритм FASTA Нахождение оптимального выравнивания требует значительных затрат времени k – длина диагоналей b – фактор отступа от диагонали
    9. 9. • Basic Local Alignment Search Tool • Чувствителен также, как FastA, но намного быстрее. • Также, как FASTA, требует параметр k (длина слова). – Белки k= 3 letter words – ДНК k= 11 letter words. Алгоритм BLAST
    10. 10. 1. Поиск идентичныхпохожих участков 2. Попытка «удлинить» эти участки насколько возможно (т.е. пока score растёт) В результате: High-scoring Segment Pairs (HSPs) THEFIRSTLINIHAVEADREAMESIRPATRICKREAD INVIEIAMDEADMEATTNAMHEWASNINETEEN Алгоритм BLAST (шаг 1)
    11. 11. Попытка соединить соседние HSPs путем выравнивания последовательностей между ними: THEFIRSTLINIHAVEADREA____M_ESIRPATRICKREAD INVIEIAMDEADMEATTNAMHEW___ASNINETEEN Алгоритм BLAST (шаг 2)
    12. 12. Blast • Blast – это семейство программ: BlastN, BlastP, BlastX, tBlastN • BlastN - ДНК vs ДНК • BlastP – белок vs белок • BlastX - translated ДНК vs белок • tBlastN - белок vs translated ДНК Query: ДНК Белок Database: ДНК Белок
    13. 13. Поиск гомологов По ДНК или по белку? Какой поиск предпочтительней?
    14. 14. ДНК или белок? Какая последовательность более постоянна в эволюционном плане? UCAUAC Or Serine -Tyrosine
    15. 15. ДНК
    16. 16. O O=P-O O Фосфатная группаФосфатная группа N Азотистое основаниеАзотистое основание (A, G, C, or T)(A, G, C, or T) CH2 O C1 C4 C3 C2 5 СахарСахар (дезоксирибоза)(дезоксирибоза) ДНК
    17. 17. ДНК ДНК состоит из двух цепей нуклеотидов,ДНК состоит из двух цепей нуклеотидов, соединённых попарносоединённых попарно:: ADENINEADENINE –– THYMINETHYMINE CYTOSINECYTOSINE -- GUANINEGUANINE Правило комплементарностиПравило комплементарности
    18. 18. Двойная спиральДвойная спираль P P P O O O 1 2 3 4 5 5 3 3 5 P P P O O O 1 2 3 4 5 5 3 5 3 G C T A
    19. 19. ДНК, дальнейшая упаковка.
    20. 20. ДНК Функции ДНК — наследственность и изменчивость.
    21. 21. Репликация ДНК Репликация ДНК
    22. 22. • Генетический код избыточен – почти все аминокислоты кодируются более, чем 1 кодоном (тройка нуклеотидов) • Последовательность ДНК может меняться, в то время, как последовательность белка остается постоянной. Ser-Tyr…. UCAUAC UCUUAC UCGUAC U…… Поиск гомологов
    23. 23. • Нуклеотиды – 4-х буквенный алфавит. • Аминокислоты – 20-и буквенный алфавит Две случайные последовательности ДНК будут идентичны ~ 25%. Две случайные белковые последовательности будут идентичны ~ 5%. Поиск гомологов
    24. 24. Матрицы для сравнения белков более чувствительны, чем матрицы для ДНК. Базы данных ДНК намного больше белковых → будут случайные совпадения. Поиск гомологов
    25. 25. Использование белковых последовательностей более предпочтительно при поиске гомологов Поиск гомологов
    26. 26. Множественное выравнивание последовательностей (MSA)
    27. 27. VTISCTGSSSNIGAG-NHVKWYQQLPG VTISCTGTSSNIGS--ITVNWYQQLPG LRLSCSSSGFIFSS--YAMYWVRQAPG LSLTCTVSGTSFDD--YYSTWVRQPPG PEVTCVVVDVSHEDPQVKFNWYVDG-- ATLVCLISDFYPGA--VTVAWKADS-- AALGCLVKDYFPEP--VTVSWNSG--- VSLTCLVKGFYPSD--IAVEWWSNG--
    28. 28. Основные предположения • Гены фиксированы, сохранены у очень широкого круга биологических видов, у совершенно различных представителей «древа жизни». • Фиксированный генетический код для белков вероятно несёт похожие, зачастую идентичные функции.
    29. 29. Например: • Гистоны: небольшие белки, присутствуют у всех эукариот. Демонстрируют выраженное постоянство последовательности в MSA Постоянство структуры и функции (упаковка DNA)
    30. 30. Почему множественное выравнивание? Позволяет дать характеристику семействам белков, найти общие участки, гомологов. Например: семейство Serine protease: семейство, отвечающее за катализ, гидролиз пептидных связей. • Одинаковые активные центры ? • Общие участка последовательности?
    31. 31. • MSA – это первый, предварительный шаг к анализу в области молекулярной эволюции и построения эволюционных деревьев. • База для филогенеза – данные молекулярной биологии или морфологические данные
    32. 32. Подходы в MSA 2 разных подхода: – 1D sequence based – сравнение последовательностей. – 2D-3D based – выравнивание, базирующееся на структуре
    33. 33. MSA algorithm • Попарное выравнивание всех последовательностей (pairwise alignment). • Кластерный анализ данных парного выравнивания для получения иерархии выравниваний (guide tree). • Построение множественного выравнивания (MSA) пошагово в соответствии с guide tree; сначала выравнивают наиболее похожие пары, затем добавляют остальные и т.д.
    34. 34. Multiple Alignment - алгоритм (1) Парное выравнивание (подготовка guide tree) 6 pairwise alignments then cluster analysis (2) Множественное выравнивание, следуя древу из п. 1. successive alignments
    35. 35. Комментарии • Парное выравнивание - оптимальный алгоритм. • Множественное выравнивание не является оптимальным алгоритмом. Вполне могут существовать и лучшие выравнивания! • Редакторы выравниваний могут быть полезны для корректировки
    36. 36. GCG Pileup: глобальный MSA. pileup @[list of sequence names] pileup @hemoglobin_list 1. The @ sign means that the file contains a list of names. 2. The list can include names from the user’s directory or code names (accession numbers) from the GCG databases.
    37. 37. GCG Пример входного файла .. sw:hbb_human sw:hbb_rat sw:hbb_mouse Hemoglobin_Alpha Hemoglobin_Gamma Hemogolibin_Delta Syntax: the file starts with “..” Sequences from the databases Sequences from the user’s directory
    38. 38. GCG PileUp creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments. It can also plot a tree showing the clustering relationships used to create the alignment. 1 IPNS_STRJU 329 aa 2 IPNS_STRCL 329 aa 3 IPNS_CEPAC 338 aa 4 IPNS_NOCLA 328 aa What is the gap creation penalty (* 8 *) ? What is the gap extension penalty (* 2 *) ? This program can display the clustering relationships graphically. Do you want to: A) Plot to a FIGURE file called "pileup.figure" B) Plot graphics on HP7550 attached to /dev/tty15 C) Suppress the plot Please choose one (* A *): c What should I call the output file name (* ipns.msf *) ? Determining pairwise similarity scores... 1 x 2 4.43 1 x 3 3.12 1 x 4 4.12 2 x 3 2.94 2 x 4 4.05 3 x 4 3.09 Aligning... Total sequences: 4 Alignment length: 338 CPU time: 00.21 Output file:/data/users/racheli/others/racheli/ipns.msf Regular GCG syntax: Default parameters, output file, etc
    39. 39. GCG !!AA_MULTIPLE_ALIGNMENT 1.0 PileUp of: @ipns.fil Symbol comparison table: GenRunData:blosum62.cmp CompCheck: 1102 GapWeight: 8 GapLengthWeight: 2 ipns.msf MSF: 338 Type: P March 14, 2002 09:29 Check: 7631 .. Name: IPNS_STRJU Len: 338 Check: 6344 Weight: 1.00 Name: IPNS_STRCL Len: 338 Check: 4249 Weight: 1.00 Name: IPNS_NOCLA Len: 338 Check: 7020 Weight: 1.00 Name: IPNS_CEPAC Len: 338 Check: 18 Weight: 1.00 // 1 50 IPNS_STRJU ~MPILMPSAE VPTIDISPLS GDDAKAKQRV AQEINKAARG SGFFYASNHG IPNS_STRCL ~MPVLMPSAH VPTIDISPLF GTDAAAKKRV AEEIHGACRG SGFFYATNHG IPNS_NOCLA ~~~MKMPSAE VPTIDVSPLF GDDAQEKVRV GQEINKACRG SGFFYAANHG IPNS_CEPAC MGSVPVPVAN VPRIDVSPLF GDDKEKKLEV ARAIDAASRD TGFFYAVNHG 51 100 IPNS_STRJU VDVQLLQDVV NEFHRNMSDQ EKHDLAINAY NKDN.PHVRN GYYKAIKGKK IPNS_STRCL VDVQQLQDVV NEFHGAMTDQ EKHDLAIHAY NPDN.PHVRN GYYKAVPGRK IPNS_NOCLA VDVQRLQDVV NEFHRTMSPQ EKYDLAIHAY NKNN.SHVRN GYYMAIEGKK IPNS_CEPAC VDLPWLSRET NKFHMSITDE EKWQLAIRAY NKEHESQIRA GYYLPIPGKK Output file: msf format
    40. 40. GCG Prettybox: генерирует графический файл из файла MSA prettybox [MSA file]{*} prettybox hemoglobins.msf{*} 1. The “{*}” is a syntax sign meaning all the sequences in the MSA file. 2. Can also calculate the consensus sequence.
    41. 41. GCG
    42. 42. ClustalW • Очень известная и широко распространённая программа: UNIX, Internet, Windows. • Выполняет MSA; может строить филогенетические деревья. • Входной файл – формат multi-fasta.
    43. 43. ClustalW • tofasta @list >IPNS_STRJU P18286 MPILMPSAEVPTIDISPLSGDDAKAKQRVAQEINKAARGSGFFYASNHGVDVQLLQDVVN EFHRNMSDQEKHDLAINAYNKDNPHVRNGYYKAIKGKKAVESFCYLNPSFSDDHPMIKSE TPMHEVNLWPDEEKHPRFRPFCEDYYRQLLRLSTVIMRGYALALGRREDFFDEALAEADT LSSVSLIRYPYLEEYPPVKTGADGTKLSFEDHLDVSMITVLYQTEVQNLQVETVDGWQDI PRSDEDFLVNCGTYMGHITHDYFPAPNHRVKFINAERLSLPFFLNAGHNSVIEPFVPEGA AGTVKNPTTSYGEYLQHGLRALIVKNGQT >IPNS_STRCL P10621 MPVLMPSAHVPTIDISPLFGTDAAAKKRVAEEIHGACRGSGFFYATNHGVDVQQLQDVVN EFHGAMTDQEKHDLAIHAYNPDNPHVRNGYYKAVPGRKAVESFCYLNPDFGEDHPMIAAG TPMHEVNLWPDEERHPRFRPFCEGYYRQMLKLSTVLMRGLALALGRPEHFFDAALAEQDS LSSVSLIRYPYLEEYPPVKTGPDGQLLSFEDHLDVSMITVLFQTQVQNLQVETVDGWRDI PTSENDFLVNCGTYMAHVTNDYFPAPNHRVKFVNAERLSLPFFLNGGHEAVIEPFVPEGA SEEVRNEALSYGDYLQHGLRALIVKNGQT input file: Multi-fasta Making the file in unix
    44. 44. ClustalW CLUSTAL W (1.7) multiple sequence alignment IPNS_STRJU -MPILMPSAEVPTIDISPLSGDDAKAKQRVAQEINKAARGSGFFYASNHGVDVQLLQDVV IPNS_STRGR -MPIPMLPAHVPTIDISPLSGGDADDKKRVAQEINKACRESGFFYASHHGIDVQLLKDVV IPNS_FLASS ----MNRHADVPVIDISGLSGNDMDVKKDIAARIDRACRGSGFFYAANHGVDLAALQKFT IPNS_PENCH --MASTPKANVPKIDVSPLFGDNMEEKMKVARAIDAASRDTGFFYAVNHGVDVKRLSNKT IPNS_CEPAC MGSVPVPVANVPRIDVSPLFGDDKEKKLEVARAIDAASRDTGFFYAVNHGVDLPWLSRET *.** **:* * *.: . * :* *: *.* :***** :**:*: *. . IPNS_STRJU NEFHRNMSDQEKHDLAINAYNKDNP-HVRNGYYKAIKGKKAVESFCYLNPSFSDDHPMIK IPNS_STRGR NEFHRTMTDEEKYDLAINAYNKNNP-RTRNGYYMAVKGKKAVESWCYLNPSFSEDHPQIR IPNS_FLASS TDWHMAMSAEEKWELAIRAYNPANP-RNRNGYYMAVEGKKANESFCYLNPSFDADHATIK IPNS_PENCH REFHFSITDEEKWDLAIRAYNKEHQDQIRAGYYLSIPEKKAVESFCYLNPNFKPDHPLIQ IPNS_CEPAC NKFHMSITDEEKWQLAIRAYNKEHESQIRAGYYLPIPGKKAVESFCYLNPSFSPDHPRIK .:* :: :** :***.*** : : * *** .: *** **:*****.*. **. *: Выходной файл: aln format http://www.ebi.ac.uk/help/formats.html форматы
    45. 45. ClustalW на EMBL
    46. 46. ClustalW на EMBL - результат
    47. 47. ClustalW at EMBL - Jalview Conservation
    48. 48. Consensus Sequence Мы можем вывести consensus sequence из результатов MSA. The consensus sequence содержит наиболее часто встречающийся символ в кажной колонке выравнивания. A T C T T G T A A C T T G T A A C T T C T A A C T T G T Ещё пара терминов……
    49. 49. Профиль (Profile) Также возможно вывести статистическую модель, описывающую MSA. Профиль содержит информацию о символах в каждом столбце выравнивания. A T C T T G T A A C T T G T A A C T T C T 1 2 3 4 5 6 A 1 0.67 0 0 . . T 0 0.33 1 1 . . C 0 0 0 0 . . G 0 0 0 0 . .
    50. 50. Profile vs. Consensus Consensus: каждая позиция отражает наиболее часто встречающийся символ. Profile: каждая позиция отражает частоту символа в данной позиции.
    51. 51. Profile vs. Consensus Данный MSA будет иметь одинаковый consensus A A C T T G C A A G T C G T C A C T T C T A A C T T G T A A C T T G T A A C T T C T A A C T T G T
    52. 52. Profile vs. Consensus Но разный профиль A A C T T G C A A G T C G T C A C T T C T A A C T T G T A A C T T G T A A C T T C T 1 2 3 4 5 6 A 0.66 1 0 0 . . T 0 0 0 1 . . C 0.33 0 0.66 0 . . G 0 0 0.33 0 . . 1 2 3 4 5 6 A 1 1 0 0 . . T 0 0 0 1 . . C 0 0 1 0 . . G 0 0 0 0 . .
    53. 53. Psi Blast (NCBI) Position Specific Iterated – автоматизированный поиск по профилю Regular blast Construct profile from blast results Blast profile search Final results
    54. 54. PSI-Blast
    55. 55. Psi-Blast вывод
    56. 56. Проблема формулировки выводов при использовании МSA: 1. Сайт выглядит общим (фиксированным) из-за того, что это – близкородственные последовательности? 2. Сайт выглядит общим из-за того, что это – исключительно, жизненно важный сайт?
    57. 57. Филогенез Эволюция – случайный процесс с неслучайным результатом
    58. 58. Цели филогенетического исследования • Реконструкция корректных генеалогических связей между биологическими объектами • Оценка времени расхождения организмов • Определение порядка эволюционных событий в процессе эволюции
    59. 59. Формат Newick ((A,(B,C)),(D,E))
    60. 60. Типы данных ? Molecular (DNA, RNA, proteins) Morphological (soft tissue, hard tissue, extant, extinct)
    61. 61. Преимущества молекулярных данных • Наследуемость. • Недвусмысленность в описании молекулярных характеристик • Поддаются количественному анализу • Оценка гомологии легче, чем морфологические исследования • Данных много
    62. 62. Древо видов и генов • Древо видов – эволюционные взаимосвязи между видами (видообразование). • Древо генов. Page, R.D.M. and Cotton, J.C. (2000) GeneTree: a tool for exploring gene family evolution. In D. Sankoff, and J. Nadeau, (eds.), Comparative Genomics: Empirical and Analytical Approaches to Gene Order Dynamics, Map Alignment, and the Evolution of Gene Families. Kluwer Academic Publishers, Dordrecht, pp. 525-536. Figure 2: (a) Incongruent gene and species trees. This incongruence can be explained by hypothesizing a gene duplication (h) at the base of the gene tree (b). The presence of only a single gene (a- d) extant in each of the present-day species (1-4) requires postulating three gene losses. (c) The corresponding reconciled tree.
    63. 63. Ортологи и паралоги • Гены-паралоги – событие дупликация (α and β) • Гены-ортологи – событие видообразования (α in the two species and β in the two species) α βα βαβα Duplication Speciation Species a Species b
    64. 64. Шаги реконструирования филогенетического древа 1. Выбор последовательностей и поиск гомологов 2. MSA 3. Матрица белков 4. Филогенетическое дерево
    65. 65. Филогенетическое дерево Филогения - раздел биологии, изучающий родственные взаимоотношения разных групп живых организмов. Филогению отображается обычно в виде "эволюционных древ" или систематических названий.
    66. 66. Зачем нужны филогенетические деревья? Биологические задачи:  сравнение 3-х и более объектов (кто на кого более похож .... )  реконструкция эволюции (кто от кого, как и когда произошел…)
    67. 67. Терминология Узел (node) — точка разделения предковой последовательности (вида, популяции) на две независимо эволюционирующие. Соответствует внутренней вершине графа, изображающего эволюцию. Лист (leaf, OTU – оперативная таксономическая единица) — реальный (современный) объект; внешняя вершина графа. Ветвь (branch) — связь между узлами или между узлом и листом; ребро графа. Корень (root) — общий предок. Клада (clade) - группа двух или более таксонов или последователь- ностей ДНК, которая включает как своего общего предка, так и всех его потомков.
    68. 68. OTU HTU (hypotetical taxonomic unit)
    69. 69. Какие бывают деревья? Бинарное (разрешённое) (в один момент времени может произойти только одно событие ) Небинарное (неразрешённое) (может ли в один момент времени произойти два события? ) Время
    70. 70. Какие бывают деревья? Укорененное дерево (rooted tree) отражает направление эволюции Неукорененное (бескорневое) дерево (unrooted tree) показывает только связи между узлами Время Если число листьев равно n, существует (2n-3)!! разных бинарных укоренных деревьев. По определению, (2n-3)!! = 1·3 ·... ·(2n-3) Существует (2n-5)!! разных бескорневых деревьев с n листьями
    71. 71. Rooting
    72. 72. A C B B C AA B C 3 OTUs3 OTUs ⇒⇒ 1 неукорененное дерево1 неукорененное дерево 3 укорененных деревьев3 укорененных деревьев A B C
    73. 73. D CA B 4 OTUs4 OTUs ⇒⇒ 33 неукорененных филогенетическихнеукорененных филогенетических деревьевдеревьев D BA C C BA D
    74. 74. 4 OTUs ⇒ 15 укорененных деревьев
    75. 75. Количество Количество Количество OTU укорененных неукорененных 2 1 1 3 3 1 4 15 3 5 105 15 6 954 105 7 10,395954 8 135,135 10,395 9 2,027,025 135,135 10 34,459,425 2,027,025 11 654,729,075 34,459,425 12 13,749,310,575 654,729,075 Количество возможных деревьев
    76. 76. Рутинная процедура, или как строят деревья? Составление выборки последовательностей Множественное выравнивание Построение дерева фрагмент записи в виде скобочной формулы: Визуализация и редактура дерева (((((con101:38.51018,(f53969:28.26973,((f67220:8.39851, max4:27.50591):4.92893,con92:30.19677):13.62315):9.53075):25.83145, EC PurR YPO2387 REO04849 RPQ00833 HI1635 PM0547RAB00351VC1721 RVFI01332 SYG CAEEL SYG HUMAN SYG BOMMO SYG METTH SYG METJA CAF29768 tr|Q97EB8 tr|Q81XT3 SYG STAAM tr|Q8R5S1 sp|P36929|RSMB ECOLI tr|Q8YYM8 tr|O29405 tr|Q8TGZ6 NOL1 HUMAN tr|Q9FG73 sp|P40991|NOP2 YEAST tr|Q8U1F1
    77. 77. GCGGCTCA TCAGGTAGTT GGTG-G Spinach GCGGCCCA TCAGGTAGTT GGTG-G Rice GCGTTCCA TC--CTGGTT GGTGTG Mosquito GCGTCCCA TCAGCTAGTT GTTG-G Monkey GCGGCGCA TTAGCTAGTT GGTG-A Human *** ** * * *** * ** Множественное выравнивание Matches
    78. 78. GCGGCTCA TCAGGTAGTT GGTG-G Spinach GCGGCCCA TCAGGTAGTT GGTG-G Rice GCGTTCCA TC--CTGGTT GGTGTG Mosquito GCGTCCCA TCAGCTAGTT GTTG-G Monkey GCGGCGCA TTAGCTAGTT GGTG-A Human *** ** * * *** * ** Multiple Alignment Matches Mismatches
    79. 79. GCGGCTCA TCAGGTAGTT GGTG-G Spinach GCGGCCCA TCAGGTAGTT GGTG-G Rice GCGTTCCA TC--CTGGTT GGTGTG Mosquito GCGTCCCA TCAGCTAGTT GTTG-G Monkey GCGGCGCA TTAGCTAGTT GGTG-A Human *** ** * * *** * ** Multiple Alignment Matches Mismatches Gaps
    80. 80. Seq 1 A G C G A GSeq 1 A G C G A G Seq 2 G C G G A CSeq 2 G C G G A C Шаг 3. Перевод количества расхождений в индексы замен
    81. 81. Distance Matrix* ** Units: количество замен нуклеотидов на 1000 Spinach Rice Mosquito Monkey Human Spinach 0.0 9 106 91 86 Rice 0.0 118 122 122 Mosquito 0.0 55 51 Monkey 0.0 3 Human 0.0
    82. 82. Шаг 4: построение филогенетического дерева
    83. 83. Spinach Rice Mosquito Monkey Human Spinach 0.0 9 106 91 86 Rice 0.0 118 122 122 Mosquito 0.0 55 51 Monkey 0.0 3 Human 0.0
    84. 84. Mon-Hum MonkeyHumanSpinachMosquito Rice Дистанция между человеком и обезьяной минимальна. Эти группы объединяются в Monkey-Human, а все остальные дистанции пересчитываются Dist[Spinach, MonHum] = (Dist[Spinach, Monkey] + Dist[Spinach, Human])/2 = (91 + 86)/2 = 88.5
    85. 85. Spinach Rice Mosquito Mon-Hum Spinach 0.0 9 106 88.5 Rice 0.0 118 122 Mosquito 0.0 53 Mon-Hum 0.0 Редуцированная матрица дистанций
    86. 86. Mon-Hum MonkeyHumanSpinachMosquito Rice Spi-Ric
    87. 87. HumanMosquito Mon-Hum MonkeySpinachRice Mos-Mon-Hum Spi-Ric Mos-Mon-Hum-Spi-Ric
    88. 88. Как выбирать последовательности для дерева?  Кроме случаев очень близких последовательностей, проще работать с белками (а не с ДНК)  Придерживайтесь небольшой выборки (< 50 последовательностей)  Избегайте: – фрагментов; – Ксенологов (горизонтальный перенос генов); – рекомбинантных последовательностей; – многодоменных белков и повторов  Используйте outgroup (последовательность, ответвившаяся от общего предка заведомо (но минимально!) раньше разделения интересующих групп- клад)
    89. 89. Самое главное – хорошее выравнивание! Максимальный вклад в финальное дерево: нельзя построить хорошее дерево по плохому выравниванию Блоки, содержащие много гэпов, плохо выровненные N- и C- концы можно просто вырезать.
    90. 90. Основные алгоритмы построения филогенетических деревьев Методы, основанные на оценке расстояний (матричные методы): • UPGMA (кластеризация) • Neighbor-joining • Минимальная эволюция Наибольшего правдоподобия, Maximal likelihood, ML Используется модель эволюции и строится дерево, которое наиболее правдоподобно при данной модели Максимальной экономии (бережливости), maximal parsimony, MP Выбирается дерево с минимальным количеством мутаций, необходимых для объяснения данных
    91. 91. Пример матрицы расстояний 1 2 3 4 5 6 7 8 0.00 10.53 9.77 12.78 12.03 16.54 13.53 25.00 HUMAN 1 0.00 9.02 12.03 9.77 15.79 9.02 27.27 HORSE 2 0.00 9.77 9.02 16.54 12.03 24.24 RABIT 3 0.00 2.26 17.29 10.53 25.76 MOUSE 4 0.00 15.79 8.27 25.76 RAT 5 0.00 10.53 29.55 BOVIN 6 0.00 25.00 PIG 7 0.00 CHICK 8 Расстояние (уровень дивергенции) между соответствующими последовательностями из геномов мыши и свиньи
    92. 92. Как понимать расстояние между объектами? • Как время, в течение которого они эволюционировали • Как число «эволюционных событий» (мутаций) В первом случае объекты образуют ультраметрическое пространство (если все объекты наблюдаются в одно время, что, как правило, верно) Но время непосредственно измерить невозможно
    93. 93. Гипотеза «молекулярных часов» (E.Zuckerkandl, L.Pauling, 1962) За равное время во всех ветвях эволюции данного генабелка накапливается равное число мутацийЕсли гипотеза молекулярных часов принимается, число различий между выровненными последовательностями можно считать примерно пропорциональным времени. Отклонения от ультраметричности можно считать случайными. Эволюция реконструируется в виде ультраметрического дерева. Укоренённое дерево называется ультраметрическим, если расстояние от корня до любого из листьев одинаково.
    94. 94. UPGMA Unweighted Pair Group Method with Arithmetic Mean разновидность кластерного метода Расстояние между кластерами вычисляется как среднее арифметическое всевозможных расстояний между последовательностями из кластеров
    95. 95. Недостатки UPGMA Алгоритм строит ультраметрическое дерево – скорость эволюции предполагается одинаковой для всех ветвей дерева. Использовать этот алгоритм имеет смысл только в случае ультраметрических данных (справедливости «молекулярных часов»). Реальное дерево UPGMA
    96. 96. Метод ближайших соседей (Neighbor-joining, NJ)  Строит неукоренённое дерево  Может работать с большим количеством данных  Достаточно быстрый  Если есть недвусмысленное с точки зрения эксперта дерево, то оно будет построено.
    97. 97. Метод Neighbor-joining Рисуем «звездное» дерево и будем «отщипывать» от него по паре листьев Пусть ui = Σk Mik/(n-2) — среднее расстояние от листа i до других листьев 1. Рассмотрим все возможные пары листьев. Выберем 2 листа i и j с минимальным значением величины Mij – ui –uj т.е. выбираем 2 узла, которые близки друг к другу, но далеки ото всех остальных.
    98. 98. Метод ближайших соседей (Neighbor-joining, NJ) 2. Кластер (i, j) – новый узел дерева Расстояние от i или от j до узла (i,j): D(i, (i,j)) = 0,5·(Mij + ui – uj) D(j, (i,j)) = 0,5· (Mij + uj – ui) т.е. длина ветви зависит от среднего расстояния до других вершин 3. Вычисляем расстояние от нового кластера до всех других M(ij)k = Mik+Mjk – Mij 2 5. В матрице М убираем i и j и добавляем (i, j). Повторяем, пока не останутся 3 узла ...
    99. 99. Input: MSA для n последовательностей, одна последовательность для каждого вида. AAAAATC AAAAAAG CCCCCCG AAAAATC AAAAAAG CCCCCCG Длинная ветвь – непохоже на правду Длинная ветвь - Похоже на правду Методы, основанные на последовательностях: Maximum Likelihood (ML), Maximum Parsimony (MP)
    100. 100. Как изобразить дерево? Топология дерева Топология дерева — только листья, узлы, (корень) и связывающие их ветви (топология не зависит от способа изображения дерева) A B C D E A BC D E Два изображения одной и той же топологии
    101. 101. Bacterium 1 Bacterium 3 Bacterium 2 Eukaryote 1 Eukaryote 4 Eukaryote 3 Eukaryote 2 Bacterium 1 Bacterium 3 Bacterium 2 Eukaryote 1 Eukaryote 4 Eukaryote 3 Eukaryote 2 Филограммы – длины ветвей пропорциональны эволюционному расстоянию. Кладограммы и филограммы Кладограммы – только топологя. Длины ветвей не учитываются 6 3 1 2 4 6 2 4 5 3 Как можно нарисовать построенное дерево?
    102. 102. Какие on-line программы строят деревья? ClustalW. “Tree type” – nj, phylip: строит только методом NJ, но результат – в разных форматах, no bootstraps Phylip (Felsenstein, 1993) – пакет программ для построения филогенетических деревьев (stand-alone) On-line (partly): например, http://bioweb.pasteur.fr/seqanal/phylogeny/phylip-uk.html  PAUP (Phylogenetic Analysis Using Parsimony)
    103. 103. MEGA: филогенетический анализ последовательностей http://www.megasoftware.net/
    104. 104. Эволюция – исторический процесс. Из 8,200,794,532,637,891,559,375 деревьев для 20 OTUs, 1 является верным и 8,200,794,532,637,891,559,374 неверны. Truth is one, falsehoods are many.
    105. 105. Какое из 8,200,794,532,637,891,559,375 деревьев истинно? Мы не знаем. Можно применить иные критетии: Например, “похожесть=родство»
    106. 106. GCG • Строковый поиск: простой текстовый поиск по локальной базе данных. • Поиск в определениях или в аннотациях. • Определения содержат минимальное количество информации для каждой статьи: доступ, имя организма, имя гена, длина последовательности, дата.

    ×