SlideShare a Scribd company logo
1 of 109
Hadoop for Bioinformatics
                       Deepak Singh
                    Amazon Web Services




Hadoop World, NYC
Via Reavel under a CC-BY-NC-ND license
By ~Prescott under a CC-BY-NC license
data sets
many data sets
PFAM                                PDB




       GENBANK                 ENSEMBL




                 Many Others
manageable
Image: Matt Wood
Human
                   genom
                   e




Image: Matt Wood
Image: Matt Wood
~100 TB/Week
Image: Matt Wood
~100 TB/Week
                       >2 PB/Year
Image: Matt Wood
years
days
hours
gigabytes
terabytes
petabytes
really fast
typical informatics workflow
Via Christolakis under a CC-BY-NC-ND license
Via Argonne National Labs under a CC-BY-SA license
killer app




Via Argonne National Labs under a CC-BY-SA license
Via asklar under a CC-BY license
Image: Chris Dagdigian
rethink algorithms
rethink computing
rethink data management
rethink data sharing
operational mindset
scalability
we are data geeks not data center geeks
two key trends
develop applications
distribute applications
use applications
some work
filters
some work
   ^
High Throughput Sequence Analysis
Mike Schatz, University of Maryland
• Read Mapping
• Mapping & SNP Discovery
• De novo Genome Assembly
Short Read Mapping
Asian Individual Genome: 3.3 Billion 35bp, 104
GB (Wang et al., 2008)

African Individual Genome: 4.0 Billion 35bp, 144
GB (Bentley et al., 2008)
Alignment > 10000 CPU hrs
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)



          Expensive to scale
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)



          Expensive to scale
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)



          Expensive to scale

  Need parallelization framework
CloudBurst




Catalog k-mers     Collect seeds   End-to-end alignment
http://cloudburst-bio.sourceforge.net; Bioinformatics 2009 25: 1363-1369
CloudBurst efficiently reports every k-difference
           alignment of every read
many applications only need the best alignment
Bowtie: Ultrafast short read aligner




Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human
genome. Genome Biol 10 (3): R25.
SOAPSnp: Consensus alignment and SNP calling




Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human
genome. Genome Biol 10 (3): R25.
Crossbow: Rapid whole genome SNP analysis



                                                                                                       Ben Langmead




Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human
genome. Genome Biol 10 (3): R25.
Preprocessed reads
Preprocessed reads



   Map: Bowtie
Preprocessed reads



     Map: Bowtie



Sort: Bin and partition
Preprocessed reads



     Map: Bowtie



Sort: Bin and partition


  Reduce: SoapSNP
Crossbow condenses over 1,000 hours
of resequencing computation into a few
hours without requiring the user to own
or operate a computer cluster
Comparing Genomes
Estimating relative evolutionary rates
           from sequence comparisons:
                Identification of probable orthologs
                              Admissible comparisons:       A or B vs. D
                                                            C vs. E
                              Inadmissible comparisons:    A or B vs. E
                                                           C vs. D




 A B C                      D    E                         species tree
                                                          gene tree
S. cerevisiae               C. elegans
Estimating relative evolutionary rates
           from sequence comparisons:
                          1. Orthologs found using the Reciprocal
                          smallest distance algorithm
                          2. Build alignment between two orthologs
                          >Sequence C
                          MSGRTILASTIAKPFQEEVTKAVKQLNFT-----PKLVGLLSNEDPAAKMYANWTGKTCESLGFKYEL-…
                          >Sequence E
                          MSGRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYDL…




                          3. Estimate distance given a substitution
                          matrix
                                                        Phe Ala Pro Leu Thr
                                                      Phe
                                                      Ala µπ
                                                      Pro µπ µπ µπ
                                                      Leu µπ µπ µπ µπ




 A B C              D    E                                                     species tree
                                                                              gene tree
S. cerevisiae       C. elegans
RSD algorithm summary
 Genome I                                            Genome J


                          Ib                                     Jc

  Align sequences &
  Calculate distances          L     Orthologs:
                                                     Align sequences &
                                                     Calculate distances          H
                                   ib - jc D = 0.1
    c
        vs.       D=1.2                                    vs.            D=0.2
              a                                        b              a
        vs.       D=0.1                                    vs.            D=0.3
    c         b                                        b              b
        vs.       D=0.9                                    vs.            D=0.1
    c         c                                        b              c
Prof. Dennis Wall
Harvard Medical School
Roundup is a database of orthologs
and their evolutionary distances.
To get started, click browse. Alternatively, you can
read our documentation here.
Good luck, researchers!
massive computational demand
1000 genomes = 5,994,000 processes =
         23,976,000 hours
2737 years
periodic task
must scale up
not scalability gurus
hadoop streaming
compared 50+ genomes
what’s next?
de novo assembly
machine learning and statistics
protein structure prediction
docking
trajectory analysis
key driving factors?
the ecosystem
Pig
Cascading
Hive
RHIPE
domain specific libraries and tools
http://aws.amazon.com/publicdatasets/
http://aws.amazon.com/education/
Thank you!




     deesingh@amazon.com; Twitter:@mndoci
Presentation ideas from @mza, @simon and @lessig

More Related Content

Viewers also liked

Eurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results PresentationEurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results Presentation
Company Spotlight
 
Investigación Operativa 1
Investigación Operativa 1Investigación Operativa 1
Investigación Operativa 1
oscarugaz
 
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Shashi Kant
 
Vision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrialsVision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrials
norbelisgoyo
 
Transfer factor3g bienestar es verde
Transfer factor3g   bienestar es verdeTransfer factor3g   bienestar es verde
Transfer factor3g bienestar es verde
TransferFactor3G
 
Bioinformatics Final Report
Bioinformatics Final ReportBioinformatics Final Report
Bioinformatics Final Report
Shruthi Choudary
 
Anxyolitics& hypnotics
Anxyolitics& hypnoticsAnxyolitics& hypnotics
Anxyolitics& hypnotics
raj kumar
 

Viewers also liked (19)

Banner
BannerBanner
Banner
 
ABAEvents - Presentación comercial
ABAEvents - Presentación comercialABAEvents - Presentación comercial
ABAEvents - Presentación comercial
 
Design fax 951 | Les gros mots du design | ShowDesign
Design fax 951 | Les gros mots du design | ShowDesignDesign fax 951 | Les gros mots du design | ShowDesign
Design fax 951 | Les gros mots du design | ShowDesign
 
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
 
Auditores
AuditoresAuditores
Auditores
 
Eurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results PresentationEurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results Presentation
 
Job Search-RD2B February 2016
Job Search-RD2B February 2016Job Search-RD2B February 2016
Job Search-RD2B February 2016
 
Investigación Operativa 1
Investigación Operativa 1Investigación Operativa 1
Investigación Operativa 1
 
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
 
Envases galotto chile
Envases galotto chileEnvases galotto chile
Envases galotto chile
 
Brochure Torre UNIKA Virrey
Brochure Torre UNIKA VirreyBrochure Torre UNIKA Virrey
Brochure Torre UNIKA Virrey
 
Vision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrialsVision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrials
 
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
 
Transfer factor3g bienestar es verde
Transfer factor3g   bienestar es verdeTransfer factor3g   bienestar es verde
Transfer factor3g bienestar es verde
 
An Integral Model of Human Resilience in Technological Systems (6.15)
An Integral Model of Human Resilience in Technological Systems (6.15)An Integral Model of Human Resilience in Technological Systems (6.15)
An Integral Model of Human Resilience in Technological Systems (6.15)
 
Presentació Patufet
Presentació PatufetPresentació Patufet
Presentació Patufet
 
Nichia product catalogue
Nichia product catalogueNichia product catalogue
Nichia product catalogue
 
Bioinformatics Final Report
Bioinformatics Final ReportBioinformatics Final Report
Bioinformatics Final Report
 
Anxyolitics& hypnotics
Anxyolitics& hypnoticsAnxyolitics& hypnotics
Anxyolitics& hypnotics
 

Similar to Hadoop for Bioinformatics

2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizona2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizona
c.titus.brown
 
R Analytics in the Cloud
R Analytics in the CloudR Analytics in the Cloud
R Analytics in the Cloud
DataMine Lab
 
2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptx2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptx
c.titus.brown
 
2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues
Dongyan Zhao
 
DESeq Paper Journal club
DESeq Paper Journal club DESeq Paper Journal club
DESeq Paper Journal club
avrilcoghlan
 
ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"
nozyh
 

Similar to Hadoop for Bioinformatics (20)

2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizona2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizona
 
SyMAP Master's Thesis Presentation
SyMAP Master's Thesis PresentationSyMAP Master's Thesis Presentation
SyMAP Master's Thesis Presentation
 
2014 anu-canberra-streaming
2014 anu-canberra-streaming2014 anu-canberra-streaming
2014 anu-canberra-streaming
 
R Analytics in the Cloud
R Analytics in the CloudR Analytics in the Cloud
R Analytics in the Cloud
 
2013 duke-talk
2013 duke-talk2013 duke-talk
2013 duke-talk
 
Talk ABRF 2015 (Gunnar Rätsch)
Talk ABRF 2015 (Gunnar Rätsch)Talk ABRF 2015 (Gunnar Rätsch)
Talk ABRF 2015 (Gunnar Rätsch)
 
The wheat genome sequence: a foundation for accelerating improvment of bread ...
The wheat genome sequence: a foundation for accelerating improvment of bread ...The wheat genome sequence: a foundation for accelerating improvment of bread ...
The wheat genome sequence: a foundation for accelerating improvment of bread ...
 
2015 osu-metagenome
2015 osu-metagenome2015 osu-metagenome
2015 osu-metagenome
 
2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptx2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptx
 
20131019 生物物理若手 Journal Club
20131019 生物物理若手 Journal Club20131019 生物物理若手 Journal Club
20131019 生物物理若手 Journal Club
 
2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues
 
2012 oslo-talk
2012 oslo-talk2012 oslo-talk
2012 oslo-talk
 
Genome rearrangment
Genome rearrangmentGenome rearrangment
Genome rearrangment
 
Igor Segota: PhD thesis presentation
Igor Segota: PhD thesis presentationIgor Segota: PhD thesis presentation
Igor Segota: PhD thesis presentation
 
2015 illinois-talk
2015 illinois-talk2015 illinois-talk
2015 illinois-talk
 
Structure based computer aided drug design
Structure based computer aided drug designStructure based computer aided drug design
Structure based computer aided drug design
 
DESeq Paper Journal club
DESeq Paper Journal club DESeq Paper Journal club
DESeq Paper Journal club
 
DNA cell cycle by flow cytometry
DNA cell cycle by flow cytometryDNA cell cycle by flow cytometry
DNA cell cycle by flow cytometry
 
RNA-seq: general concept, goal and experimental design - part 1
RNA-seq: general concept, goal and experimental design - part 1RNA-seq: general concept, goal and experimental design - part 1
RNA-seq: general concept, goal and experimental design - part 1
 
ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"
 

More from Deepak Singh

Intel Theater Presentation - SC11
Intel Theater Presentation - SC11Intel Theater Presentation - SC11
Intel Theater Presentation - SC11
Deepak Singh
 
Talk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource DirectorsTalk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource Directors
Deepak Singh
 
Platforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the BrinkPlatforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the Brink
Deepak Singh
 
Systems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop KeynoteSystems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop Keynote
Deepak Singh
 
Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010
Deepak Singh
 
Masterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale scienceMasterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale science
Deepak Singh
 
Talk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshopTalk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshop
Deepak Singh
 

More from Deepak Singh (20)

Intel Theater Presentation - SC11
Intel Theater Presentation - SC11Intel Theater Presentation - SC11
Intel Theater Presentation - SC11
 
Talk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource DirectorsTalk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource Directors
 
Platforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the BrinkPlatforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the Brink
 
High Performance Cloud Computing
High Performance Cloud ComputingHigh Performance Cloud Computing
High Performance Cloud Computing
 
#arseniclife
#arseniclife#arseniclife
#arseniclife
 
High Performance Cloud Computing
High Performance Cloud ComputingHigh Performance Cloud Computing
High Performance Cloud Computing
 
Systems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop KeynoteSystems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop Keynote
 
Talk at NCRR P41 Director's Meeting
Talk at NCRR P41 Director's MeetingTalk at NCRR P41 Director's Meeting
Talk at NCRR P41 Director's Meeting
 
Platforms for data science
Platforms for data sciencePlatforms for data science
Platforms for data science
 
Discovery 2015 Workshop
Discovery 2015 WorkshopDiscovery 2015 Workshop
Discovery 2015 Workshop
 
Bio-IT World 2010 - Keynote talk
Bio-IT World 2010 - Keynote talkBio-IT World 2010 - Keynote talk
Bio-IT World 2010 - Keynote talk
 
Talk at Microsoft Cloud Futures 2010
Talk at Microsoft Cloud Futures 2010Talk at Microsoft Cloud Futures 2010
Talk at Microsoft Cloud Futures 2010
 
NHGRI Cloud Computing talk
NHGRI Cloud Computing talkNHGRI Cloud Computing talk
NHGRI Cloud Computing talk
 
Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010
 
Masterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale scienceMasterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale science
 
Talk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshopTalk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshop
 
Big Data & the networked future of Science (at Ignite Seattle 7)
Big Data & the networked future of Science (at Ignite Seattle 7)Big Data & the networked future of Science (at Ignite Seattle 7)
Big Data & the networked future of Science (at Ignite Seattle 7)
 
Science Big, Science Connected
Science Big, Science ConnectedScience Big, Science Connected
Science Big, Science Connected
 
Bioscreencast: Capturing the life sciences frame by frame
Bioscreencast: Capturing the life sciences frame by frameBioscreencast: Capturing the life sciences frame by frame
Bioscreencast: Capturing the life sciences frame by frame
 
Searching Science
Searching ScienceSearching Science
Searching Science
 

Recently uploaded

Architecting Cloud Native Applications
Architecting Cloud Native ApplicationsArchitecting Cloud Native Applications
Architecting Cloud Native Applications
WSO2
 
Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Victor Rentea
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Safe Software
 

Recently uploaded (20)

Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
Biography Of Angeliki Cooney | Senior Vice President Life Sciences | Albany, ...
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdf
 
CNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In PakistanCNIC Information System with Pakdata Cf In Pakistan
CNIC Information System with Pakdata Cf In Pakistan
 
Navigating the Deluge_ Dubai Floods and the Resilience of Dubai International...
Navigating the Deluge_ Dubai Floods and the Resilience of Dubai International...Navigating the Deluge_ Dubai Floods and the Resilience of Dubai International...
Navigating the Deluge_ Dubai Floods and the Resilience of Dubai International...
 
AWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of TerraformAWS Community Day CPH - Three problems of Terraform
AWS Community Day CPH - Three problems of Terraform
 
Exploring Multimodal Embeddings with Milvus
Exploring Multimodal Embeddings with MilvusExploring Multimodal Embeddings with Milvus
Exploring Multimodal Embeddings with Milvus
 
Apidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, Adobe
Apidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, AdobeApidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, Adobe
Apidays New York 2024 - Scaling API-first by Ian Reasor and Radu Cotescu, Adobe
 
Corporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptxCorporate and higher education May webinar.pptx
Corporate and higher education May webinar.pptx
 
Architecting Cloud Native Applications
Architecting Cloud Native ApplicationsArchitecting Cloud Native Applications
Architecting Cloud Native Applications
 
Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024
 
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
 
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
Apidays New York 2024 - APIs in 2030: The Risk of Technological Sleepwalk by ...
 
Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024Finding Java's Hidden Performance Traps @ DevoxxUK 2024
Finding Java's Hidden Performance Traps @ DevoxxUK 2024
 
DBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor PresentationDBX First Quarter 2024 Investor Presentation
DBX First Quarter 2024 Investor Presentation
 
Emergent Methods: Multi-lingual narrative tracking in the news - real-time ex...
Emergent Methods: Multi-lingual narrative tracking in the news - real-time ex...Emergent Methods: Multi-lingual narrative tracking in the news - real-time ex...
Emergent Methods: Multi-lingual narrative tracking in the news - real-time ex...
 
DEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
DEV meet-up UiPath Document Understanding May 7 2024 AmsterdamDEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
DEV meet-up UiPath Document Understanding May 7 2024 Amsterdam
 
presentation ICT roal in 21st century education
presentation ICT roal in 21st century educationpresentation ICT roal in 21st century education
presentation ICT roal in 21st century education
 
Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024Axa Assurance Maroc - Insurer Innovation Award 2024
Axa Assurance Maroc - Insurer Innovation Award 2024
 
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers:  A Deep Dive into Serverless Spatial Data and FMECloud Frontiers:  A Deep Dive into Serverless Spatial Data and FME
Cloud Frontiers: A Deep Dive into Serverless Spatial Data and FME
 
Apidays New York 2024 - Passkeys: Developing APIs to enable passwordless auth...
Apidays New York 2024 - Passkeys: Developing APIs to enable passwordless auth...Apidays New York 2024 - Passkeys: Developing APIs to enable passwordless auth...
Apidays New York 2024 - Passkeys: Developing APIs to enable passwordless auth...
 

Hadoop for Bioinformatics