Your SlideShare is downloading. ×
Upcoming SlideShare
Loading in...5

Thanks for flagging this SlideShare!

Oops! An error has occurred.

Saving this for later? Get the SlideShare app to save on your phone or tablet. Read anywhere, anytime – even offline.
Text the download link to your phone
Standard text messaging rates apply



Published on

Published in: Business
  • Be the first to comment

  • Be the first to like this

No Downloads
Total Views
On Slideshare
From Embeds
Number of Embeds
Embeds 0
No embeds

Report content
Flagged as inappropriate Flag as inappropriate
Flag as inappropriate

Select your reason for flagging this presentation as inappropriate.

No notes for slide


  1. WASPADA Demi Kebenaran Dan Keadilan Harian Umum Nasional Banda Aceh: Terbit Sejak 11 Januari 1947 Cuaca : Berawan dan Provinsi NAD: peluang hujan lokal Lereng Timur Pegunungan, Dataran Tinggi, Pesisir Timur, Pendiri : H. Mohd. Said (1905 - 1995) Angin : Barat Daya - Barat Laut Pantai Barat: Berawan Hj. Ani Idrus (1918 - 1999) Kec. antara 10 s/d 30 Km/jam dan hujan ringan Temperatur Maks/Min: 330C - 250C EDISI ACEH ISSN: 0215-3017 BMKG Polonia KAMIS, Kliwon, 20 Agustus 2009 /29 Sya’ban 1430 H ● No: 22887/A Tahun Ke-63 Terbit 24 Halaman ● Harga Eceran: Rp 2.500,- (belum termasuk ongkos kirim) Hilangkan Citra Ganja Aceh Polda Sita 89 Ton Antara BANDA ACEH (Waspada): TERORIS: Kadiv Humas Mabes Polri Irjen Pol Nanan Kapolda Aceh Irjen Pol Aditya- Soekarna (kanan) didampingi Wakadiv Humas Mabes Polri Brigjen Sulistiyo Ishak saat menunjukan foto tersangka warman menegaskan, hingga kini teroris yang diduga terlibat dalam peledakan bom Hotel Aceh masih dicap sebagai daerah JW Marriot dan Ritz Carlton beberapa waktu lalu di Mabes penghasil ganja terbesar di Polri, Jakarta, Rabu (19/8). Indonesia. Polri Rilis Identitas 4 “Saya pikir pencitraan Aceh seba- gai basis ganja sudah harus dihilang- kan, dengan cara kita semua ikut men- Buronan Bom Kuningan dukung upaya pemberantasan,” tegas Kapolda kepada wartawan di Banda JAKARTA (Antara): Polri merilis identitas empat buronan Aceh, Rabu (19/8). yang diduga terlibat peledakan bom di Hotel JW Marriott Kapolda tidak memungkiri, masih dan Ritz Carlton Mega Kuningan Jakarta 17 Juli lalu yang banyak ladang ganja di sejumlah lokasi menewaskan 9 orang dan melukai 53 lainnya. masing-masing kabupaten/kota di Kepala Divisi Humas Polri Irjen Pol Nanan Soekarna Provinsi Aceh. di Jakarta Rabu (19/8) mengatakan, warga yang memiliki Ini, katanya, disebabkan masyara- informasi soal keempat buron itu dapat menghubungi kat tidak ada kegiatan lain, sehingga Polri atau kantor polisi terdekat. jika ada yang mengajak untuk mena- Mereka adalah Syaifudin Zuhri bin Djaelani Irsyad alias nam ganja dengan memberi imbalan Udin alias Soleh, Ario Sudarso alias Suparjo Dwi Anggoro besar, langsung menanamnya. alias Aji alias Dayat alias Mistam Usamudin, Bagus Budi Kapolda menduga, maraknya pe- Pranoto alias Urwah dan Mohamad Syahrir. Syaifudin nanaman ganja di daerah itu karena Zuhri hingga kini belum diketahui asal dan tanggal lahirnya, ada pihak-pihak yang memesan dari sedang alamat terakhirnya adalah Perum Telaga Kahuripan, luar Aceh. Parung, Bogor, Jawa Barat. “Kita tangkap si penanam atau Ciri-ciri fisik Syaifudin adalah laki-laki, suku Jawa, bentuk pengedarnya, kemudian kita tanyakan kepala bulat, warna mata hitam, bentuk alis sedang, bibir siapa yang menyuruh menanam, tebal. jawaban yang kita peroleh justru Sedangkan Arios Sudarsono memiliki dua catatan kelahi- orang luar dan begitu juga pembeli ran yakni lahir di Tegal, 22 Januari 1973 dan di Kendal 20 atau penampung.” Maret 1973. Menyangkut jaringan interna- Antara Dia pernah tinggal di Kampung Pisangan RT 10 RW sional terkait peredaran sabu-sabu GANJA: Para tersangka bersama barang bukti puluhan ribu batang ganja diamankan di Mapolda Aceh, Banda Aceh, Rabu (19/8). Selama Juli- 05, Cakung, Jakarta Timur dan Gamping RT 08 RW 02 Desa Agustus 2009, Polda Aceh menemukan seluas 48,5 hektar ladang ganja (140 ribu batang lebih) di Aceh Besar, Pidie, Bireuen dan Gayo Lues, sabu- Lanjut ke hal 2 kol. 3 Lanjut ke hal 2 kol. 1 sabu 535 gram bersama 10 tersangka. Dalam Islam Tidak Ada Istilah Teroris Presiden: 2010 Semua Desa BC Soekarno-Hatta Gagalkan KOTA LHOKSEUMAWE (Waspada): Rabu (19/8) siang, ustadz DR H Rusli Hasbi, Lc, MA, dosen Universitas Islam Penyelundupan Heroin Negeri (UIN) Syarif Hidayatullah Jakarta, di mesjid komplek Mapolresta Lhokseumawe, seusai memberikan tausyiah menyambut bulan Ramadhan 1430 H kepada wartawan mengatakan, dalam Islam tidak ada istilah teroris. Kata dia, teroris merupakan nama pemberian pihak Terhubung Internet TANGERANG (Antara): Petugas Kantor Pengawasan dan Pelayanan Bea Cukai Bandara Internasional Soe- karno-Hatta, Tangerang, Banten, Ra- Maman menyebutkan, berdasar- kan pengakuan dari tersangka, kedua pelaku sudah melakukan lima kali dengan modus yang sama, namun barat terhadap umat Islam yang membangkang, seperti JAKARTA (Antara): Pemerintah paradigma “Pembangunan untuk “Percepatan pengembangan bu (19/8), menggagalkan upaya pe- pelaku mengaku hanya sebagai kurir Osama bin Laden dan kawan-kawannya. “Dalam Islam menargetkan pada tahun 2010 seluruh Semua” memerlukan beberapa wilayah melalui pembangunan in- nyelundupan narkotika jenis heroin sehingga tidak tahu apa isi paket tidak ada teroris. Islam tidak mengakui adanya teroris. desa dan kecamatan di Tanah Air telah prasyarat, di mana perbaikan kemak- frastruktur untuk membuka kete- sebanyak 60 gram. pengirimannya. Jika pun ada disebut oknum, dan oknum tidak boleh di- terhubung dengan infrastruktur tele- muran dan kualitas hidup rakyat risolasian daerah-daerah terpencil,” Kasubag Umum Bea Cukai Ban- Sementara pencegahan barang atasnamakan Islam,” sebut Rusli Hasbi. fon dan internet. secara merata ditentukan oleh ke- ujarnya. dara Soekarno-Hatta, Maman Sulae- haram tersebut berawal dari infor- Dilanjutkan, di Indonesia ada sekitar 220 juta jiwa. Kalau “Pembangunan infrastruktur tersediaan infrastruktur dasar. Pem- Khusus infrastruktur penyediaan man mengatakan, selain mendapat- masi Bea Cukai Kamboja (Cambo- ada satu dua orang teroris, terus dicap semua umat Islam informatika dan telekomunikasi dasar bangunan infrastruktur meliputi jalan air minum, pemerintah juga kan barang bukti, petugas kepabeanan dian Customs Office) yang ber- di nusantara sebagai teroris itu salah. Sementara di barat, ke seluruh pelosok tanah air adalah raya, irigasi, pelabuhan laut, pela- mengambil kebijakan strategis dengan tersebut menahan dua orang tersang- koordinasi dengan Direktorat Jenderal kalau ada yang salah dikatakan oknum, namun kalau umat wujud nyata dari tekad bersama buhan udara, penyediaan air bersih, pemberian jaminan dan subsidi bunga ka yang menyelundupkan barang ha- Bea Cukai, Badan Narkotika Nasional Islam yang salah disebut teroris. membangun kesatuan Indonesia,” telekomunikasi, dan infrastruktur kepada Perusahaan Daerah Air Mi- ram tersebut, yakni Hari dan seorang dan Direktorat IV Mabes Polri. Menurut dia, bom bunuh diri yang dilakukan teroris kata Presiden Susilo Bambang Yu- energi dan kelistrikan. num (PDAM). Program ini salah satu wanita bernama Juana. “Kami mem- Maman mengungkapkan, kedua dengan bom mati syahid para pejuang dalam mempertahan- perkirakan harga heroin itu senilai pelaku penyelundupan melanggar dhoyono, saat berpidato pada Sidang Perbaikan kualitas infrastruktur upaya mewujudkan “millennium kan agama Islam sangat berbeda. Bom bunuh diri, katanya, Rp600 juta,” kata Maman. Undang-Undang Nomor 22 Tahun Paripurna Dewan Perwakilan Daerah di daerah padat penduduk seperti development goals” (MDGs), dalam Maman menuturkan, pelaku 2007 tentang Narkotika dengan merupakan dosa besar. Sedangkan bom mati syahid seperti (DPD) RI, di Gedung DPR-RI, Jakarta, Jawa, terutama Jakarta, dibangun “Ja- bentuk penurunan separoh proporsi di Irak dan Palestina untuk membela agama Islam. “Di melakukan modus operandi melalui ancaman maksimal pidana hukuman Rabu (19/8). karta Mass Rapid Transit System penduduk tanpa akses terhadap jasa pengiriman paket PT DHL atas mati atau seumur hidup, atau paling Indonesia tidak ada permusuhan, kenapa harus ada bom Pada tahun 2010 seluruh daerah Project”, untuk mengatasi kemacetan sumber air minum pada tahun 2015. nama pengirim EJC dan nama pe- lama penjara 20 tahun dan denda bunuh diri, kalau berani datang ke Palestina, di sana terbuka lapangan, saya mendukungnya,” ucapnya. perbatasan di tanah air juga diharap- lalu lintas. Pembangunan transportasi “Air minum kebutuhan dasar nerimanya, HR, di daerah Cikini, paling banyak Rp1 miliar. Dikatakannya, pemerintah jangan hanya menangkap kan dapat menerima siaran TVRI dan nasional juga dipadukan secara ter- masyarakat, yang harus tersedia dalam Jakarta Pusat, sedangkan narkotika- Untuk penyelidikan lebih lanjut, RRI. sistem dengan pembangunan daerah jumlah yang cukup merata, dan de- nya diselipkan ke dalam kitab suci pihak BC menyerahkan tersangka Lanjut ke hal 2 kol. 3 Menurut Presiden, keberhasilan secara berkelanjutan. ngan mutu yang baik,” kata Presiden. yang dilengkapi sampul. dan barang bukti ke Mabes Polri. KPK Periksa DPR RI Dukung Baca Halaman Dalam Antasari Selama Pemerintah Bandar Ganja 165 Kg Empat Jam Soal KKA Asal Aceh Ditangkap JAKARTA (Antara): Ketua Komisi Pemberantasan Korupsi (KPK) non BANDA ACEH (Waspada) Ang- Seorang pria asal Aceh diduga bandar ganja, gota DPR RI sangat mendukung aktif Antasari Azhar, selama empat AZ ditangkap aparat Kepolisian Polsek Metro Limo, kebijakan yang akan meninjau ulang jam hari ini, diperiksa oleh lembaga Polres Metro Depok, Jawa Barat, ketauhan rencana likuidasi PT Kertas Kraf Aceh yang secara formal masih dipim- menyimpan daun ganja kering seberat 165 kilogram (KKA). Keputusan diambil setelah ada pinnya itu melalui tim Direktorat Pe- di rumahnya di Jalan H. Terin, lingkungan Rt. 03/ titik terangpasokan bahan baku untuk ngawasan Internal KPK di Rutan 03 Pangkalan Jati Baru, Limo, Depok, Jawa Barat, pabrik tersebut. Narkoba Polda Metro Jaya, Jakarta, Rabu (19/8) dinihari. “Rakyat Aceh tentu gembira de- dalam kasus pelanggaran kode etik. ngan keputusan tentang KKA itu. Kita Tim pemeriksa yang berjumlah berharap keputusan ini tidak akan lima orang datang ke Rutan Narkoba berubah. Anggap saja ini kado HUT sekitar pukul 10:30 WIB dan keluar RI bagi rakyat Aceh,” kata Nasir Djamil sekitar pukul 14:30 WIB, menggu- kepada Waspada via SMS, kemarin. nakan dua mobil. Menurutnya, rencana likuiditas Tim KPK enggan memberikan Shalat Tarawih keterangan ketika wartawan men- cegat mereka di depan Rutan justrtu mencerminkan pemerintah SBY tidak responsif dan cenderung Oleh Drs H Ameer Hamzah lepas tangan permasalahan yang di- Narkoba. alami PT KKA. Padahal, kehadiran Barang siapa mendirikan malam Ramadhan dengan Seorang anggota tim pemeriksa KKA sangat diharapkan sebagai motor keimanan dan penuh perhitungan, maka diampuni Allah Cesna Anwar hanya mengatakan, penggerak perekonomian Aceh di seluruh dosanya setahun yang lalu. (HR: Bukhari-Muslim). pemeriksaan itu bersifat internal dan sektor industri. KKA, kata Nasir sangat akan melaporkan hasil pemeriksaan Shalat Tarawih adalah shalat sunah ba’da shalat Isya, dibutuhkan sampai kapan pun oleh ke pimpinan KPK. waktunya khusus pada malam bulan Ramadhan. Shalat Waspada/Muhammad Zairin rakyat Aceh. Antasari kini menjadi tahanan ini termasuk bagian amalan untuk menghidupkan syiar PASAR MURAH: Pekerja menurunkan stok sembako untuk pasar murah yang digelar Dinas Perindagkop Karenanya, lanjut dia, keinginan Polda Metro Jaya sebagai tersangka bulan suci Ramadhan. Tempat-tempat ibadah seperti masjid, dan UKM Provinsi Aceh, Rabu (19/8) didepan halaman Masjid Raya Baiturrahman, Banda Aceh. Pasar rakyat untuk menjual atau mengalihkan kasus pembunuhan berencana meunasah, mushalla dan langgar atua surau penuh sesak yang dibuka sejak 15-20 Agustus 2009 itu diperuntukkan bagi kaum ekonomi lemah sekaligus untuk menekan kepada pihak lain harus dibang jauh didatangi kaum muslimin dan muslimat Semua mengharap Lanjut ke hal 2 kol. 1 harga menjelang bulan ramadhan 1430 Hijriah. jauh. “Kalau dilikuidasi yang untung ridha dan anpunan dari Allah. calo berdasi dan pejabat pejabat ter- Jumlah rakaat shalat Tarawih sejak dulu telah menjadi tentu baik di Aceh maupun di pusat. Sedangkan rakyat tetap rugi. “Karena Warga Diminta Waspadai Cacing Hati khilafiah di antara para ulama, ada yang cuma mengerjakan itu pemerintah SBY-Budiono haus Lanjut ke hal 2 kol. 1 beranggung jawab agar PT KKA tetap Lanjut ke hal 2 kol. 1 SIGLI (Waspada): Masyarakat diingatkan tidak mengonsumsi daging lalu mengalir dan diminum kembali oleh sapi peliharaan masyarakat. sapi terjangkit penyakit cacing hati (faciola hepaticae) dan sapi ngorok Akibatnya, hewan ternak itu terserang penyakit sapi ngorok. Serampang erampang (septicaemia epizoolicae) (SE). Untuk mengantisipasi penyakit sapi ngorok menyeruak ke Pidie, Kabid Kesehatan Dinas Pertanian dan Perikanan, Pidie Sofyan Mansur, pihaknya telah melakukan cek poin di Geumpang, terhadap sapi dan kepadaWaspada, Rabu (19/8) mengungkapkan, sesuai hasil kerja pihaknya kerbau yang didatangkan dari Meulabohk, Aceh Barat. di empat kecamatan di Kab. Pidie, ditemukan sapi peliharaan warga Bila hasil cek poin positif hewan tersebut berpenyakit, maka hewan rawan terjangkit penyakit sapi ngorok. tersebut dilarang dikirim ke Pidie. Meliputi Kec, Keumala, Tangse, Mane dan Geumpang. ”Jadi kita himbau Selain itu, petugas di kecamatan juga melakukan vaksinasi terhadap - Butuh waktu lama kepada masyarakat untuk mewaspadai dan tidak mengonsumsi daging sapi maupun kerbau secara rutin setiap setahun sekali dan bila ditemukan sapi penyakitan,” kata Sofyan. kasus sapi ngorok petugas langsung melakukan vaksinasi agar tidak Menurut dia, keempat kecamatan itu memiliki hulu sungai yang mewabah. Seraya meyebutkan, penyakit cacing hati biasanya menyerang - He... he... he... sama dengan Aceh Barat. Masyarakat di sana kerap membuang bangkai hati hewan. Penyakit cacing hati bisa menyerang manusia, bila manusia sapi peliharaannya ke hulu sungai, sehingga air di dalam sungai tercemar, mengonsumsi daging tersebut.(b20)
  2. 2 Berita Utama WASPADA Kamis 20 Agustus 2009 Anak Yatim Dan Kaum Duafa Siswa Minta Masyarakat Dapat Bantuan Meugang Hargai Kesucian Ramadhan KOTA LHOKSEUMAWE (Waspada): Para anak yatim dan kaum duafa di empat kecamatan dalam wilayah Pemko Lhok- BANDA ACEH (Antara): Seratusan dapat memperburuk citra Rama- seumawe, dapat bantuan dari Pemko Lhokseumawe. Bantuan siswa Sekolah Menegah Atas (SMA) dhan. “Kita berharap pemerintah diserahkan secara simbolis diwakili oleh geusyik (kepala desa) di Banda Aceh meminta warga masya- mengawasi masyarakat tetap berada masing-masing, Rabu (19/8) siang. rakat menjaga dan menghargai kesu- di dalam koridor hukum yang berlaku Suaidi Yahya, Wakil Walikota Lhokseumawe ditemani cian Ramadhan 1430 Hijriah di Pro- dan mendorong bagi pelaksanaan Safwan, Sekdako dan M. Rizal, Camat Muara Dua, kemarin vinsi Aceh. kegiatan terpuji,” kata pelajar lainnya, di aula kantor Kecamatan Muara Dua menjelaskan, untuk “Kita meminta masyarakat tidak Firman. Kecamatan Muara Dua, jumlah kaum duafa sebanyak 2.179 menodai kesucian Ramadhan dengan Berkaitan dengan kedatangan KK dengan bantuan Rp108.950.000. Anak yatim sebanyak 1.142 berbagai kegiatan baik dan berma- Ramadhan, Pemerintah daerah orang dengan jumlah bantuan senilai Rp57.100.000. faat,” kata seorang pelajar Zulfikar di (pemda) mengimbau masyarakat Untuk Kecamatan Muara Satu, jumlah kaum duafa 1.453 Banda Aceh, Rabu (19/8). muslim untuk melaksanakan ibadah KK dengan jumlah bantuan Rp72.650.000. Dan Jumlah anak Para siswa yang tergabung dalam puasa dan memakmurkan masjid yatim sebanyak 740 anak dengan jumlah bantuan Rp37 juta. wadahTim Pengelola Ceramah Agama dengan shawat tarawih dan tadar- Untuk Kecamatan Banda Sakti, jumlah kaum duafa sebanyak (TPCA) SMA negeri 3 itu juga melaku- rus di bulan ini. 4.159 KK dengan jumlah bantuan senilai Rp207.950.000. Jumlah kan pawai disepanjang jalan kota Petugas penegak syariat Islam atau anak yatim 1671 orang dengan jumlah bantuan Rp83.550.000. Banda Aceh sebagai simbol menyam- Wilayatul Hisbah (WH) yang kini ber- Untuk Kecamatan Blang Mangat, jumlah kaum duafa 2.159 but datanganya bulan suci Rama- gabung dengan Satuan Polisi Pamong KK dengan jumlah bantuan senilai Rp107.950.000, dan anak dhan 1430 Hijriah. Praja (Satpol PP) berupaya mening- yatim 989 orang dengan jumlah bantuan Rp49.450.000. Total Zulfikar mengatakan, sebagai katkan penegakan syariat Islam sepan- jumlah bantuan yang disalurkan untuk kaum duafa dalam daerah yang dijuluki Serambi Mekkah jang Ramadhan. “Kita akan menam- empat kecamatan senilai Rp227.100.000. Sementara untuk dan menjunjug tinggi nilai-nilai sya- bah personel dan meningkatkan pe- anak yatim senilai Rp497.500.000. riat Islam itu, masyarakat Aceh diha- negakan syariat sebab selama Rama- “Bantuan yang kita serahkan ini untuk tiga kali meugang. rapkan bersuka cita menyambut pe- dhan aktivitas masyarakat mening- Setiap kepala keluarga Rp150 ribu dan untuk anak yatim per nuh berkah ini. “Sebagai muslim kita kat,” kata Kepala Satpol PP dan WH jiwa Rp150 ribu. Bantuan ini bersumber dari APBK Lhokseuma- harus bersuka cita menyambut bulan Banda Aceh, Iskandar. we 2009. dan ini kegiatan rutin tahunan,” terang Suaidi Yahya, Ramadhan ini dan kita mengisinya Terkait penegakan syariat Islam Wakil Walikota yang diamini Safwan, Sekda.(cmun) Waspada/Muhammad Zairin dengan berbagai ibadah yang faha- itu, pedagang diharapkan ikut mem- GELAR AKSI: Siswi SMA Negeri 3 Banda Aceh membawa spanduk dalam aksi menyambut bulan suci Ramadhan lannya dilipatgandakan oleh Allah bantu Satpol PP dan WH. Tidak men- 1430 Hijriah, Rabu (19/8) di depan Masjid Raya Baiturrahman Banda Aceh. Disamping berorasi menyambut bu- SWT,” katanya. jual makanan di siang hari sesuai ke- DPR RI Dukung ... lan puasa mereka juga membagikan selebaran dakwah kepada warga yang melintasi kawasan tersebut. Dalam aksi itu, para siswa me- tentuan, sudah merupakan dukungan eksis,” sebut mantan jurnalis yang kembali terpilih sebagai minta pemerintah berperan aktif pedagang kepada Satpol PP dan WH, anggota DPR RI asal Aceh itu. mengawasi setiap tindakan yang katanya. Terkait pasokan bahan baku, Nasir mengharapkan agar gubernur mengambil kebijakan yang adil dan komprehensif. Pola tanam dan tebang yang terseleksi dapat dilakukan. “Mora- torium logging adalah solusi mengatasi kerusakan lingkungan dan sekaligus juga jalan keluar mengatasi kerusakan ling- Brunai Tetap Komit Walikota Banda Aceh kungan. Juga sekaligus mengatasi kesilitan bahan baku untuk Juru Dakwah Ramadhan pabrik KKA. Lingkungan perlu dijaga, rakyat juga perlu men- dapat pekerjaan. Sudah saatnya pemerinah Aceh melakukan program jangka pendek, menengah dan panjang untuk me- lestarikan hutan dan pabrik KKA,” ujarnya. Menurut dia, keberadaasn proyek vital seperti PT Arun, Bantu Aceh BANDA ACEH (Antara): Wali Kota Banda Aceh, Mawardy Nurdin dijad- walkan menjadi juru dakwah pada Safari Ramadhan selain mem- pererat silaturrahmi dengan masya- rakat juga bertujuan menyemarakkan PT PIM, PT AAF dan PT KKA bukan saja sebagai simbol ekonomi BANDA ACEH (Waspada): butkan, kedua petinggi militer itu kepada daerah yang terkena bencana rangkaian safari Ramadhan 1430 Hijrah bulan suci bagi umat Islam tersebut tapi juga menyangkut martabat rakyat Aceh. “Jangan terjadi Wakil Menteri Perhanan (Menhan) didampingi Atase Pertahanan Brunai tsunami seperti bantuan pembangu- di sejumlah masjid di ibukota Provinsi yang dilaksanakan pada 22 Agustus berlahan tapi pasti satu persatu proyek vital tersebut dilikuida- Kerajaan Brunai Darussalam, di Jakarta Letkol Pengiran Haji Hapiz nan masjid, mushalla, bantuan anak Aceh itu. “Safari Ramadhan sudah 2009 menurut kalender masehi. si dan yang sudah terjadi adalah PT AAF . menjadi tradisi bagi pejabat teras untuk Selain melaksanakan safari Rama- Yang Dimuliakan Pehin bin Pengiran Haji Kamaluddin dan yatim, pemberian kitab suci Al-Qur- Kita berhadap dalam tempo dua bulan ke depan peme- menyambung silaturrahmi dengan dhan, Pemerintah Kota Banda Aceh Dato Singamanteri Kol (B) Dato masing-masing ajudanWakil Menhan an, dan lainnya. masyarakat,” kata Wakil Wali Kota juga menggelar Ramadhan Fair di rintah sudah memiliki skenario yang aspiratif, rasional dan Seri Paduka Haji Muhammad dan ajudan Pangab kerajaan itu. Pada kesempatan itu, Wagub me- empiris guna menyehatkan KKA melalui program restruk- Banda Aceh, Illiza Sa’aduddin Djamal seputaran masjid Raya Baiturrahman Yasmin menyatakan Sementara dalam pertemuan nyampaikan terimakasih atas bantuan di Ban-da Aceh, Rabu (19/8). Banda Aceh pada pertengahan puasa. turisasi dan KKA harus direkturisasi total,” demikian Nasir pihaknya tetap berkomitmen yang berlangsung di ruang kerja Wa- kerajaan Brunai yang diberikan ke- Djamil. (b02) Wali kota dijadwalkan akan ber- Ramadhan Fair akan diisi berbagai membantu Aceh, baik dalam gub itu, Wagub Muhammad Nazar pada masyarakat Aceh. Disamping itu, safari Ramadhan di sepuluh masjid kegiatan keagamaan seperti kesenian bidang kesehatan, pendidikan, didampingi Asisten II Sekda Aceh, HT Wabub memaparkan tentang kejaya- sejak 25 Agustus 2009 atau pada puasa yang bernafaskan Islam guna mensyi- KPK Periksa Antasari ... dan penguatan hubungan Said Mustafa dan Kabag Humas Pe- an Aceh masa lampau sampai memili- ke empat, diawali di Masjid Al Ikhlas arkan Syariat Islam di daerah tersebut. kerjasama lainnya. merintah Aceh, Nurdin F Joes. ki rumah Aceh di Arab Saudi, yang kini Gampong Ilie Kecamatan Ulee Kareng Untuk menyemarakkan Rama- Direktur Putra Rajawali Banjaran, Nasruddin Zulkarnaen. Kabag Humas Pemerintah Aceh disebut baital Asyi. Sekarang, baital Banda Aceh. dhan dan menjaga Kota Banda Aceh Antasari juga diduga telah melanggar kode etik pimpinan Pernyataan itu terungkap saat menambahkan sebelum diterima Asyi itu sendiri menjadi sangat penting Safari Ramadhan juga dilakukan tetap aman dan tertib, pemerintah lembaga anti korupsi itu yakni menemui tersangka kasus ko- Wagub Aceh Muhamad Nazar me- Wagub, Wakil Menhan dan Pangab bagi upaya menampung jamaah ca- Wakil Wali kota, Sekda dan para asis- setempat juga mengeluarkan seruan rupsi Anggoro Wijoyo yang tengah berada di Singapura. nerima kunjungan kerja Wakil Men- Kerajaan Brunai Darussalam tersebut, lon haji asal Aceh. ten di jajaran Pemerintah Kota Banda bersama muspida agar masyarakat Kasus ini terkuak setelah Antasari membuat testimoni teri Pertahanan (Menhan) dan Pang- telah terbang dengan helikopter TNI Hal lain lagi yang disampaikan Aceh di masjid-masjid di sembilan ke- menjalankan ibadah dengan sebaik- yang menyebutkan adanya dugaan suap kepada oknum KPK lima Angkatan Bersenjata (Pangab) AD ke Calang, Aceh Jaya, didampingi wagub, terkait dengan berbagai po- camatan di Kota Banda Aceh. baiknya. yang tengah menyidik kasus korupsi proyek Sistem Komunikasi Kerajaan Brunei Darussalam, Sela- Asisten HT Said Mustafa dan peja- tensi sumber daya alam Aceh yang Radio Terpadu di Departemen Kehutanan tahun 2006 - 2007. sa (18/8) sore di kantor gubernur, bat Kodam Isklandar Muda. melimpah dan dapat dilakukan akti- Testimoni itu menyebutkan, Antasasi sempat menemui Banda Aceh. Mereka adalah Yang Di- Di Calang tamu Kerajaan Brunai vitas investasi oleh Brunai. Pemerintah Waspadai Gelombang Laut Tinggi Anggoro di Singapura, sementara KPK menilai tindakan me- muliakan Pehin Dato Singamanteri Kol itu disambut Bupati Azhar Abdurrah- Irwandi-Nazar berkeinginan mengi- nemui tersangka atau pihak yang terlibat dalam kasus yang (B) Dato Seri Paduka Haji Muhammad man dan jajaran Muspida Aceh Jaya. rimkan putra putri Aceh untuk men- BANDA ACEH (Antara): Para kata bagian observasi BMG Blang Yasmin dan Yang Dimuliakan Pehin “Sepulang dari Aceh Jaya, mereka di- dapatkan beasiswa ke negara ber- nelayan dan pelayaran kapal tongkang Bintang, Aceh Besar itu. ditangani KPK itu adalah perbuatan melanggar kode etik. Datu Lailaraja Mejar Jenderal Dato Pa- terima Wagub dan mereka kembali penduduk 350 ribu orang dengan luas diminta mewaspadai gelombang laut BMG Blang Bintang juga memper- KPK telah melaporkan Antasari ke Polda Metro Jaya atas tinggi berkisar antara 2-3 meter di kirakan cauca di kawasan Kota Banda tuduhan membuat surat palsu yakni surat pencabutan cekal duka Seri Haji Halbi bin Haji Moham- ke Jakarta sore itu juga,” ungkapr F Joes. wilayah sekitar 5765 km2, khususnya mad Yussof. Menurutnya, kunjungan mereka pada jurusan-juriusan khusus di perairan laut sebelah barat dan utara Aceh, Meulaboh (Aceh Barat), Lhok- Anggoro untuk bepergian ke luar negeri dan melaporkan Prov. Aceh hingga tiga hari mendatang. seumawe dan Sabang, berawan yang Kabag Humas Pemerintah Aceh, ke Calang antara lain untuk meng- bidang petroleum, ekonomi, dan ju- Antasari ke Mabes Polri atas tuduhan menemui tersangka. “Gelombang laut tinggi terjadi di disertai hujan ringan. Kecepatan angin Nurdin F Joes kepada Waspada menye- . evaluasi sejumlah bantuan Brunai rusan lainnya.(b04) Menurut KPK, tindakan menemui tersangka juga meru- sebelah barat sampai ke utara perairan yang bertiup dari arah barat daya pakan pelanggaran pidana sehingga harus dilaporkan ke Pol- Aceh itu riskan bagi kapal nelayan dan berkisar 5-35 kilometer perjam dan ri selain dianggap melanggar kode etik. KPK juga tengah menyiapkan laporan pencemaran na- ma baik oleh Antasari karena menuduh ada oknum KPK yang Kampung Di Aceh Besar Terima Dana 20 Juta Dolar tongkang,” kata Kasi Observasi dan Informasi Stasiun Badan Meteorologi dan Geofisika (BMG) Blang Bintang, ketinggian permukaannya sampai 3.000 fet. Suhu udara maksimum 32 derajat BANDA Aceh (Waspada): Seba- juga berkat adanya kerja advokasi stra- paten/kota tidak mengetahui konsep Alvianto, Rabu (19/8). celcius dan minimum 23 derajat cel- menerima suap yang dianggap telah mencemarkan nama Sementara gelombang laut di cius dengan tingkat kelembaban mak- baik dan fitnah terhadap KPK. nyak 604 Kampung di Aceh Besar tegi kemandirian pembangunan. ini, apalagi mereka yang merupakan perairan timur Aceh berkisar antara simum 97 dan minimum 62, sedang mendapatakan dana distribusi sebesar “Mercy Crops menyediakan be- masyarakat di tingkat kampung.“Kami 0,50-1,25 meter. Intensitas hujan di di wilayah barat Aceh suhu udara mak- 20 juta dollar US. Gubernur juga ber- berapa mekanisme pendanaan un- mengharapkan dengan kegia-tan yang seluruh wilayah provinsi ujung paling simum 31 derajat celcius dan mini- Hilangkan Citra Ganja ... komitmen menyediakan tambahan tuk program pengembangan kesada- kami bikin ini, pemerintah dapat barat Indonesia diperkirakan masih mum 21 derajat celcius dengan kelem- yang sudah mewabah di Aceh, Kapolda kembali menegaskan, 60 juta dollar US bagi 6.385 kampung ran dan kapasitas Pemerintah Aceh, memanfaatkan media massa untuk dalam katagori ringan dan sedang, baban 92-73. pihaknya terus memantau bahkan sudah menangkap tiga yang ada di Aceh. guna mendukung program pemba- menulis kampungnya,” lanjut Cut pelaku oleh Direktorat Pol Air, dan saat ini sedang dalam pro- “Sehubungan dengan itu, peme- ngunan yang berbasis kampung,” Risma. ses penyidikan. “Sabu itu katanya masuk dari Malaysia dan dalam waktu rintahan Aceh bakal memastikan se- mua kampung memiliki strategi yang ucap Cut Risma. Dia mengatakan, banyak kabu- Selain sebagai fungsi menyam- paikan informasi, media massa juga Peluang Tommy Jadi Ketum Golkar Kecil dekat, kami akan mengirim tim untuk memantau ke negeri jelas untuk membangun kemandirian paten/kota lain di Aceh belum melak- dianggap mampu membantu upaya jiran tersebut,” ungkapnya. di 23 kabupaten/kota di Aceh,” ucap sanakan strategi membangun keman- mengentaskan kemiskinan. Menu- BANDA ACEH (Antara): Penga- yang juga dosen Fakultas Hukum Un- Kapolda juga tidak memungkiri kalau saat ini di Aceh Advokasi Media Massa Impact-Mercy dirian kampung. “Sebagian masyara- rutnya, peran media massa sebagai mat politik dari Universitas Syiah Kuala syiah di Banda Aceh, Rabu (19/8). diduga ada tempat peracikan sabu. “Apakah itu dilakukan Corps, Cut Risma Aini kepada Was- kat belum memahami pentingnya pemberi pesan yang berkaitan dengan (Unsyiah) Banda Aceh M Jafar menilai, Menurut dia, meskipun dari se- di laut atau di darat, masih kita dalami,” sambungnya sekali- pada, Rabu (19/8) di Banda Aceh. strategi ini, yang merupakan usaha permasalahan di kampung, dapat peluang Hutomo Mandala Putra untuk gi finansial cukup, tapi Tommy su-dah gus berjanji terus berupaya membongkar peredaran narkoti- Dikatakan, Kabupaten Aceh Besar untuk mengurangi tingkat kemiski- disalurkan. menjadi Ketua Umum Partai Golkar lama tidak aktif lagi di Partai Golkar ka jenis sabu-sabu berikut bandarnya. suatu daerah yang sudah melaksana- nan,” ucapnya. Impact-Mercy Corps juga melak- pada Munas VII di Pekanbaru, sangat dan kurang berkomunikasi dengan Sita 89 Ton Ganja kan secara keseluruhan strategi pem- Cut Risma berpendapat, para sanakan advokasi media massa, kecil karena jaringannya kurang luas. kaderkader partai berlam-bang pohon Didampingi Direktur Narkoba Kombes Pol Rahadi bangunan kampung. Keberhasilan itu pembuat keputusan di tingkat kabu- dengan tujuan meningkatkan kapasi- “Saya menilai peluang Tommy beringin itu, sehingga sulit mencari Muyanto serta sejumlah pejabat utama Polda Aceh, Kapolda tas menulis bagi masyarakat kampung Soeharto (panggilan akrab Hutomo dukungan pada Mu-nas di Pekanbaru, Adityawarman menjelaskan, selama Semester I 2009, yang berada di sejumlah wilayah Aceh. Mandala untuk menjadi Riau, 4-7 Oktober mendatang. sosial selama ini,” imbuhnya. Direktorat Narkoba Kepolisian Aceh menyita 89 ton daun Dalam Islam Tidak ... Rusli Hasbi juga mengingatkan Makanya, seminar sehari tentang Ketua Umum Partai Golkar sangat Partai Golkar sekarang, katanya, ganja kering, dengan menangkap sepuluh tersangka. peranan media massa dalam mengu- kecil, karena selain jaringannya ku- berbeda dengan masa orde baru yang teroris, tetapi juga perlu menguping pemerintah supaya tidak kaku dengan Selain ganja, pihak kepolisian juga menyita puluhan gram keluhan rakyat untuk melakukan peru- rakyat. Karena jika kaku maka rakyat rangi kemiskinan ini diselenggara- rang luas, ia juga sudah lama tidak sangat ditentukan oleh orang-orang narkotika jenis sabu-sabu yang diduga diselundupkan da- bahan. Misalnya, mengobati kesen- akan mengambil jarak dengan pe- kan, tandas Cut Risma.(b12) terjun di dunia politik,” kata M Jafar yang berkuasa pada saat itu. ri Malaysia ke Aceh. jangan sosial di tengah masyarakat merintah. Kalau sudah mengambil Puluhan ton daun ganja kering dan sabu-sabu itu disita yang terjadi selama ini. Selain itu, in- jarak, di depan pemerintah rakyat kepolisian dalam berbagai operasi di kabupaten/kota di stansi keamanan seperti Polri harus mengatakan ‘ya’, tapi di belakang provinsi Aceh, yang ditangkap petugas di Bandara Internasio- menyatu dan berpihak dengan rakyat. pemerintah akan mengatakan yang nal Sultan Iskandar Muda, Blang Bintang, Aceh Besar bebera- “Mengantisipasi aksi terorisme, sebaliknya. pa waktu lalu. jangan hanya menangkap teroris saja, “Selain itu, instansi keamanan “Ini hasil operasi terbesar selama 2009, termasuk mem- tapi pemerintah juga perlu menguping seperti Polri itu harus menyatu dengan bekuk pelakunya,” ujar Kapolda.(b09) maunya mereka apa. Dari menguping rakyat sampai seolah-olah rakyat itu, kita bisa tahu keluhan rakyat se- mengatakan, ‘polisi berpihak kepada hingga bisa dilakukan perubahan. Jadi kami, bukan berpihak kepada peme- Shalat Tarawih ... tidak hanya menangkap maling, tapi rintah’. Kalau itu bisa diwujudkan, delapan rakaat, tambah tiga rakaat witir. Ada yang menger- mengobati sistem berpikir dalam ma- Insya Allah negeri ini aman dan ten- jakan 20 rakaat tambah tiga witir. Khilafiah tersebut harus syarakat dan mengobati kesenjangan teram,” katanya.(cmun) diposisikan sebagai “rahmat”, jangan sampai menjadi “mala- petaka” perpecahan umat. Keduanya baik, sama-sama ada Jalan Giring-Giring II No 104 RT 09 RW pengikutnya. Polri Rilis Identitas 4 ... 10 Sukmajaya, Depok, Jawa Barat. Ibadah Shalat Tarawih memang sudah sangat memasya- Sidokumpul Kecamatan Patean, Ken- Ia memiliki ciri fisik antara lain laki- rakat pada bulan suci Ramadhan.Orang dewasa, anak-anak, dal, Jawa Tengah. laki, suku Sunda, tinggi badan 165 Cm, kakek, nenek semua mendatangi tempat ibadah yang cuma Ciri fisik buronan ini adalah laki- bentuk kepala bulat, warna mata ada selama bulan ini saja. Apalagi antara shalat Isya dan Tarawih laki, suku Jawa, tinggi 165 cm, kepala hitam, alis tipis dan bibir tipis. Buronan ada sedikit ceramah yang disampaikan oleh ustaz-ustaz yang oval, warna mata hitam, alis tebal, bibir ini memiliki paspor Nomor A 167383 diundang. Tema ceramah biasanya tentang fadhilah puasa tebal dan memakai kacamata. yang masih berlaku hingga sekarang. dan ibadah sunnah bulan Ramadhan. Bagus Budi Pranoto lahir di Kudus Nanan Soekarna mengatakan, Bagi yang benar-benar serius beribadah, shalat Tara- 2 November 2009 dan alamat terakhir nomor-nomor yang bisa dihubungi wih telah membawa dampak positif terhadap pribadi yang adalah Desa Klisar Mijen RT 08 RW 01 jika ada warga yang memiliki infor- bersangkutan. Taraeih dapat melenyapkan dosa-dosa yang Kecamatan Kaliwungu, Kabupaten Ku- masi soal buronan itu adalah Ba- bersarang dalam hatinya, dapat menyembuhkan berbagai dus, Jawa Tengah. reskrim Polri di 021-7218029, 021- gejala penyakit ringan seperti sakit kepala, sakit pinggang, Ia bersuku Jawa, jenis kelamin laki- 7218309, 081383950059, sakit angin merah dan lain-lain. Sebab dalam prosesi sha- laki, tinggi badan 160 cm, bentuk kepala 0813827398774 dan Humas Polri di lat yang banyak rakaat itu berulang kali kita berdiri, i’tidal, oval, warna mata hitam, alis tebal dan 021-7218421, 081385099108. Dalam sujud, duduk tahiyyat, dan gerakan-gerakan lainnya. Da- bibir tebal. kasus ledakan bom itu, Polri telah rah yang kotor kembali bersih sebab peredaraannya seim- Ciri khusus yang dimiliki adalah menahan dua tersangka yakni Aris dan bang sampai ke otak. tahi lalat di bawah bibir sebelah kiri Indra, warga Te-manggung. Waspada/Muhammad H. Ishak Orang yang malam hari shalat Tarawih akan menda- dan memiliki noktah pada pelipis se- Tersangka lain yakni Ibrohim TERPERANGKAP LUMPUR: Jalan lintasan Banda Aceh–Calang–Meulaboh (Pantai Barat) belum rampung pat hikmah dari Allah berupa kekuatan dalam bekerja be- belah kiri. tewas tertembak di Temanggung, pengerjaannya. Bahkan belasan kilometer jalan di titik Kecamatan Lamno dan Sampoiniet, Kabupaten Aceh Ja- sok hari atau dalam beribadah. Sebaliknya orang yang ma- Mohamad Syahrir lahir di Jakarta, sedangkan tersangka Air Setiawan dan ya, berlumpur hingga 30-50 centimeter. Lumpur selain akibat longsor saat musim penghujan juga akibat jalan las shalat Tarawih akan mendatangkan nampak negatif pa- 25 Juni 2009 dan memiliki alamat ter- Eko Sarjono tewas tertembak di Beka- yang sedang dalam tahap pengerjaan. Tidak sedikit pengguna jalan, baik roda dua maupun roda empat terperang- da kepribadiannya, antara lain; mereka menjadi pemalas di akhir di Kompleks Garuda Blok C1 No si. Dua pelaku bom bunuh diri yakni kap lumpur.. Pengguna jalan mendesak Pemda Aceh di bawah kendali kontraktor segera menyelesaikan sarana siang hari sehingga berpuasa juga merasa berat. Karena itu, 6A RT 06 RW 16 Kampung Melayu, Dani Dwi Permana dan Nana Ihwan tranportasi itu. Terlihat sebuah mobil penumpang umum jenis L300 terparangkap lumpur di Kecamatan Sampoi- mari kita shalat Tarawih dengan rajin. Teluk Naga, Tangerang, Banten dan Maulana tewas di lokasi kejadian. niet, Aceh Jaya. Foto diambil belum lama ini.
  3. WASPADA Kamis 20 Agustus 2009 Luar Negeri 3 Tembak Menembak Serangan Bom Dan Mortir Di Baghdad, 10 Orang Tewas Dan Ledakan Di Kabul BAGHDAD, Irak (Antara/Reuters): Serangan terlihat di gambar televisi. bom dan mortir masing-masing selang beberapa Ledakan itu terjadi dekat Kementerian Luar menitdiBaghdadPusat,Rabu(19/8)menewaskan Negeri Irak, persis dekat Zona Hijau, kata polisi. sekurang-kurangnya 10 orang dan mencederai Para petugas keamanan PBB mengatakan 50 orang, kata polisi. setidaknya satu peluru mortir mungkin mendarat Satu ledakan bom yang cukup dekat dengan dekat kompleks PBB, juga di Zona Hijau. gedung parlemen Irak di kompleks pemerintah Ledakan-ledakan lain dekat Kementerian dan diplomatik dekat Zona Hijau yang dijaga Keuangan dan gedung pemerintah pusat * Sehari Sebelumnya, Serangan Taliban Renggut 21 Jiwa ketat memecahkan sejumlah kaca jendela, seperti Baghdad. KABUL, Afghanistan (AP): Tembak menembak dalam perjuangan mereka melawan pemerintah baru dan Korut Isyaratkan Pendekatan pasukan asing. dan serangkaian ledakan menggema di jantung Tiga petugas pemilu dan sopir mereka tewas dalam Lebih Lunak Kepala Korsel pemboman yang sama di pro- ibukota Afghanistan Rabu SEOUL, Korea Selatan (Antara/Reuters): dengan dunia luar dalam bulan ini, namun media vinsi utara Badakhshan Selasa. (19/8), sehari menjelang Hampir 120.500 warga Afgha- Korea Utara, Rabu (19/8), mengatakan, pemim- resmi di Pyongyang tetap menggunakan bahasa nistan yang didaftar untuk mem- pinnya Kim Jong-il telah mengirimkan ucapan marah atas latihan gabungan militer AS-Korsel pemilihan presiden dan belasungkawa atas meninggalnya mantan yang dimulai Senin. bantu pelaksanaan pemilu, sehari setelah para militan sementara itu kelompok Taliban presiden Korea Selatan Kim Dae-jung, sebagai “Militer dan rakyat DPRK (Korut) sepenuhnya menembaki Istana berikrar akan menggagalkannya. isyarat terakhir kemungkinan mencairnya siap untuk merespon provokasi musuh dengan Secara keseluruhan terdapat hubungan antara kedua Korea.Kim Dae-jung balasan yang tak terampuni,” kata suratkabar Kepresidenan serta Selasa meninggal pada usia 85 tahun. Rodong Sinmun, di dalam komentarnya. 3.196 kandidat, termasuk 238 meledakkan bom bunuhdiri wanita, yang bertarung untuk Dia adalah seorang tokoh istimewa Korea memperebutkan 420 kursi Selatan (Korsel) dalam mengembangkan demo- Ubah semenanjung menghadang satu iring- dewan di 34 provinsi negara itu. krasi. Dia memenangkan Hadiah Nobel Perda- Pemimpin Korut Kim bertemu dengan iringan kendaraan NATO di maian karena menyelenggarakan konferensi presiden Korsel Kim Dae-jung di bandara ketika Kabul. Pendudukan bank tingkat tinggi (KTT) pada Juni 2000 dengan Kim dia tiba pada Juni 2000 di Pyongyang untuk Dalam perkembangan Jong-il, dan berusaha mewujudkan rekonsiliasi melakukan pertemuan pertama dari dua negara lainnya, pasukan keamanan dengan Korea Utara (Korut). yang secara teknik masih dalam keadaan perang Tiga atau empat pria membunuh tiga pria bersenjata Seorang pembantu dekat almarhum Kim, itu. Keduanya berjabat tangan, saling tersenyum bersenjata mengambil alih satu yang menyerang sebuah bank Park Ji-won, mengatakan kepada para wartawan dan menyanyikan lagu tradisional mereka dalam cabang bank Pashtani Rabu dini- di Kabul Pusat, Rabu pagi, dan bahwa Korut ingin mengirimkan delegasi terdiri KTTyangmeredakanketegangandisemenanjung. hari di satu persimpangan di sedang mencari para penyerbu lima tokoh ke Korsel, untuk menghormati keper- Pertemuan itu berkulminasi pada ‘kebijakan kota kuno Kabul, kata jurubicara lain yang mungkin masih be- giannya.Diamengatakan,delegasitersebutmung- sinar matahari’ yang menyebabkan Kim Dae- Kementerian Dalam Negeri rada di dalam gedung itu, kata kin akan tiba menjelang pemakaman, yang diper- jung meraih Hadiah Nobel Perdamaian. Pemim- Zemeri Bashary. polisi, yang menuduh Taliban kirakan akan diselenggarakan di ibukota Seoul. pin Korut Kim mengadakan pertemuan dengan Polisi mengepung gedung sebagai pelaku aksi itu. Para analisis mengatakan, meninggalnya Kim para pejabat tinggi. Dengan mantan presiden itu, terlibat kontak tembak de- “Kami telah membunuh tiga akan memberikan peluang untuk perbaikan AS Bill Clinton pada bulan ini, yang menghasilkan ngan para penyerang. Bashary penyerang di dalam bank itu,” hubungan antara kedua Korea, yang memburuk dibebaskannya dua wartawati AS yang dijatuhi mengatakan belum diketahui kata kepala penyelidik kejahatan sejak Presiden Lee Myung-bak mengambil alih hukuman penjara di Pyongyang, dan juga dengan tentang korban dalam bentro- dari kepolisian Kabul, Sayed Ab- kekuasaan di Korsel sekitar 18 bulan lalu. pemimpin Hyundai Group, yang merupakan kan itu namun suara tembak dul Ghafar Sayedzada. “Mereka Lee membuat marah Korut karena memutus investor besar di Korut. menembak itu yang diiringi adalah gerilyawan Taliban,” arus bantuannya, yang diberikan sejak KTT 2000. Sementara itu, Gubernur New Mexico dan dengan serangkaian ledakan katanya. Serangan yang dituduh “Tidak ada keraguan terhadap melunaknya mantan utusan PBB Bill Richardson akan bertemu terdengar dari berbagai penjuru dilakukan gerilyawan Taliban situasi yang telah terbentuk, namun Korut akan dengan dua diplomat Korut Rabu, kata kantornya, kota selama beberapa jam. Sedi- itu terjadi saat ibu kota Afgha- tetap bersikap keras kalau ada siapapun yang di tengah tanda-tanda mencairnya hubungan kit warga sipil berada di daerah nistan itu berada dalam ke- berusaha melakukan pendekatan politik di pema- kedua negara setelah kunjungan Bill Clinton ke itu karena sejumlah kemente- amanan ketat menjelang pemi- kaman, karena mereka akan mengatakan bahwa Pyongyang. rian pemerintah dan perkan- lihan presiden dan dewan pro- kunjunganmerekatidakadahubungannyadengan Kim Myong-gil, salah seorang delegasi Korut toran bisnis ditutup Rabu sehu- vinsi, Kamis. masalah politik Utara-Selatan,” kataYang Moo- di PBB, mengusulkan pertemuan itu, yang akan bungan dengan perayaan The Associated Press Baku tembak di gedung ber- jin, seorang profesor pada Universitas Pengkajian berlangsung selama sehari di kantor gubernur Korut. di Santa Fe, New Mexico, kata jurubicara kemerdekaan Afghanistan dari penjajahan Inggris. BAWA MAYAT Polisi Afghanistan membawa tiga mayat tersangka pemberontak di belakang satu truk setelah mereka terbunuh dalam satu tembak tingkat tujuh itu telah berhenti tetapi ambulan dan pasukan ke- Meskipun sudah ada tanda-tanda melunak Richardson, Alarie Ray-Garcia. Serangan Taliban sehari se- TERSANGKA menembak di Ka bul, Rabu (19/8). Tembak menembak dan serangkaian amanan masih berada di lokasi belumnya mengguncang Afgha- ledakan menggema di jantung ibukota Afghanistan, sehari sebelum itu, kata seorang wartawan. nistan yangf mengakibatkan sedikitnya 21 orang tewas. PEMBERONTAK pemilihan presiden setelah tiga militan bersenjata AK-47 dan granat tangan menguasai sebuah bank. Polisi menyerbu gedung itu dan Sayedzada mengatakan tidak jelas berapa jumlah orang yang OKI Bahas Masalah Muslim Serangkaian serangan roket menghantam kompleks kepre- sidenan di Kabul. Afghanistan,” kata NATO dalam menewaskan ketiga militan bersenjata tersebut , kata kalangan pejabat. perempuan dan anak-anak, ini terjadi pada saat persiapan memasuki gedung itu dan polisi sedang mencari para penye- rang yang masih ada. Minoritas Uighur Dengan China Serangan itu, yang meng- satu pernyataan. cedera. akhir pemilihan presiden yang Sekjen PBB Ban Ki-moon JEDDAH, Arab Saudi (Antara/IINA): Satu merupakan penduduk minoritas di China. guncang jantung ibukota Afgha- “Dua anggota ISAF dan 53 Sementara itu, sebuah bom akan berlangsung Kamis. Rabu menyerukan semua war- delegasi tingkat tinggi Sekretariat Organisasi Delegasi juga akan menyelidiki akar persoalan nistan, terjadi menyusul anca- warga sipil Afghanistan juga pinggir jalan meledak meng- Kedua korban sedang da- ga Afghanistan yang memiliki Konferensi Islam (OKI) sedang berkunjung ke, yang mengakibatkan munculnya aksi kekerasan man baruTaliban untuk menya- cedera dalam peristiwa itu,” kata hantam satu kendaraan yang lam perjalanan menuju pusat hak pilih memberikan suara Beijing, China, untuk membicarakan masalah belakangan ini di kawasan minoritas Muslim itu bot pemungutan suara Kamis. Pasukan Bantuan Keamanan membawa dua petugas pemi- pemungutan suara di distrik ter- mereka dalam pemilu men- nasib warga minoritas Muslim Uyghur di Provinsi sehingga menewaskan ratusan orang. “Jika aksi Sebanyak 17 juta orang Afgha- Internasional (ISAF). lihan presiden ke pusat pemu- sebut, kata AbdulWasir Alokozai, datang untuk membantu mem- Xinjiang. kekerasan itu tidak segera diakhiri, maka bakal nistan memenuhi syarat untuk Sekjen PBB Ban Ki-moon ngutan suara di Afghanistan ketua panitia pemilihan untuk perkuat institusi-institusi demo- DelegasiyangdipimpinDutabesarSyedKasim merenggangkan hubungan antara China dan memberi suara mereka, di te- menyampaikan kekhawatiran Selatan, dan menewaskan wilayah selatan. Polisi mem- kratik negara itu. Al-Masri, Penasehat Sekjen OKI, berada di Beijing dunia Islam,” kata Sekjen Ihsanoglu baru-baru ngah kekhawatiran yang me- mengenai kematian dua staf keduanya, kata para pejabat di benarkan terjadinya serangan “Sekjen mendesak seluruh sejak Sabtu (15/8) untuk kunjungan selama bebe- ini. ningkat bahwa mereka tidak PBB dalam serangan bunuh diri Kandahar, Rabu. itu. wanita dan pria Afghanistan rapa hari. Kunjungan tersebut juga akan memper- Sejak awal Juli lalu, Sekjen OKI melakukan datang ke tempat pemungutan kedua yang ditujukan kepada Ledakan tersebut meng- Milisi Taliban, banyak dari yang memiliki hak pilih mem- siapkan rencana lawatan Sekjen OKI Ekmeleddin kontak intensif dengan pemerintah Beijing dalam suara. NATO di Kabul dalam dua hari. hantam kendaraan yang sedang mereka yang melarikan diri ke berikan suara mereka dalam Ihsanoglu ke Beijing dalam waktu dekat atas upaya menyelesaikan konflik tersebut. Para Namun koalisi pimpinan “Secara tiba-tiba, saya men- melaju di distrik Shorabak di Pakistan setelah invasi dipimpin pemilihan presiden dan dewan undangan Pemerintah Republik Rakyat China. Menteri Luar Negeri OKI dalam pertemuan ke- NATO menyatakan, meskipun dengar suara ledakan kuat. Saya provinsi Kandahar, yang ber- AS pada tahun 2001 yang me- provinsi,” kata satu pernyataan Delegasi itu dijadwalkan memantau langsung 36 di Damaskus, Suriah, 25 Mei lalu, meminta terjadi lonjakan serangan tidak tahu apa penyebabnya. batasan dengan Pakistan, di numbangkan mereka dari ke- PBB, mengacu pada pemilu kondisi warga Muslim Uyghur di Provinsi Oto- SekjenIhsanogluuntukmelakukankontakdengan gerilyawan, kurang dari satu per- Saya melihat putra saya cedera. mana kelompok garis keras kuasaan di Afghanistan, sering yang akan diselenggarakan nomi Xinjiang dan warga MuslimTurkistanTimur Pemerintah China agar Beijing menjamin hak- sen tempat pemungutan suara Saya harus segera membawa Taliban bersembunyi. Insiden menggunakan bom pinggir jalan Kamis. (m07) di China. Warga Muslim di kedua kawasan itu hak warga Muslim Uyghur di Provinsi Xinjiang. menghadapi resiko diserang. dia ke luar daerah tersebut,” kata Satu bom mobil bunuhdiri seorang pria Afghanistan yang Selasa ditujukan kepada iring- iringan NATO di satu jalan padat kendaraan di dekat pangkalan pakainya berlumur darah kepada wartawan di tempat kejadian. “Itu adalah serangan bu- 3.400 Orang Hilang Di Kashmir militer AS dan pasar, menewas- SRINAGAR, India (Antara/ oleh pasukan keaamanan India. didaftar sebagai hilang oleh kan 10 orang termasuk seorang nuhdiri ... dengan sasaran rom- bongan pasokan buat pasukan AFP): Pihak berwenang di Kash- Pemerintah,yangtidakmem- kelompok HAM setempat. prajurit NATO dan melukai lebih mirIndiamemperkirakanjumlah berikan rincian lagi mengenai Para pejabat keamanan India dari 50 orang, kata beberapa asing,” kata pejabat polisi Sayed Abdul Ghafar Sayedzada. orang yang hilang di negara ba- orang hilang, juga mengesam- berpendapat banyak orang yang pejabat. gian itu setelah beberapa dasa- pingkan pembentukan komisi hilangitutelahmelitaskePakistan “Menurut laporan yang Taliban mengaku bertang- gung jawab atas serangan ter- warsa kerusuhan mencapai penyelidikan untuk menyelidiki untuk bergabung dengan gerilya- diperbarui, mereka yang tewas sedikitnya 3.400 orang, kurang semuakasusoranghilangitu,kata wan dan mengatakan makam- adalah seorang anggota ISAF, sebut dan atas penembakan ro- ket ke ibu kota serta kota Jalala- dari separuh seperti disampaikan satupernyataanyangdikeluarkan makam itu makam gerilyawan tujuh warga sipil Afghanistan oleh kelompok hak asasi manusia di majelis itu. “tak dikenal” yang tewas dalam dan dua pegawai sipil Afgha- bad, Afghanistan timur, tempat sedikitnya 10 orang, kebanyakan Hitungan resmi yang dike- Pada 2007, satu kelompok tugas. Kekacauan di India telah nistan di Misi Bantuan PBB di luarkan di majelis negara bagian setempat, Asosiasi Orangtua menyebabkan lebih 47.000 orang itu menyebutkan 3.429 orang OrangHilang,mengatakanSelasa tewas, menurut hitungan resmi. hilang antara 1990 dan Juli 2009, (18/8) pihaknya menemukan 940 Kelompok HAM menyebutkan dengan hanya 110 orang yang ‘makam tak dikenal’ di 18 desa sedikitnya70.000orangtewasdan Yaman Berlakukan Jam Kerja hilang setelah penangkapan oleh di distrik Uri, yang dekat dengan hilang. Namun jumlah kematian pasukan keamanan. wilayah Kashmir yang diperintah terkait perlawanan gerilyawan Lima Jam Selama Ramadan Kelompok-kelompok hak Pakistan. di negara bagian itu telah asasi manusia lokal dan interna- Amnesty International men- menurun dengan cepat sejak SANA’A, Yaman (Antara/Saba-OANA): Dalam pertemuan sional menyatakan lebih 8.000 desak pemerintah agar menen- dimulainya proses perdamaian mingguan, kabinetYaman mengesahkan pemberlakuan lima jam orang telah hilang di wilayah itu, tukan apakah setiap makam itu yang berjalan lambat antara India kerja setiap hari kerja selama Ramadan 1430 Hijriyah, demikian dengan sebagian besar ditangkap memuat jenasah orang yang dan Pakistan. The Associated Press keterangan pers Kementerian Pelayanan Sipil. Para demonstran pelajar memegang teman mereka ketika polisi berusaha menahannya Keputusan kabinet tersebut intinya mengurangi jam kerja pada saat dia mencapai pintu gerbang Istana Malacanang di Manila, Filipina, Rabu (19/ resmi di semua lembaga pemerintah, yaitu mulai pukul 10:00 hinggapukul15:00waktusetempatuntukenamharikerjamingguan. Adapun jam kerja di rumah sakit, instalasi pelayanan kesehatan Obama Anggap Ada Kemajuan 8). Lebih dari sepuluh demonstran ditangkap dan sejumlah lainnya cedera setelah mereka bergulat dengan polisi saat ingin menerobos barisan pengamanan dalam satu unjuk rasa menentang apa yang disebut mereka sebagai tindakan korupsi di kalangan pemerintah dan lembaga serupa dikurangi hanya empat jam kerja saja setiap hari kerja, mulai pukul 10:00 hingga 14:00 untuk enam hari kerja. Sementara itu, keputusan yang dikeluarkan Selasa itu juga Masalah Pemukiman Israel Presiden Gloria Macapagal Arroyo. memberi wewenang kepada Kementerian Pelayanan Sipil untuk WASHINGTON (Antara/ “Ada gerakan pada jalan yang memangku jabatan. melakukan pemeriksaan dan pengawasan di semua kementerian Reuters): Presiden Amerika Seri- benar,”kataObamaketikaditanya Kemunculan pemerintah dan lembaga pemerintah guna memastikan bahwa para pegawai kat Barack Obama mengatakan tentang perkembangan terbaru Israel yang berhaluan keras dan tidakbolosselamaRamadhandanmenaatijamkerjayangditetapkan diamelihattanda-tandayangme- setelah berembuk dengan pertikaian di kalangan Palestina tersebut. legakan bahwa perlawanan Israel Presiden Mesir Hosni Mubarak, telahmenghambatusaha-usaha- bagi imbauannya untuk membe- 81, di Gedung Putih. nya itu. Rusia Berjanji Tinjau Kembali kukan pembangunan pemukim- an di Tepi Barat melemah. Walaupun Netanyahu tam- paknya berusaha menenangkan Iniadalahkunjunganpertama Mubarak ke AS sejak tahun 2004. Penjualan S-300 Ke Iran Selasa pagi waktu setempat (Rabu19/8WIB),seorangmenteri Washington, kelompok Perda- maian Sekarang yang anti pemu- Dia tetap tidak senang dengan imbauan mantan Presiden pemerintah Israel mengatakan kiman Israel mengatakan pem- George W.Bush bagi demokrasi MOSKOW, Rusia (Antara/AFP): Presiden Rusia Dmitry tidak ada penawaran dikeluarkan bangunan terus dilakukan untuk di dunia Arab dan kecaman Medvedev berjanji akan meninjau kembali rencana Rusia menjual bagi proyek perumahan baru di 1.100 unit rumah. pemerintahnya terhadap hak sistem pertahanan udara canggihnya S-300 kepada Iran, kata pemukiman sejak PM Benjamin “Harapan saya adalah bahwa asasi manusia di Mesir. Presiden Israel Shimon Peres Rabu (19/8),yang dikutip kantor Netanyahu berkuasa lima bulan kita akan melihat tidak hanya Negara-negaraArabmeletak- berita. lalu. usaha dari Israel, tetapi juga dari kan tanggung jawab itu pada “Presiden Medvedev berikrar akan meninjau kembali masalah Netanyahumenolakdesakan Palestina sekitar masalah-masa- Israeluntukmenghidupkankem- ini sekali lagi, setelah saya jelaskan bahwa tindakan itu berdampak Obamabagipembekuantotaldan lah hasutan dan keamanan, dari bali proses perdamaian, semen- pada keseimbangan kekuatan di kawasan kami,” kata Peres sehari jalanbuntuitutelahmenimbulkan negara-negaraArabyangmenun- tara Israel mengatakan Palestina setelah dia melakukan pembicaraan dengan pemimpin Rusia perpecahan paling serius dalam jukkan kesediaan mereka untuk dan negara-negara Arab harus itu. hubungan AS-Israel dalam satu berunding dengan Israel,” kata terlebih dulu memajukan proses Kontrak penjualan sistem rudal anti-pesawat terbang S-300 dasawarsa. Obama. perdamaian itu. itu dilaporkan telah ditanda-tangani kembali pada tahun 2005, PresidenPalestinaMahmoud Kedua pemimpin itu, yang Mubarak mengatakan dia namun menimbulkan kontroversi yang besar karena senjata itu Abbasmengatakandiatidakakan bertemu untuk ketiga kalinya da- mengemukakan kepada Obama akan meningkatkan secara signifikan kapabilitas pertahanan udara memulai kembali perundingan lambeberapabulan,membicara- “dengan sangat terus terang dan Iran. perdamaian dengan Israel sam- kan bagaimana mempercepat bersahabat” dia melakukan Di tengah keberatan AS atas kontrak itu, para pejabat Rusia pai negara itu menghentikan pe- proses perdamaian yang macet kampanye pemilu berdasarkan menandaskan beberapa bulan lalu, bahwa tak satupun sistem nambahan rumah di permu- itu, satu prioritas kebijakan luar satu rencana reformasi dan mulai pertahanan S-300 yang telah dikirimkan ke Teheran. kimannya. negeri penting bagi Obama sejak melaksanakan perubahan.
  4. 4 Agenda WASPADA Kamis 20 Agustus 2009 Java Rockin’ Land 2009: Damai Ala Musik Rock singel hit Everything You Want, panjang hingga malam hari. pilan solo memukau dari bassis penonton di hari kedua ini juga festivalinikembalimenghadirkan Send It Up dan The Best I Ever Tiga highlight lain sebelum BillySheehanbersamagitarisPaul sukses membuat setiap koridor kembang api yang bersahutan Had. Melee tampaknya merajai Mr Big dari kubu internasional, Gilbert dengan teknik drill picking kendaraan di Ancol macet to- dari samping kiri dan kanan pa- antusiasme penonton malam itu SecondhandSerenade,bandyang khas Mr Big lengkap bersama bor tal hingga menjelang subuh. nggung. meski umur band asal Califor- juga berasal dari California, serta listriknya, di depan jumlah pe- Dihariketiga,Minggu,9Agus- Dengan tercapainya target nia ini masih tergolong baru, de- dari kubu lokal, /rif dan sebuah nonton mencapai sekitar 10 ribu tus, jumlah penonton tak lagi pihak Java Festival Production, ngan sang keyboardis – vokalis, kolaborasi bernama Tribute To orang. sepadat sebelumnya, meski jauh sejumlah45ribupenontonselama Chris Cron tampil super-atraktif ImmortalLegends menampilkan Hampir semua singel hit me- lebih dibandingkan hari pertama, tiga hari penuh, plus antusiasme sambilmeneriakkan“KamiTidak semua personel wanita plus She- reka mulai dari Green Tinted Six- namunsepertibiasa,penampilan timbal balik yang sama antara Takut Datang Kesini” dibalik baju rina, Imel Ten 2 Five, Tere, Kikan ties Mind, AddictedToThat Rush, Slank mengawali acara seperti penonton dengan band interna- yang bertuliskan “We Are Not Cokelat dan lain-lain. Alive & Kickin, Daddy, Brother, biasa dipenuhi massa fanatiknya. sional di luar Mr Big kelihatan Afraid”. Secondhand Serenade mele- Lover and Little Boy, Take Cover, Dua highlight internasional terkejut sekali menikmati barisan Ledakan kembang api juga takkan tajinya seolah sebuah Wild World, Just Take My Heart, yang tampil setelahnya adalah penonton yang rata-rata hafal membuatsuasanasemakinterasa proyeksolodarisangvokalis,John hingga hit balada fenomenalnya, Mew dan Third Eye Blind. lirik semua lagu mereka, rasanya meriah. Sebagai penutup, masih Vesely, terlihat sedikit terburu- To Be With You muncul sebagai Jika aliran rock Mew terasa kita bisa positif menantikan event ada sebuah band rock eksperi- buru menyelesaikan konsernya bonus sebelum diakhiri dengan sedikit segmental di nada-nada ini kembali digelar tahun depan mental bernuansa sedikit am- tanpa yell-yell‘we want more’ dari Colorado Bulldog yang meng- minornya, Third Eye Blind yang bient asal Jepang, Joujouka penonton yang sudah didesaki hentak. seperti Java Jazz Festival, terbukti dulu sempat mencetak hit lewat Madskip-pers yang cukup massa Mr Big merangsek ke Meski sudah dimakan usia, lagu Semi-Charmed Life terma- dari banyaknya usulan tentang menyita perha-tian sebagian tengah kerumunan penonton. stamina para personel aslinya suksalahsatupionirrockberaliran band-band yang bakal muncul penonton di pang-gung Segar Barisan kian padat itu ternya- masih terlihat sangat enerjik. alternatif yang booming di medio nanti dari milis dan official face- bernuansa pinggiran laut. ta semakin terasa sesak dengan Sayang, antusiasme penonton akhir 90an. book Java Rockin’land. Hari Kedua, Sabtu, 8 Agustus jarak waktu hampir satu jam me- terlalu berdesakan tanpa sedikit- Penampilan Third Eye Blind Seperti tema perhelatan ta- merupakan puncak dari nunggu penampilan reuni grup pun jarak sempat agak mengu- yang atraktif ternyata belum lagi hun ini, ‘Rock Brings Indonesia Vertical Horizon Together’, siapa bilang musik tak pagelaraninidenganpenampilan rock legendaris yang sempat bu- rangi kenyamanan sebagian membuat penonton beranjak, Mr Big sebagai jualan utamanya bar ini, meski mereka muncul penonton memilih mundur dari karena masih ada Gigi dan Su- bisa membawa pesan perda- Konsep pertunjukan musik tunda karena kasus bom Mega lengkap Gudang Garam Inter yang di-tunggu-tunggu. Sejak tepat jadwal dengan habis- kerumunan penuhsesaktersebut perman Is Dead membagi dua maian yang terdengar begitu tiga hari penuh secara tematik Kuningan, event ini akhirnya jadi Music Java Rockin’land digelar siang, pintu masuk sudah habisan membawakan tak ku- dengankeadaanbasahkuyupdan massapenontonantarapenikmat bijak?Bahkanuntukurusanmusik dengan ratusan artis dan banyak juga digelar dengan konfirmasi sejak Jumat, 7 Agustus ini di hari dipenuhi antrian berlanjut rang dari 16 lagu plus penam- lemas keringat. Padatnya jumlah pop rock dengan punk. Penutup rock sekalipun. (dan) panggung agaknya menjadi sa- artis luar yang berkurang dari awalnya masih terlihat lengang. saran Java Festival Production rencana semula. Bagi pencinta Walau ada nama-nama seperti dalam usaha mereka menggun- cang dunia festival musik inter- nasional. musik rock, perhelatan seperti ini jadi sebuah pemuas dahaga, apalagi dengan harga tiket Naif, Alexa dan Candil Seurieus membuka festival ini di pukul 16.00,jumlahpenontonbarumu- Puteri Indonesia Tidak Takut DJ Riri Gugat Cerai Setelah Java Jazz kini telah memasuki usianya ke-5 dan Rp500.000,- (normal di luar early bird dan komunitas) untuk bisa lai terasa padat saat Andra & The Backbone tampil di panggung Pulang Ke Tanah Air Alice Norin diakui dunia sebagai perhelatan menikmatiperforma88bandlokal uta-ma Intermusic Stage. Putri Indonesia Zivanna Leti- Rumah tangga DJ Riri jazz terbesar, berikut Java Soul- dan 10 internasional selama 3 hari Dua band rock internasional sha di beberapa forum gosip ter- dengan istrinya Alice Norin nation Festival mengusung tema penuh,yangjelas-jelaslebihmurah tampil setelahnya, Melee dengan siar kabar takut pulang ke Indo- terancam bubar. Rabu (19/ RnB, Java Festival Production dibandingkan sebuah konser hits mereka BuiltTo Last semakin nesia.halitudikutipdalamsebuah 8), Riri menggugat istrinya, kini menggebrak dunia musik tunggal. membakarpenontondistageuta- wawancara Zizi sapaan akrabnya jugaberprofesisebagaiDisc rock. Bertempat di Pantai Karna- ma, dilanjutkan dengan Vertical denganpihakpanitiaMissUniverse. Jockey, di Pengadilan Aga- Sempat diisukan bakal ter- val, Ancol, event perdana bertitel Horizon disini dikenal dengan “My biggest fear is I don’twant ma Jakarta Selatan. to go home that’s my biggest fear, “Saya memasukkan because it’s very fun and excit- permohonan talak cerai ing here (saya takut tak mau pu- saudara DJ Riri terhadap lang, karena di sini sangat menye- istrinya Alice Norin,” jelas nangkan),” demikian ujar ZIzi Mada R. Mardanus, pe- dalam wawancara tersebut. ngacara Riri, saat ditemui DJ Riri dan Alice Norin/dth Pernyataan itu sontak mem- di Pengadilan Agama Ja- bentuk berbagai opini. Ada yang karta Selatan, Jl Rambutan, menganggapnya biasa saja, ada Pejaten, Rabu (19/8). juga mencaci Zizi karena diang- Mada menuturkan alasan Riri menggugat Alice karena sudah gap tidak nasionalis. tidak ada keharmonisan dalam pernikahan mereka. “Adanya Tak mau opini semakin ber- perselisihan dan pertengkaran yang terus menerus maka diputuskan Zivanna Letisha/dth untuk bercerai baik-baik,” imbuhnya. kembang, Mega Angkasa selaku HumasYayasan Puteri Indonesia, mungkin Zizi takut pulang. Ia Masih menurut Mega, jawa- Sebelumnya pada 7 April 2009 lalu, Riri dan Alice menggelar mewakili Zizi berusaha melu- hanya merasa happy di sana. ban Zizi sama sekali tidak me- jumpa pers di kediaman mereka di kawasan Cipete, Jakarta Selatan. ruskan kabar tersebut. Bukannya takut pulang. Kepula- nggambarkan bahwa ia takut Saat itu Alice mengaku menjalin cinta dengan putra pengusaha “Jadi itu hanya jawaban yang ngannya pun sudah kita persiap- pulang.Baginyamungkinbanyak Sudwikatmono, Agus Lasmono Sudwikatomono. di cut off pre eliminery interview kan” tegas Mega saat dihubungi orang yang salah mendefinisikan Saat menggelar jumpa pers itulah Riri sempat mengutarakan waktu sebelum di karantina. Tak Rabu (19/8). jawaban Zizi saat itu.(dth) niatnya untuk menceraikan Alice. Namun Alice memohon agar tidak diceraikan suaminya tersebut.(dth) Galan Slim Dukung Musik Tanah Air KAMPUS tidak hanya Slim “Sound of Distortion” yang kelangsungan band kampus menjadi tempat studi formal, diselenggarakan di kampus tersebut. tetapi berpotensi untuk mela- Fakultas Kedokteran USU Medan Animobandkampusdievent kukan pengembangan bakat pada Sabtu (15/8).Event Galan Galan Slim“Sound of Distortion” positif, di antaranya bermain Slim “Sound of Distortion” sangat baik, terlihat dari banyak- musik, melalui band-band kam- merupakan kompetisi band nya band yang mendaftar serta Ferry Budiman-Aak Medan Production bersama len Freadly (tengah) serta lex X n G A - Mild usai pus. Banyak dijumpai band ter- antarkampussekaligusajangbagi berpartisipasi di event tersebut. temu pers sebelum konser Tribute to Michael Jackson dilangsungkan kenal berasal dari kampus, misal- para band kampus untuk me- Masyarakat pun sangat antusias nya “Sheila On 7” dari UGM nunjukkan talentanya pada sesa- untukmenyaksikanperformance Yogyakarta. ma mahasiswa serta masyarakat. wajah-wajah baru yang berbakat Ben Lagu Pertama Michael Jackson Band kampus, biasanya memiliki penggemar tersendiri, siapa lagi kalau bukan teman- Disini terjadi interaktif antara band dan penonton, dimana pe- nontondapatmemilihbandyang serta mendapatkan hiburan. “Kegiatan ini sebagai wujud dukungan Galan Slim, sebagai Dikenal Glen Freadly teman satu kampusnya. Banyak di antara band kampus ini yang memilki talenta luar biasa, tetapi menjadi favoritnya. Melalui event Galan Slim“Sound of Distortion”, performanceband-bandkampus brand yang peduli akan perkem- bangan musik Indonesia teruta- ma pada talenta band muda,” Glen Freadly mengaku mulai mengenal lagu- pendukung acara tersebut, Glen memaparkan mereka menghadapi beberapa akan dinilai langsung oleh ujar Yuniarko E dari Galan Slim. laguMichaelJacksonsejakkelasIVSD diperkenalkan betapa hebatnya sosok seorang Michael Jackson kendala, salah satunya adalah penonton, sehingga menun- Dikatakan, selain Galan Slim orang tuanya. Ben adalah Lagu pertama mampu serta kesetiaannya dijalur musik. kesempatanuntuktampil,sehing- jukkan penerimaan masyarakat “Sound of Distortion”, juga meng- merasuki jiwanya dan berlanjut sampai sekarang. Michael Jackson kata Glen Freadly, adalah ga dikenal oleh masyarakat. akan band tersebut. Bagai- gelar Galan Slim Loud &Vote.“Ini Pengakuan tulus tersebut diutarakan Glen Frea- seorang legenda dan seniman besar di jalur musik Melihat kondisi itu, Galan manapun, masyarakatlah yang merupakan event outdoor dan dly sebelum manggung di acara Tribute to Michael pop. Rasanya tidak berlebihan bila akhirnya men- Slim, mengadakan event Galan akan menentukan eksistensi dan wadah bagi para anak band di Jackson di Retro Medan belum lama berselang. diang Michael Jackson dianugerahi gelar The King daerah untuk menunjukkan Pagelaran dikemas Anak Medan Production didu- of Pop. Kiprahnya sebagai entertainer sejati sudah talentanya pada masyarakat,” kung X Mild mampu mengembalikan kenangan terbukti, apalagi dia mampu menjadi orang kulit tambah Yuniarko. pengunjung betapa besarnya bintang Jacko begitu hitam pertama menembus batas warna kulit di Sebelumnya, Galan Slim panggilan akrab The King of Pop ini. negaranya Amerika Serikat. “Loud &Vote” telah digelar di Kec. Glen menyebutkan, keluarganya memang tidak Tidak cuma mampu menembus perbedaan Tanjung Morawa, Kab. Deli Nabila Syakieb/dth bisa dilepaskan dengan dunia seni, terutama musik. kulit, karya-karya agung Michael Jackson juga Serdang dan di Kec. Sei Rampah, Ayahnya senang jenis musik klasik, ibunya gemar mendengar lagu-lagu keluaran Motown khusus banyak membicarakan tentang kemanusiaan. Con- tohnya lagu Heal TheWorld yang fenomenal serta Kab. Serdang Bedagai pada Sabtu Ashraf Sinclair Bantah (15/8). “Animo event Galan Slim mengangkat artis-artis kulit hitam dan om-nya sendiri maniak musik rock. banyaklagilagu-lagunyamampumenggugahdunia bersama artis-artis lainnya tercermin di lagu We “Loud &Vote” juga sangat tinggi, terlihatdaribanyaknyabandyang Dekati Nabila Syakieb Glen sejak kecil walaupun sudah dicekokin Are The World. mendaftar,” jelas Yuniarko. Baru-baru ini terhembus kabar Ashraf Sinclair merupakan musik-musik karya musisi kulit hitam, namun orang Glen sendiri menjelaskan, bahwa dirinya sangat Dikatakan,untukmendukung penyebab kandasnya hubungan Nabila Syakieb dan Yuri. Ketika tuanya tidak pernah memaksakannya agar menjadi shock saat mendengar kabar tentang meninggalkan perkembangan musik tanah air, dikonfirmasi, suami BCL itu pun langsung menampiknya. seperti Michael Jackson. Ia sendiri pun dalam karir- Michael Jackson. Dan secara kebetulan pula dia pihaknya juga menyediakan PemainfilmasalMalaysiatersebutmengungkapkanhubungannya nya memilih genre sendiri, karena prinsipnya Glen lagi berada di studio menyiapkan sebuah lagu yang latihan gratis di studio musik yang dengan Nabila hanya sebatas rekan kerja. Sebelumnya mereka pernah menilai, dirinya tidak mungkin bisa seperti Michael belum tercipta liriknya. Namun musiknya bagaikan telah ditunjuk. “Secara keselu- berakting sebagai suami istri di film horor ‘The Real Pocong’. Jackson dan Michael Jackson pun tidak bisa sepertti ungkapan perasaan hatinya kayaknya cocok sekali ruhan, event Galan Slim “Sound “Ya kita nggak ada apa-apa cuma gosip-gosip doang,” ujarnya dirinya. untuk dipersembahkan buat idolanya. of Distortion” dan Galan Slim saat ditemui di Persari, Ciganjur, Selasa (18/8). Saat menghadiri temu pers sebelum konser Ketika ditanya, kapan lagu tersebut dirilis, Glen “Loud &Vote” sangat bermanfaat Ashraf juga membantah kalau BCL sempat cemburu dengan Tribute to Michael Jackson di Garuda Plaza Hotel masih menyimpannya sebagai rahasia, karena untukpengembangantalentapara Nabila ketika mereka terlibat dalam satu sinetron berjudul ‘Cinta dihadiri juga Ferry Budiman Sumbayak dari Anak dalam waktu dekat ia akan menggarap vidio klipnya Waspada/Ist anak band. Untuk itu, kita akan dan Anugerah’. Ia pun menekankan dirinya tidak punya perasaan Medan Production serta Hangga Saputra-Regional serta membuatkan lirik lagu tersebut yang ia Salah satu grup band peserta untuk gigi di ajang alan Slim Sound G “ menggelar kegiatan ini di seluruh terhadap Nabila.“Nggak ada chemistry sama Nabila sampai sekarang,” Promo Manager Sumbagut PT Bentoel Prima selaku persembahkan buat Michael Jackson.(m09) of istortion” i USU Medan, Sabtu (19/8). D d daerah di Sumut,” katanya. (m42) pungkasnya.(dth) 07.30 Kuis Siapa Lebih 07.30 Musik : Inbox 07.00 Masquerade 07.00 Pororo The 07.05 Indonesia This 07.30 Musik 09.00 Kabar 9 07.00 KiSS 07.00 Avatar 07.30 I Gosip Pagi Berani 09.30 Halo Selebriti 07.30 Layar Pagi Little Penguin Morning Derings 09.30 Kabar Pasar Vaganza 08.00 Dora The 08.00 Selamat Pagi 09.00 Musik : Dahsyat 10.00 Sinema Pagi 09.30 Cerita Pagi 07.30 Kartun Dino 07.30 Metro Xin Wen 09.00 Jail 10.00 Documen- 08.30 Impian Explorer 09.00 Ngelenong 11.00 Silet 12.00 Liputan 6 10.30 Nekad 2 Babies 09.05 Archipelago 09.30 D Show tary one Sang Putri 09.00 Obsesi Nyok 12.00 Seputar Indone- Siang 11.00 Sidik 08.00 Star Kids 10.30 Chat Club 10.30 Jelang Siang 11.00 Opini 09.30 FTV Drama 10.00 MTV Gaya 10.30 60 Minutes sia Siang 12.30 Luping Show 12.30 Go Show 09.00 Espresso 11.05 I Witness 11.00 Insert 12.00 Kabar Siang 12.30 Sergap 10.00 Heboh 11.30 Patroli Bebas 11.30 Redaksi Siang 13.30 Kasak Kusuk 13.00 Layar 11.30 Megapolitan 12.00 Reportase 13.00 Tepi Jaman 13.00 Musik : Hits 11.30 Topik Siang 12.00 Fokus Siang 11.00 MTV Ampuh 12.00 I Gosip Siang 14.00 Plalist Kemilau 12.05 Metro Siang Siang 13.30 Expose 15.00 Kabar Kabari 12.00 Musik : Klik 12.30 Happy 12.00 Abdel & 12.30 Bocah 16.00 Kepompong 13.30 1001 Cerita 13.30 Save Our 14.00 Bioskop 15.00 Kabar 15 15.30 OB Shift 2 13.30 Transformer Song Temon Petualang 17.00 Liputan 6 14.30 Go Show Nation Indonesia 16.00 Menyingkap 16.00 Duit Kaget 14.00 Speed Racer 14.30 KiSS Sore 13.00 Global Siang 13.00 Laptop Si Unyil Petang 15.00 Masquerade 15.05 Bisnis Hari Ini 16.00 Insert Sore Tabir 16.30 Bedah Rumah 16.00 Buka Kartu 15.30 FS Boy 14.30 Spectaculer 14.00 Cita-Cita 17.30 Cinta 15.30 Casper 17.00 Discover 16.30 Orang Ketiga 16.30 Mata Kamera 17.00 Seputar Indonesia 16.30 Topik Petang Before Flowers Spiderman 15.00 Koki Cilik Memang Kuya 17.00 Ninja Warrior Indonesia 17.00 Reportase 17.30 Kabar Petang 17.30 Baim Anak 17.00 Santai Bareng 17.00 Kasih Dan 15.30 Mata Angin 16.00 Jejak Petualang 18.00 Lemon Tea 18.00 Ben 7 17.30 Metro Hari Ini Sore 19.00 Suara Rakyat Sholeh Yuk Amara 17.00 Spongebob 17.00 I Gosip News 19.00 Melati Untuk 19.00 Mukjizat 19.05 Suara Anda 17.30 Kado 19.30 Satu Jam 18.00 Manohara 18.30 Kena Deh 18.00 Tangisan 18.00 Naruto 17.30 Rahasia Marvel Cinta 20.30 Genta Istimewa Lebih Dekat 19.00 Cinta Dan 19.00 Segeerrr Isabella 19.00 Abdel vs Sunnah Anugerah 20.30 Cinta Fitri 20.00 Mansooe La 20.00 4 M : Makin Demokrasi 18.00 Suami Suami 20.30 Telusur 19.00 Jiran Temon 18.30 Musik On The 20.30 Dewi 21.30 Terlanjur Gokilun Malam Makin 21.05 Top Nine Takut Istri 21.00 Apa Kabar 20.00 Inayah 20.00 Lesehan Spot 22.00 Masihkah Kau Cinta 21.00 Gado Gado Mantap News 19.00 Bioskop Indonesia 22.00 Mega Lagee 20.00 Opera Van Java Mencintaiku 22.30 Gala Sinema 22.00 Curhat 21.30 Tawa Sutra 21.30 Welcome BCA Indonesia 22.00 Bang One Bollywood 21.00 Srimulat 21.00 OKB 01.00 Seputar Indone- 00.30 Liputan 6 Bareng Anjas 23.00 Kena Deh 22.05 Just Alvin 21.00 LG Mobile Show 00.00 FS The 22.00 Big Movies 22.00 Mister Tukul sia Malam Malam 00.00 Yukita Tawa 23.30 Topik Malam 23.05 Inside World 22.30 IBL Full Hospital 00.00 F1 Sensation 23.00 Begadang 01.30 UEFA Champi- 01.00 Buser 01.30 Neo Joged 00.00 Lensa Olah 23.30 Metro Sports 22.00 Bioskop Court 01.00 Fokus 00.30 Global 00.30 Sport 7 Malam ons League 01.30 Playist Asyik Raga 00.05 Metro Malam Trans TV 23.00 Di Balik Malam Tragedi Malam 02.00 Reportase CATATAN Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan Malam **m30/B
  5. WASPADA Kamis 20 Agustus 2009 Nusantara 5 Ucapan Pangdam Dinilai Pemilu 2009 Dianggap Buruk Sudutkan Islam JAKARTA (Waspada): Tahapan pemilihan umum, baik pemilihan anggota legislatif maupun pemilihan presiden 2009 JAKARTA (Waspada): Pernyataan Pangdam IV Diponegoro, hampir usai. Meski demikian, kritikan terus dialamatkan kepada Mayjen Haryadi Soetanto beberapa waktu lalu berbunyi, ‘jika Komisi Pemilihan Umum (KPU) yang menilai pelaksanaan pemilu ada orang asing memakai sorban, jubah atau berjenggot, laporkan tahun ini buruk. saja ke pihak keamanan,’ dinilai telah mengandung unsur SARA. Ketua KPU Hafiz Anshari mengatakan, semua orang punya Bahkan pernyataan itu dinilai melukai umat Islam. hak untuk menilai. “Namun harapannya, penilaian itu secara “Pernyataan itu sungguh menyinggung umat Islam dan menim- obyektif, adil, realistis, bukan karena kepentingan politik tertentu,” bulkan kecurigaan-kecurigaan terhadap golongan Islam Salafy kata dia, Selasa (18/8). atau Majelis Tabligh,” tegas Ketua Lajnah Tanfidziyah Majelis Ditambahkan Hafiz, harus ada parameter yang jelas untuk Mujahidin Indonesia (MMI), Irfan S Awwas, Rabu (19/8). menilai sebuah keberhasilan pemilu. Karena bagi Hafiz, ini adalah Irfan mengatakan, tuduhan ataupun stigma terorisme seringkali pemilu yang luar biasa. Dia lantas membeberkan kendala yang mengarah kepada ajaran atau golongan Islam ketika terjadi teror dihadapi komisi yang dipimpinnya itu. Di antaranya soal waktu. dan aparat memeriksa wanita bercadar dan menciduk kelompok Para anggota KPU kata dia, baru dilantik 23 Oktober 2007, sementara pendakwah itu adalah hal sudah keterlaluan. 5 April 2008 sudah masuk tahapan pemilu. “Jika ini dibiarkan maka orang tua akan melarang anaknya “UU No 10 Tahun 2008 ditandatangani 31 Maret 2008, kita belajar mengaji karena takut dikemudian hari dicap sebagai teroris,” terima 3 April. Padahal 5 April masuk tahapan pemilu. Padahal kata dia KPU harus buat 48 peraturan,” tambah dia. Terkait tindakan densus 88 dalam penangkapan pelaku teroris Selain itu KPU sebelumnya tak dipusingkan permasalahan di Temanggung beberapa waktu lalu, Irfan mengatakan, densus pemilihan kepala daerah (pilkada), beda dengan yang sekarang. 88 bertindak over acting serta melanggar aturan hukum. “Densus “Tidak ada pilkada di 2004, sedangkan pada 2008 kita harus 88 bertindak berlebihan, brutal dan membabi buta,” tandasnya menyelenggarakan pilkada 160 gubernur, walikota, problema Dia juga mengatakan, tindakan densus 88 akan menimbulkan besar, apalagi ada perubahan regulasi,” sebutnya. keresahan bagi umat Islam. “Ada umat Islam yang dicurigai aparat Dari sisi anggaran kata Hafiz, juga ada kendala. “Dari sisi langsung menangkapnya. Ini akan menimbulkan keresahan bagi anggaran, DIPA I cair 24 Juni 2008. Kita mulai kerja Januari atau umat Islam,” tuturnya.(vivanews) enam bulan setelah itu,” tambah dia, Siapapun yang ingin memberikan penilaian kinerja KPU harus JK Minta Pemerintah punya parameter. “Perbandingannya, ada UU berbeda, kondisi dan tata cara,” kata Hafiz. “Silahkan melakukan penilaian, Baru Awasi Otonomi GURU HONORER: Ratusan guru honorer menggelar aksi unjuk rasa, di depan Istana Merdeka, Jakarta, Rabu (19/8). Para Antara menilainya komperhensif, realistis, objektif sehingga menghasilkan yang benar.” tambahnya. (vivanews) JAKARTA (Waspada): Wakil Presiden Jusuf Kalla mengatakan, guru honorer dari berbagai daerah itu menuntut Presiden Susilo Bambang Yudhoyono agar mengangkat mereka menjadi salah satu tantangan yang dihadapi pasangan Susilo Bambang Yudhoyono (SBY) dan Boediono adalah otonomi daerah. Pemerin- Pegawai Negeri Sipil. Kuasa Hukum Prita Nilai tah diharapkan memberikan kesempatan kepada daerah Keterangan Dr Grace Janggal Rapat Paripurna menjalankan otonomi daerah secara leluasa, namun tetap disiplin. Hal itu dikatakan Jusuf Kalla (JK) usai menemui rombongan TANGERANG (Waspada): Dr Grace dari RS Omni Internasional pasukan pengibar bendera pusaka dari Sulawesi Selatan di Istana diperiksa sebagai saksi dalam kasus Prita Mulyasari. Kuasa hukum Wapres, Rabu (19/8). “Masalah saat ini timbul karena suatu sistem Prita menilai ada kejanggalan dalam keterangan Dr Grace. DPD Keluhkan yang garis pemerintahannya tidak sesentral dulu,” kata dia. “Kami melihat ada kejanggalan dari keterangan saksi,” kata Karena itu menurut JK, dibutuhkan suatu dorongan dan juga kuasa hukum Prita, Samsu Anwar menanggapi keterangan saksi kesempatan kepada daerah untuk menjalankan otonomi daerah Dr Grace terkait kasus pencemaran nama baik dengan terdakwa secara leluasa. Namun pemerintah harus tegas dan disiplin Prita di Pengadilan Negeri Tangerang, Banten, Rabu (19/8). mengawasi otonomi daerah. “Juga kalau ada masalah tetap ada Samsu mengungkapkan beberapa kejanggalan dalam punishment-nya, jadi tetap ada disiplin yang berjalan,” tuturnya. keterangan yang diberikan saksi Dr Grace. Kejanggalan pertama Wilayah Perbatasan Menurut JK, tugas pemerintah saat ini memang menjalankan menurutnya, adalah pengakuan Dr Grace bahwa dia langsung pemerintahan secara umum dan membangun infrastruktur secara datang ke sentra pengaduan polisi untuk melaporkan kasus merata di seluruh daerah. Selebihnya, kata Kalla, merupakan pencemaran nama baik dirinya. tugas masyarakat. “Kita membangun suasana dan harmoni di Hal itu dianggap Samsu sebuah kejanggalan, karena pada masyarakat,” kata dia. kenyataannya kuasa hukumnya Grace lah yang datang untuk Namun JK tetap berharap pasangan SBY - Boediono dapat melapor. “Grace tidak datang langsung melapor ke polisi. Ter- menjalankan pemerintahan dengan baik. “Ya mudah-mudahan JAKARTA (Waspada): Ke- jukkan maraknya eksploitasi Konkritnya, menurut Gi- pernah berhenti mengajak selu- nyata yang datang kuasa hukumnya, dia hanya buat surat,” ujar semua bisa berjalan,” ucapnya.(vivanews) tua Dewan Perwakilan Dae- sumber daya alam secara ilegal nandjar, pusat-pusat pertum- ruh jajaran pemerintahan untuk Samsu. rah (DPD) Ginandjar Karta- di daerah perbatasan, baik pe- buhan perlu dikembangkan di senantiasa menjaga mentalitas, Kejanggalan berikutnya soal pengambilan darah Prita. Menurut Mahfud Risau Tak Adanya sasmita menekankan tentang pentingnya mengamankan nambangan ilegal, pembalakan liar, penangkapan ikan ilegal (il- wilayah perbatasan, sentuhan sosial dari pusat juga harus in- integritas dan etika profesio- nalisme setinggi-tingginya. Samsu, pengakuan Dr Grace yang didasari keterangan Dr Hengky bahwa Prita diambil darahnya sebanyak dua kali adalah tidak Pengawasan Hakim MK wilayah perbatasan. “DPD menaruh perhatian besar ter- legal fishing), sampai perda- gangan manusia ilegal (human tens dilakukan guna mem- bangun semangat nasionalisme, “Jangan pernah berpikir, apalagi tergoda berkompromi dengan benar. Sebab Prita hanya sekali diambil darahnya. “Pengambilan darah Prita hanya sekali, ini juga kejanggalan,” katanya. kait kondisi wilayah perba- trafficking). dan infrastruktur harus di- integritas, utamanya menya- Berikutnya adalah soal kewajiban memberikan keterangan JAKARTA (Waspada): Ketua Mahkamah Konstitusi (MK) tasan,” ujar Ginandjar di ha- Bukan cuma itu, daerah bangun secara memadai untuk lahgunakan wewenang untuk tentang perawatan medis yang akan dijalani oleh pasien. Menurut Mahfud MD meragukan kualitas hakim konstitusi ke depan. Dia dapan Presiden Susilo Bam- perbatasan pun marak dengan mendukung keamanan serta kepentingan pribadi, apalagi Samsu, pihak RS Omni yakni Dr Hengky, tidak memberikan merasa gundah karena selama ini tidak ada yang meng-awasi bang Yudhoyono saat rapat penggunaan uang negara te- kemandirian ekonomi di per- korupsi,” tandas Presiden. keterangan medis kepada Prita. kinerja hakim konstitusi. paripurna DPD di Senayan, tangga seperti dollar Singapura batasan. Menurut SBY, jaminan Pengakuan Dr Grace mengatakan Prita dijelaskan soal “Saya ragu 15 tahun atau 20 tahun ke depan apakah kualitas Jakarta, Rabu (19/8). dan ringgit Malaysia, keter- “Semua itu penting untuk pembangunan tanpa korupsi, perawatan medis yang akan dijalaninya, menurut Samsu, tidak hakim masih bisa dipertahankan. Saya risau karena MK tidak gantungan masyarakat pada memperkuat wibawa Indonesia akan terwujud dengan pelak- benar. “Tidak ada memberikan keterangan medis, bahkan hingga ada yang mengawasi,” ujar Mahfud saat memberikan sambutan Ginandjar mengingatkan sumber penghidupan dan pe- di mata rakyatnya sendiri dan sanaan pakta integritas dan selesai dirawat pun tidak diberikan catatan rekam medis itu. pada peluncuran buku karya tiga hakim konstitusi dan pe-luncuran bahwa Indonesia sudah sering rekonomian negara tetangga, di mata negara-negara tetangga,” kontrak kinerja yang konsisten. Padahal pasien berhak untuk itu.” websitepribadi Ketua MK di Aula Gedung MKRI Jl. Medan Merdeka diganggu dan dikejutkan oleh serta dominannya arus infor- tegas Ginandjar. Pada akhirnya, “Pemerintah pusat dan daerah Karena kejanggalan itu, kuasa hukum Prita secara khusus Barat, Jakarta, Rabu (19/8). manuver politik dari negara masi dari media negara te- Ginandjar menyatakan bahwa yang tidak berhasil menjaga meminta Dr Grace agar tidak memberikan keterangan palsu. Mahfud menyayangkan pasal pengawasan Komisi Yudi-sial tetangga, seperti kasus di Blok tangga. DPD bertekad untuk terus me- integritas dan profesionalitas “Kami ingatkan saudara saksi di bawah sumpah,” tegur Samsu (KY) kepada MK yang sekarang ini tidak bisa dihidupkan kembali, Ambalat. Ginandjar mengungkit Kondisi itu lambat laun ber- ngawal agenda pembangunan kerjanya harus siap memetik kepada Dr Grace. kecuali dengan adanya amandemen konstitusi. Menurutnya, hilangnya Pulau Sipadan dan implikasi negatif terhadap rasa di wilayah perbatasan. kegagalan ataupun kehilangan Sidang pencemaran nama baik RS Omni dengan terdakwa hakim MK juga harus diawasi dan tidak boleh diistimewakan. Ligitan dari wilayah Negara kebangsaan dari masyarakat Korupsi kepercayaan dari rakyat yang Prita Mulyasari mengajukan 3 saksi di antaranya 2 dokter RS Dulu ketika MK memutuskan bahwa hakim MK tidak bisa Kesatuan Republik Indonesia. yang berada di kawasan terse- Sebelumnya, Presiden SBY dipimpinnya.” Omni yakni Dr Hengky dan Dr Grace. Satu lainnya adalah Reynold diawasi oleh KY, Mahfud yang kala itu menjadi anggota DPR “Hal itu terjadi karena kondisi but. “Hal itu menjadi titik rawan mengingatkan pejabat peme- SBY juga berjanji, reformasi Parentino Panjaitan.(dtc) mengatakan dirinya termasuk sebagai orang yang marah dan tidak puas mengapa penaf-sirannya bisa demikian. riil di kawasan perbatasan yang dalam menjaga keutuhan rintah daerah yang memiliki birokrasi kementerian dan “Jika ada gagasan amandemen kelima UUD, saya yang sangat memprihatinkan, baik NKRI,” ujar Ginandjar meng- kewenangan jangan mudah lembaga dapat diselesaikan pada pertama mengusulkan agar hakim konstitusi diawasi KY. Kalau secara fisik, ekonomi, maupun ingatkan. tergoda melakukan korupsi. 2011. “Secara bertahap peme- bisa kita jadi punya checks and balances. Saya akan mengusul- sosial,” ujarnya. Oleh karena itu, DPD men- “Lima tahun terakhir ini tidak rintah melaksanakan program kan agar dalam pasal 24b UUD, KY itu tidak hanya mengusul- Ginandjar juga menyam- desak agar pengembangan dan sedikit pejabat pemerintah reformasi birokrasi, agar pela- kan hakim agung dan mengawasi perilaku hakim, tapi juga paikan laporan dari anggota- pengelolaan wilayah perbatasan daerah yang mendapatkan yanan kepada masyarakat prima mengawasi hakim konstitusi dan semua hakim,” jelasnya. anggota DPD di tiap provinsi hendaknya menjadi prioritas penindakan hukum karena dengan mengedepankan tata Mahfud mengkhawatirkan semakin lama idealisme hakim yang berbatasan dengan negara pemerintah, dengan dukungan korupsi,” kata dia. kelola pemerintahan yang akan semakin luntur. Dirinya khawatir jika tidak diawasi hakim tetangga. Laporan itu menun- anggaran khusus dari APBN. Presiden mengatakan, tidak baik.”(j07/vivanews) Beasiswa Dan Wajah Baru FIF akan bertindak sewenang-wenang nantinya. Mahfud juga berpendapat agar proses seleksi hakim kons- titusi yang berasal dari unsur DPR tidak diseleksi sendiri oleh DPR. Tetapi dititipkan kepada sebuah lembaga independen yang dibentuk secara ad hoc. Contohnya, jika sekarang ada hakim MEDAN (Waspada): Presi- yaitu cabang Bogor, Yogyakarta Surianto Chen, Kepala Cabang customer yang 6 persen di konstitusi yang kosong dan diisi penggantinya dari DPR, maka dent Director Federal Interna- dan Medan. “Namun pada 2010 Medan Agus Susanto serta Ke- antaranya berada di Sumut. bisa dibentuk lembaga ad hoc dari luar DPR dan DPR tinggal tional Finance (FIF) Jakarta, diharapkan semua cabang pala Pemasaran Medan David Helm standar mengesahkan saja. Suhartono menekankan perlu- sudah melakukan hal sama, Suwardi, FIF bersama World Kasubdit Bid. Gakkum Polda “Karena kalau DPR itu bisa dipolitisir. Siapa yang punya nya melakukan perbaikan pela- yaitu meningkatkan performa Wild Foundation (WWF) telah Sumut AKBP Endang Her- hubungan politik dan kapasitas DPR tidak memiliki kemam- yanan untuk meningkatkan pelayanan,” kata Suhartono me- menanam 4.000 pohon di mawan yang hadir berharap Antara puan untuk menggelar fit dan proper test,” ucap dia.(dtc) kepuasan para pelanggan. Salah nyebutkan, Medan merupakan kawasan Gunung Rinjani. FIF juga menyediakan helm SIDANG LANJUTAN PRITA: Prita Mulyasari (32) terdakwa satunyaone stop solution service pilot projek untuk program ini. Kepedulian sosial lainnya, standar bagi para pelanggan. kasus pencemaran nama baik terhadap Rumah Sakit (RS) Omni atau satu pintu. Dalam rangkaian itu, FIF membantu para lansia (lanjut “Ini salah satu bentuk kepedu- 115 Caleg Akan Gugat KPU Suhartono mengatakan itu Medan juga memberi beasiswa usia), perbaikan dan rehabilitasi lian sosial di bidang lalu lintas,” Internasional Tangerang, bersiap menjalani persidangan, di Pengadilan Negeri Tangerang, Banten, Rabu (19/8). Prita kembali JAKARTA (Waspada): Para calon legislatif (caleg) yang gagal saat peresmian wajah baru laya- kepada 10 siswa SD, SMP dan rumah ibadah, rehab ruang gur- kata Endang. menjalani persidangan setelah Jaksa Penuntut Umum (JPU) masuk Senayan karena putusan Mahkamah Agung (MA) soal nan terpadu FIF Cabang Medan, SMA berprestasi. “Mereka anak- u di daerah, serta memberi ke- Undang-undang lalu lintas melakukan perlawanan (verzet) atas putusan hakim yang penetapan tahap kedua tidak jadi dilaksanakan, akan menggugat Rabu (19/8) di kantor FIF Jl. anak pelanggan yang mem- sempatan kepada 40 pelanggan dan angkutan No. 14 /1992 yang menghentikan sidang dan membebaskan Prita melalui putusan KPU ke Pengadilan Tata Usaha Negara (PTUN). Hal itu dilakukan Kapten Muslim. Selama ini kata punyai kemampuan, namun mengikuti pelatihan agrowisata diubah menjadi UU No. 22/2009 sela pada 25 Juni 2009. karena mereka menganggap KPU melanggar UU. dia, untuk mengangkat kredit, kurang didukung anggaran.” di Bogor, Bali dan Riau. Mereka mengharuskan pengguna sepe- “KPU telah mengadu domba MK dan MA. Kalau KPU tidak pengambilanbukuhitam (BPKB) Selain beasiswa, pihaknya sela- diberi pelatihan pembuatan damotor menggunakan helm melaksanakan putusan MA kami akan menggugat melalui tata kendaraan, perpanjangan surat ma 2009 telah melakukan ber- pupuk kompos, perkebunan standar. Selain itu pihaknya terus Bursa Calon Ketum Golkar usaha negara,” ujar juru bicara caleg yang gagal Sudiatmiko kendaraan (STNK) harus beru- bagai kegiatan sosial seperti dan sebagianya. “Ini merupakan mensosialisasikan agar peng- Aribowo dalam dialog ‘Dualisme Lembaga Yudisial’ di Gedung rusan dengan petugas di lantai I sampai lantai III. “Dengan wajah donor darah, pemberian zakat dan kurban. sumbangsih kami kepada nega- ra, karena perusahaan pem- guna sepedamotor menghi- dupkan lampu saat siang hari. Siswono: Wanti-wanti DPR, Senayan, Jakarta, Rabu (19/8). Salah satu caleg yang gagal masuk senayan karena KPU baru ini, semua pelayanan itu berada di lantai I.” Dalam skala nasional jelas Suhartono didampingi Kepala biayaan ini termasuk aset bang- sa,” sebut Suhartono menam- “Bagi yang melakukan pelang- garan diberi sanksi berupa Cukongisme Di Golkar mengabaikan putusan MA, Hakim Sorimuda Pohan menegaskan JAKARTA (Waspada): Anggota Dewan Penasihat Golkar, bahwa gugatan ke PTUN sudah atas persetujuan partai. Program ini sebutnya, masih Departemen Tirta Setiadharma, bahkan, secara nasional perusa- denda Rp100.000,” jelas- terbatas pada tiga kota besar Kepala Kantor Wilayah Sumut haan ini mempunyai 5,6 juta nya.(m11) Siswono Yudhohusodo mengingatkan para pemilik suara di “Kami 115 caleg yang seharusnya masuk Senayan. Tentu saja Musyawarah Nasional Golkar nanti tidak terjebak dalam politik kepentingan anggota dewan untuk parpol dan atas restu parpol,” uang. Jangan gadaikan aspirasi demi kebutuhan dana operasional ungkap Hakim. 115 caleg akan mengumpulkan dukungan dalam partai, kata dia. diskusi yang akan digelar di Hotel Sahid Jaya Kamis hari ini.(dtc) Menengok Museum Nyamuk Indonesia “Memang dalam politik sekarang membutuhkan biaya sangat tinggi, tapi organisasi apapun, paling baik kalau didukung oleh Hari Konstitusi SIAPA sangka hewan kecil yang sering kita temui ini memiliki anggotanya sendiri,” kata Siswono. daya tarik yang luar biasa bagi jutaan umat manusia di dunia. “Jangan sampai ada cukongisme di dalam berpolitik di partai. Jadikan Refleksi Perbaikan UUD 45 Nyamuk, hewan yang masuk kategori serangga itu ternyata berdampak luas bagi kehidupan manusia baik secara negatif Nanti partai itu bisa jadi tergadaikan, yang paling baik itu partai yang dibiayai dari iuran anggotanya. Jadi setiap anggota mempunyai JAKARTA (Waspada): Sejumlah pimpinan lembaga negara maupun positif. hak yang sama dengan yang lain,” katanya di Hotel Kartika Chandra, telah menetapkan 18 Agustus sebagai hari konstitusi guna Tengok saja sekitar 110 juta penduduk beresiko tertular Jakarta, Rabu (19/8). menumbuhkan kesadaran berkonstitusi. Deklarasi dilakukan malaria. Artinya, angka pesakitan manusia Indonesia sekitar Siswono memahami kecenderungan saat ini memang ada 18 Agustus 2008. tiga juta pertahun. Di sisi lain, ribuan pekerja buruh pabrik pragmatisme yang berlebihan. Menjalankan organisasi partai Presiden Susilo Bambang Yudhoyono, Selasa (18/8) hadir yang bekerja pada industri insektisida atau obat antinyamuk yang sebesar ini tidak murah. Untuk membiayai tenaga staf dan memperingati hari konstitusi itu di Gedung DPR/MPR RI Ja- bergantung pada besarnya kebutuhan manusia akan obat operasional seperrti listrik dan telepon di DPP saja, kata dia, karta. Presiden mengatakan, peringatan Hari Konstitusi 18 Agustus antinyamuk di sebuah negara. begitu banyak hingga, ratusan juta rupiah setiap bulan. harus dijadikan sebagai refleksi. Langkah amandemen dilakukan Mosquito Theatre atau Teater Nyamuk merupakan ikon Oleh karena itu, Siswono secara pribadi senantiasa berusaha bukan hanya merumuskan konstitusi yang baik untuk negara, wisata ilmiah sebagai kegiatan yang mengintegrasikan menumbuhkan idealisme yang tinggi di dalam jajaran Partai melainkan sebagai refleksi terhadap perbaikan atas konstitusi pembelajaran ilmu pengetahuan, teknologi dan seni bidang Golkar. “Kenyataan sekarang, pragmatisme memang masih sangat yaitu UUD 1945. “Salah satu karakter dan fungsi konstitusi itu kesehatan dengan kegiatan pariwisata. tinggi. Tapi tidak betul kalau semata-mata hanya dana. Dana merumuskan checks and balances, utamanya antara lembaga “Keberadaan teater nyamuk ini upaya pendekatan kepada itu memang penting tapi tidak segala-galanya. Para pemilih yang eksekutif, legislatif dan yudikatif,” sebutnya. masyarakat untuk mempermudah terhadap akses hasil 514 ini juga saya yakin bisa menilai unsur-unsur yang lain, selain Selain itu kata presiden, konstitusi juga harus menunjukkan Litbangkes agar penelitian ini berhasil guna dan berdaya guna,” dan dokumen. kekuatan dana,” katanya. hubungan yang jelas antara rakyat dan negara. “Negara tidak ujar Kepala Badan Penelitian dan Pengembangan Kesehatan Museum nyamuk pertama di Indonesia ini dihiasi replika Penentu suara di Munas itu ada 514 suara, yaitu 470 dari DPD boleh terlalu kuat ataupun terlalu lemah. Harus ditemukan formula Departemen Kesehatan RI Agus Purwandianto saat peresmian nyamuk ukuran besar pada dinding utamanya. Ada enam II, 33 dari DPD I, 10 dari organisasi sayap dan 1 dari DPP Saat . hubungan yang tepat antara rakyat dan negara,” kata dia Gedung Teater Nyamuk di Jl. Raya Pangandaran, Desa Babakan, genus (tingkatan) koleksi nyamuk yang dimiliki museum yaitu, ini terdapat beberapa nama yang menyatakan niat menakhodai menyebutkan, konstitusi juga harus tetap adaptif dengan perkem- Kec. Pangandaran, Kab. Ciamis, Jawa Barat, Rabu (19/8). Aedes, Culex, Anopheles, Mansonia, Armigeres dan Toxor. Golkar. Selain Tommy, Aburizal, Surya dan Yuddy Chrisnandi, bangan jaman. Sebagai pendukung wisata ilmiah, gedung berkonsep Masing-masing genus terdiri dari spesimen, stadium telur, ada pula Ferry Mursyidan Baldan. Kesadaran minimalis dengan nuansa perpaduan hijau, merah dan oranye larva, pupa dan nyamuk. Sementara Jusuf Kalla, Ketua Umum sekarang, memilih tak Sementara Ketua MPR, Hidayat Nur Wahid dalam sambutan dilengkapi fasilitas sesuai kegiatan yang dilakukan di gedung Kepala Lokalitbang Pengendalian Penyakit Bersumber melanjutkan lagi tongkat kepemimpinan. Pergantian kepemim- tertulisnya mengatakan, dengan ditetapkannya 18 Agustus sebagai tersebut. Binatang (P2B2) Ciamis, Sugianto mengatakan, alasan pemba- pinan Golkar digelar dalam Musyawarah Nasional yang hari konstitusi, maka menjadi kewajiban seluruh komponen bangsa Fasilitas itu terdiri dari gedung sinema berukuran 9x8 ngunan teater nyamuk di kawasan wisata Pantai Pangandaran diagendakan 4-7 Oktober 2009 di Riau. terus menggelorakan cinta dan kesadaran berkonstitusi. meter berkapasitas 120 orang, ruang multimedia yang berfungsi sebagai wisata ilmiah aternatif dari wisata-wisata yang sudah Sementara Tommy Soeharto yang dimunculkan, terganjal Penetapan 18 Agustus sebagai hari konstitusi tertuang dalam untuk proses editing dan dubbing, pusat pelayanan sebagai ada disekitarnya. Teater nyamuk memang direncanakan akan aturan Anggaran Dasar dan Anggaran Rumah Tangga Golkar keputusan presiden No. 18/2008. Dalam momen setahun hari tempat pelayanan informasi, penjualan tiket serta penjualan dikomersialisasikan, namun tidak ditunjukan untuk mengambil yang mensyaratkan calon ketua umum haruslah pernah menjadi konstitusi ini, MPR menggelar beberapa acara seperti seminar souvenir dan museum sebagai tempat penyimpanan koleksi keuntungan. (dtc) pengurus DPP atau DPD I Golkar. Tommy hanya memenuhi nasional, silaturahim dan cerdas cermat UUD 1945.(j07) syarat telah menjadi kader Golkar selama lebih 10 tahun.(vivanews)
  6. 6 Sport WASPADA Kamis 20 Agustus 2009 AP Unggulan Tanpa Masalah Pelatih Werder Bremen Thomas Schaaf (kiri) dan Direktur Olahraga Klaus Allofs memperkenalkan Claudio Pizarro LONDON (Waspada): Hasil Selasa (Rabu WIB): di Bremen, Jerman, kemarin. Klub-klub unggulan relatif Glasgow Celtic vs Arsenal 0-2 CopenhagenvsAPOEL 1-0 tanpa masalah dalam Bremen Kenalkan Pizarro menarungi leg pertama Timisoara vsVfB Stuttgart SheriffTvsOlympiakos 0-2 0-2 Sporting vs Fiorentina 2-2 KLUB Bundesliga, Werder Bremen, sukses dalam babak playoff Liga Champi- negosiasinya dengan Chelsea untuk mengikat secara permanen Jadwal Rabu (Kamis WIB): striker Claudio Pizarro, yang musim lalu bermain bagus dalam ons 2009/2010, Selasa (Rabu FKVentspilsvsFCZurich - status pinjaman di Weser Stadium. WIB). Levski Sofia vs Debrecen Pizarro pun langsung diperkenalkan pelatih Bremen OlympiqueLyonvsAnderlecht - Thomas Schaaf dan Direktur Olahraga Klaus Allofs, kemarin. PanathinaikosvsAtleticoMadrid - “Kami bicara serius dengan Chelsea. Kami memang berharap Arsenal (Inggris), VfB Stutt- SalzburgvsMaccabiHaifa - semuanya bisa segera beres,” jelas Allofs. gart (Jerman) dan Olympiakos Pizarro sempat dipanggil lagi oleh The Blues, tapi kansnya Piraeus (Yunani) yang masuk sulit untuk mendapat tempat utama dalam skuad Carlo kami.” dalam paket favorit, sama-sama Lehmann pensiun Ancelotti. Gabung sejak 2007, penyerang Peru berusia 30 tahun mencetak angka kemenangan 2- itu bahkan baru main 21 kali untuk Si Biru akibat kalah bersaing Di Politechnica Timisoara, 0 pada aksi tandang masing-ma- Rumania, VfB Stuttgart berjaya dengan Didier Drogba, Nicolas Anelka dan Salomon Kalou. sing. Hasil itu otomatis memper- berkat dua gol dalam tempo tiga besar peluang mereka menem- menit ke gawang FC Timisoara. Chamakh Menuju Hammers bus penyisihan grup, sebelum melakoni leg kedua pekan depan. Timo Gebhart mencetak angka pertama lewat titik penalti, satu TheGunnersbahkanmenjadi lainnya melalui mantan gelan- BOMBER andalan Girondis Bor- klub Inggris pertama yang me- dang Arsenal dan Barcelona deaux Marouane Chamakh menuju menangi laga Eropa di markas Aleksandr Hleb. London untuk berlabuh di West Ham Celtic sejak Nottingham Forest Kiper veteran Jerman Jens United, setelah negosiasi kedua klub pada 1983. London Reds berjaya Lehmann yang membela Arsenal berjalan positif. Kepastiannya jadi di Glasgow berkat gebrakan bek AP sebelum gabung Stuttgart, sebe- amunisi baru The Hammers tinggal William Gallas dan gol bunuh diri Gelandang Fiorentina Juan Vargas (kiri) bertarung seimbang dengan bintang Sporting Joao Moutinho dalam laga leg pertama lum duel tersebut mengumum- menunggu penjualan bek James Collin Gary Caldwell. playoff Liga Champions di Stadion Alvalade, Lisbon, Rabu (19/8) dinihari WIB. kan akan pensiun pada akhir ke Stoke City dengan bandrol 5 juta Pasukan Gudang Senjata itu musim ini. pounds. memimpin di Celtic ketika tenda- tim tuan rumah. karena memasukkan bola ke mengganggu permainan kami. Sedangkan bos Celtic Tony Di Tiraspol, Olympiakos Menurut media di London, ngan bebas Cesc Fabregas menit Gol itu membuka angka gawang sendiri menit 71. Kami membutuhkan semangat Mowbray mengaku; “Saya kira Piraeus juga membukukan jalan kemarin, transfer Chamakh akan 43 melesat melewati kiper Artur keberuntungan bagi Arsenal. “Saya kira kami harus lebih lebih tinggi pada pertandingan Caldwell berusaha agar tidak indah menuju penyisihan grup tercapai dengan perkiraan harga sekitar Boruc. Gallas yang berdiri bebas Caldwellyangdihukumtidakmain mengawasi bola sebelum men- mendatang,” tutur arsitek Arsenal terjadi gol, tetapi akhirnya malah lewat kemenangan tandangnya 7 juta pound dalam dua hari ke depan. meneruskan si kulit bundar di Skotlandia minggu lalu, lants coba menciptakan angka, karena ArseneWenger dalam Sky Sports, merugikan kami. Arsenal mem- atas Sheriff Tiraspol. Harapan tim Untuk menuntaskannya, Ketua Eksekutif The Hammers, Scott melaju ke dalam mulut gawang melakukan kiprah lebih jelek mereka tidak terlalu banyak Rabu (19/8). beri pelajaran berharga bagi tuan rumah untuk menjadi klub Duxburry, sudah terbang ke Prancis. Chamakh yang awalnya pertama Moldova yang maju ke ingin ke Arsenal, tega pindah kendati kini menjadi tumpuan babak utama memudar akibat gol Bordeaux. Vidic Analisa Barca Blues Bangkit Bantai Black Cats gol Dudu dan pemain pengganti Kostas Mitroglou. Dalam duel lainnya, FC Co- penhagenmengalahkantamunya LONDON (Waspada): Chel- Ancelotti. APOEL Nicosia 1-0 melalui gol BEK Manchester United Ne- sea asuhan pelatih Carlo Ancelotti Klasemen Liga Premier: D JJB Stadium, klub promosi menit 51 yang diciptakan Zdenek manja Vidic, menurut agennya bangkit dari ketertinggalan satu Chelsea 2 2 0 0 5-2 6 WolverhamptonWanderers me- Pospech. Paolo Fabbri, terus menganalisa gol untuk membantai tuan Arsenal 1 1 0 0 6-1 3 ngalahkan tuan rumah Wigan Di Lisbon, Sporting terpaksa kemungkinan untuk menerima rumah Sunderland 3-1 yang Man City 1 1 0 0 2-0 3 Athletic 1-0 berkat tandukan akan kehilangan strikernya asal lamaran Barcelona. “Vidic akan membuat The Blues naik ke Stoke City 1 1 0 0 2-0 3 menit keenam dari Andy Keogh. Montenegro Simon Vukcevic, senang bermain di Barca, karena puncak klasemen Liga Premier, West Ham 1 1 0 0 2-0 3 Wigan yang mencatat yang dikeluarkan dari lapangan impiannya adalah pergi ke Liga Selasa (Rabu WIB). Tottenham 1 1 0 0 2-1 3 kemenangan 2-0 atas AstonVilla, saat bermain imbang 2-2 mela- Spanyol,” ungkap Fabbri, seperti Gol-gol di babak kedua dari Wigan 2 1 0 1 2-1 3 Sabtu lalu, melakukan serangan wan Fiorentina.Vukcevic menda- dikutip dari Goal, kemarin. Michael Ballack, Frank Lampard Fulham 1 1 0 0 1-0 3 gencar sepanjang babak kedua. pat kartu kuning kedua karena “Kami harus terus menganalisa serta Deco Souza, membatalkan Man United 1 1 0 0 1-0 3 Pemain pinjaman dari Chelsea membuka kaosnya setelah men- situasinya. Tapi yang realistis, itu keunggulan The Black Cats dari Sunderland 2 1 0 1 2-3 3 Scott Sinclair, menyia-nyiakan cetak angka yang menyamakan sulit terjadi saat ini. MU baru saja satu gol yang disarangkan Darren Wolves 2 1 0 1 1-2 3 peluang terbaik The Latics lewat kedudukan menit 58. kehilangan Cristiano Ronaldo dan Bent menit 18. Hull City 1 0 0 1 1-2 0 tandukannya yang tidak akurat. Juan Manuel Vargas mem- Carlos Tevez, sehingga mereka tidak akan ingin kembali “Kami bermain dengan Liverpool 1 0 0 1 1-2 0 (h01/sky/ant/rtr/ap) buat Fiorentina memimpin lebih kehilangan elemen penting lainnya,” katanya menambahkan. sangat bagus dari menit pertama Birmingham 1 0 0 1 0-1 0 dahulu menit keenam. Setelah hingga menit akhir. Tak mudah Bolton 1 0 0 1 0-1 0 Vukcevic menyamakan bermaindibabakpertamakarena Portsmouth 1 0 0 1 0-1 0 AP Baptista Tetap Roma Sunderland mencetak gol, tapi kami dapat terus mengontrol Aston Villa Blackburn 1 0 0 1 0-2 0 1 0 0 1 0-2 0 Gelandang Chelsea Michael Ballack kedudukan, Miguel Veloso gantian membuat Sporting ung- merayakan golnya ke gul lewat tendangan kilatnya dari AGEN bomber Brazil Julio duel dan memiliki sikap mental Burnley 1 0 0 1 0-2 0 jarak sekitar 25 meter. Striker Italia Baptista, Herminio Menendez, yang baik,” puji Ancelotti dalam Everton 1 0 0 1 1-6 0 gawang Sunderland di Stadium of Light, Selasa Alberto Gilardino membalasnya memastikan kliennya tetap akan Sky Sports, Rabu (19/8). 11 menit sebelum laga usai. (h01/ bertahan membela AS Roma “Ini merupakan pertanding- hadap Didier Drogba dan Lam- (Rabu WIB). sky/ant/rtr/uefa) sekaligus menepis rumor kepin- an yang fantastis bagi kami. Saya pard mendapat kesempatan un- dahan mantan pemain Arsenal, senang, karena saya melihat tim tukmencetakgollewattendangan Real Madrid dan Sevilla tersebut. ini meningkat permainannya penaltinya. Lampard pun me- “Saya tidak tahu apa-apa ten- dengan sangat cepat,” tambah nyamakan rekor Jimmy Greaves tang kepindahan Baptista. Saya pelatih asal Italia itu. sebagai pencetak gol terbanyak tidak berbicara kepada siapapun. London Blues yang harus kelima sepanjang sejarah Chelsea Saya tidak mengerti mengapa berjuang keras untuk menang dengan 132 gol. ada banyak pembicaraan menge- AP 2-1 atas Hull City, Sabtu lalu, me- Satu tembakan sempurna nai kepindahan Julio,” jelas Me- mulai serangan gencarnya ketika dari gelandang Portugal Deco nendez dalam, kemarin. Ballackmenyamakankedudukan menit70mengokohkankemena- “Saya tidak pernah bicara itu, tidak dengan Inter ataupun tujuh menit setelah babak kedua ngan Si Biru. “Dia (Deco) bekerja klub lain. Saat ini saya bisa mengkonfirmasi bahwa Julio dimulai. sangat bagus dan termotivasi bertahan di Roma, itu 100 persen,” tegasnya lagi. Si Biru kembali mencetak gol untuk tinggal dan bermain. Ini menit 61 ketika George McCart- musimpentingbaginyaterutama ney melakukan pelanggaran ter- sebelum Piala Dunia,” ucap Palermo Intip Burdisso PALERMO mengintip kesempatan untuk mendapatkan bek Argentina Nicolas Burdisso, yang tidak masuk lagi dalam rencana pelatih Inter Milan Jose Mourinho. yang dikutip kemarin melaporkan, pemain berusia 28 tahun itu terpaksa akan meninggalkan Giuseppe Meazza menyusul kedatangan bek Brazil Lucio. Palermo pun menyiapkan anggaran sebesar 5 juta euro atau setara Rp70 AP miliar untuk memboyong mantan bek Boca Juniors tersebut. Burdisso yang membela I Nerazzurri sejak 2004 lalu, juga diminati AS Roma. Sneijder Berubah Pikiran AP GELANDANG Belanda Wesley Sneijder yang semula ngotot untuk terus bertahan di Real Madrid, ber- ubah pikiran menyambut lirikan Inter MaldiniRagukanDuta Seri A Milan yang sempat ditolaknya. ROMA (Waspada): Mantan pelatih Italia Cesare Maldini, “Saya dengar (Jose) Mourinho tak terlalu yakin dengan peluang para duta Seri A di ajang Liga akan menjadikan saya pilihan utama. Champions, terutama setelah melihat penampilan Fiorentina. Dia pelatih hebat yang melatih tim Tampil melalui babak kualifikasi, La Viola berhasil selamat hebat. Jika saya memutuskan untuk dari terkaman tuan rumah Sporting Lisbon dengan bermain meninggalkan Madrid, Inter akan 2-2, Selasa (Rabu WIB), setelah diusirnya pemain Sporting asal menjadi pilihan menarik,” tutur Montenegro Simon Vukcevic. Sneijder, seperti dilansir Il Corriere “Wasit yang memimpin partai itu kelihatannya kurang Dello Sport, kemarin. pengalaman. Dia menggunakan dua pendekatan berbeda saat I Nerazzurri mengintensifkan memberi hukuman,” kata Maldini kepada TribalFootball, perburuan Sneijder, karena gelandang Argentina Esteban Rabu (19/8), mengomentari kartu merah Vukcenic. Cambiasso dipastikan absen lama pasca menjalani operasi Maka Cesare menilai, peluang wakil Italia untuk menjuarai pada lututnya. Inter dan Real tengah melakukan negosiasi Liga Champions tergantung pada kegiatan di bursa transfer, untuk memuluskan kepindahan itu dengan opsi pinjaman terutama oleh Juventus dan AC Milan. “Jika Juventus dan senilai 7 juta euro atau sekitar Rp99 miliar. Milan merekrut pemain lain, mungkin saja peluang bisa (jonny/dari berbagai sumber) berubah,” tutur Maldini. (bb/tf) Pandev Mau Tuntut Lazio ROMA (Waspada): Striker Pandev, Mattia Grassani, tak pernah dimainkan dalam Macedonia Goran Pandev Selasa (Rabu WIB). pertunjukan,” tambah mau menuntut SS Lazio ke Pandev sejak awal Grassani. jalur hukum, karena meminta agar dimasukkan ke Pandev sebenarnya tidak dianggap membekukan dalam bursa jual. Namun sendiri. Dua rekannya, Cris- dirinya dari skuad setelah Lazio tak kunjung menerima tian Ledesma dan Lorenzo Di terjadi perselisihan kontrak. tawaran yang pantas dan Silvestri, juga dibekuk dari “Jika situasi ini terus membekukan Pandev dari skuad dengan alasan yang berlanjut dan Pandev tetap skuad yang sudah menjuarai sama. “Kami harus segera dikucilkan oleh manajemen Piala Super Italia dan tampil bertemu dengan manajemen dan bukan oleh pelatih, maka di Liga Eropa. “Pandev Lazio. Jika tidak, maka kami kami menilai telah terjadi diperlakukan seperti musisi harus menempuh jalur lain,” pelecehan,” kecam pengacara yang terus ikut latihan, tetapi tegas Grassani. (bb/fi) AP
  7. WASPADA Kamis, 20 Agustus 2009 Sport 7 PIMNAD Jr Kalah Lagi SALATIGA (Waspada): PIMNAD Junior kalah beban. lagi, kali ini di tangan tuan rumah Pusdiklat Basket Hasilnya, Surliyadin, Iqbal Firdaus, Fadhiel FTI UKSW Salatiga 61-75 pada game kedua Irshad, Encep dan Akbar Aulia hanya kalah tipis Turnamen Basket Piala Kemerdekaan di GOR 16-18namunmembalikkankeadaandenganmere- Kridanggo, Salatiga, Selasa (18/8) malam. but kuarter kedua dengan kemenangan 32-29. “Anak-anak sudah tampil maksimal. Hanya Sayangnya, di kuarter III anak-anak PIMNAD sayang, mereka masih kelelahan usai menghadapi kehilangan fokus dan memudahkan lawan Pasific Caesar di game pertama. Selain itu, mereka memecahkan defense Surliyadin cs. Di kuarter jugamasihmudadanminimpengalaman,sehing- terakhir, PIMNAD kembali menemukan form ga wajar belum menemukan form terbaiknya,” dengan menerapkan full court press. Kendati lapor asisten pelatih Jekky LB Sagala kepada merebut kuarter akhir, marjin poin tetap saja Waspada. membuat mereka kalah. Menurut Jekky, pertandingan demi pertan- Dalam laga ini, Surliyadin yang juga bigman dinganyangdimainkanditurnameninimerupakan PIMNAD tampil sebagai top skor dengan koleksi pelajaran berharga bagi pemain-pemain muda 15 poin disusul Iqbal Firdaus 11. Di laga berikutnya, PIMNAD. Pada dua kuarter awal, anak-anak PIMNAD Jr akan berhadapan dengan tim PIMNADJrtampilmengesankandanseolahtanpa Kobatama, Halim Kediri. (b07) Saka Bhayangkara Juara Senam Lalu Lintas Polres Lhokseumawe Antara LHOKSEUMAWE (Waspada): Saka Bhayang- (Kantibmas),” jelas Puteh. LOMBA PERAHU LAYAR: Beberapa peserta perahu layar saling mendahului pada lomba dalam memperingati HUT ke 64 RI di Pulau Buluh, Batam, Rabu (19/ karan berhasil meraih juara senam lalu lintas pada Juara kedua senam Saka Bhayangkara Polsek 8). kegiatan Pertikara Cabang Polres Lhokseumawe Dewantara dan Saka Bhayangkara Polsek 2009 di Bumi Perkemahan Lapangan Besi Tua, Dewantara menempati juara ketiga. Lomba Desa Hagu Tengah, Kec Banda Sakti, Pemko kegiatan baris berbaris dijuarai Saka Bhayangkara Venus Cabut Lebih Awal Lhokseumawe. Polres Lhokseumawe disusul Saka Bhayangkara Ketua Panitia Kompol M Darussalam Puteh Polsek Dewantara dan Saka Bhayangkatan Polsek kepada Waspada, Rabu (19/8) mengatakan, Banda Sakti. perlombaan tersebut merupakan rangkaian yang Lomba kegiatan cerdas-cermat dimenangi diikuti para anggota Pramuka di wilayah hukum Saka Bhayangkara Polsek Syamtalira Bayu. Polres Lhokseumawe. Runner-up diduduki Saka Bhayangkara Polres tak bisa memenangkan satu set mengalahkan Magdalena Ryba- Disebutkan,kegiatanyangberlangsungselama dan juara ketiga menjadi milik Saka Bhayangkara TORONTO (Waspada): empat hari sejak 14 Agustus lalu dibuka Bupati Polsek Samudera. pun. Namun, dalam pertanding- rikova, 2-6, 6-3, 6-2 untuk Unggulan ketiga Turnamen an di Toronto, Bondarenko tam- membawanya bertemu Lucie Aceh Utara Ilyas A Hamid. UntuklombakegiatanpenyuluhanKantibmas, Rogers Cup di Toronto, pil gemilang dengan memenang- Safarovadibabakkedua.Safarova “Selain senam, kegiatan mempertandingkan juara diraih Saka Bhayangkara Polsek Dewantara kan tiga game berturut-turut sebelumnya menang atas Kaia lomba baris berbaris, cerdas cermat serta diikuti Saka Bhayangkara Polsek Muara Batu dan Venus Williams, menjadi penyuluhankeamanandanketertibanmasyarakat Saka Bhayangkara Polsek Banda Sakti. (b17) untuk memenangkan set kedua Kanepi (Estonia), 6-4, 7-6 (3). petenis unggulan 10 besar dan memanfaatkan satu-satunya Petenis China Zheng Jie terus pertama yang tersingkir di kesempatan mematahkan servis melaju usai mengalahkan Elena babak awal. Langkah Venus Venus di set ketiga. Vesnina (Rusia) 6-3, 6-2 untuk “Tentusajasayaberharapbisa kemudian bertemu unggulan langsung terhenti pada bermainbaikdanbisatampillebih kedelapan Caroline Wozniacki penampilan perdananya saat jauh di sini. Tetapi ternyata tidak di babak kedua. Kim Clijsters bisa. Kateryna bermain sangat melanjutkan kegemilangannya melawan Kateryna bagus,” kataVenus yang bermain setelah di babak pertama Bondarenko. di Toronto sejak 1997. mengalahkan petenis Inggris Adapun Bondarenko me- Elena Baltacha 6-3, 6-4. Setelah mendapat bye di ngatakan, setelah tak bisa me- Pertandingan lain, Svelana babak pertama, Bondarenko ngantisipasi kekuatan pukulan Kusnetzova (Rusia) tumbang 4- menjadi lawan pertama Venus Venus di set pertama, dia ber- 6, 3-6 dari petenis Australia Sa- di babak kedua Rabu (19/8). strataegi untuk memainkan bola mantha Stosur.Victoria Azarenka Venus pun kalah 6-1, 5-7, 4-6. lebih lama pada dua set berikut- (Belarusia) mengandaskan Peng Kemenangan ini menjadi yang nya. “Sebuah kemenangan besar Shuai (China) 6-3, 6-3. Flavia pertama bagi Bondarenko dari karena melawanVenus. Saya me- Pennetta (Italia) menang 6-3, 6- tiga pertemuan dengan Venus. rasa,jikabisamengalahkanVenus, 3 atas Maria Kirilenko (Rusia) dan AP Dalam dua pertemuan berarti saya bisa mengalahkan Dominika Cibulkova (Slowakia) Kateryna Bondarenko membuat kejutan dengan menyingkirkan sebelumnya, termasuk di Wim- pemain lain,” ujar Bondarenko. mengalahkan Sara Errani (Italia) Venus Williams. bledon tahun ini, Bondarenko Pada laga lain, Ana Ivanovic 6-4, 6-2. (m33/ap) Soderling Akui Hewitt Tangguh CINCINNATI, AS (Waspada): bagus di Roland Garros danWim- 7-6 (4), 7-6 (4). Petenis Australia, Lleyton Hewitt bledon. Ia adalah tipikal pem- Sementara itu, unggulan ke- , harus bermain tiga set 3-6, 10- bunuh raksasa, memiliki rasa sembilanGillesSimonmerupakan 8, 6-4 melawan petenis Swedia percaya diri dan pukulan ekstra petenis pertama yang maju ke Robin Soderling sebelum yang dapat dilakukan berulang- putaran ketiga setelah menang melangkah ke babak selanjutnya ulang,” tambah Hewitt yang akan 7-6, 6-7, 6-1 atas Igor Andreev pada Turnamen Cincinnati menghadapi petenis Jerman asal Rusia. Selanjutnya, ia Waspada/Zainal Abidin Masters, Rabu (19/8). Benjamin Becker di babak kedua. bertemu unggulan kedelapan Kabag Bina Mita Polres Lhokseumawe Kompol M Darussalam Puteh yang juga Ketua Panitia Perlawanan yang dilakukan Andrea Seppi akan menjadi Nikolay Davydenko atau petenis Kegiatan Pertikara Cabang Polres Lhokseumawe 2009, menyerahkan hadiah kepada juara Soderling diakui Hewitt memang lawan Rafael Nadal di babak Rusia lain Igor Kunitsyn yang baru-baru ini. sangat tangguh. Petenis Swedia kedua setelah mengalahkan Jan mengalahkan petenis AS James itu pernah mengalahkan Rafael Hernych 3-6, 6-4, 6-1. Mikhail Blake 7-6 6-7 6-4. (m33/ant/rtr) Nadal di Roland Garros tahun Youzhny mengalahkan Victor AP ini dan kemudian menjadi lawan Hanescu 7-5, 6-2 untuk bertan- Roger Federer di final. ding melawan Guillermo Garcia- “Tidakgampangterusmelaju Lopez yang menyingkirkan ung- karena ia (Soderling) bermain gulan ke-11 Fernando Verdasco Pavlik Tunda Pertarungan NEW JERSEY, AS dikutip AFP Rabu (19/8) , Dia kalah dalam (Antara/AFP): Pertarungan mengatakan, Pavlik pertandingan kelas Sudoku mempertahankan gelar kelas menengah Dewan Tinju Dunia (WBC) Kelly Pavlik di mengalami infeksi pada bagian tangan kirinya sehingga harus mendapat menengah super melawan Bernard Hopkins pada November 2008, namun Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada New Jersey melawan perawatan doker. Februari lalu berhasil pengulangan angka mendatar, menurun, maupun di dalam kotak rekannya dari Amerika Paul Petinju dengan rekor 35- menghentikan perlawanan 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya perlu Williams, ditunda dari 3 1 di antaranya menang KO 31 Marco Antonio Rubio pada pertimbangan dan logika. Jawaban di kolom 8. Oktober menjadi akhir kali itu, menghentikan laga perebutan gelar. November atau awal perlawanan Jermain Taylor Williams dengan rekor Desember mendatang. pada 2007 hingga berhak atas 37-1 di antaranya 27 menang 7 8 Promotor laga seperti mahkotanya. KO, adalah petinju kidal yang menang angka melawan Winky Winky, April lalu. 6 8 9 7 5 Williams mengalami kekalahan satu-satunya 9 5 4 ketika naik ring melawan petinju dari Puerto Rico, Carlos Quintana, Februari 7 1 9 6 2008 tetapi membalas dendam empat bulan kemudian. 8 1 9 7 9 3 2 4 1 5 6 3 4 2 5 8 2 4 7 9 9 1 8 7 3 6 8 7 9 3 1 6 5 4 2 4 1 7 4 7 8 9 1 3 2 4 7 6 3 5 6 2 5 1 9 8 7 1 4 2 3 6 2 2 4 5 6 9 7 8 5 1 8 4 3 3 9 7 1 9 4 3 5 7 1 9 2 8 6 4 9 1 8 6 3 4 7 2 5 dailyboxing
  8. 8 Sport WASPADA, Kamis 20 Agustus 2009 Beda Misi Alonso-Badoer VALENCIA, Spanyol (Waspada): Pembalap Renault Fernando Alonso mengincar podium di GP Eropa akhir pekan ini. Tak sekedar menginginkan poin, namun Alonso juga mengusung misi balas dendam. Valencia merupakan lo- Sementara itu, driver kasi yang musim lalu tidak pengganti Ferrari Luca Ba- membawa hoki bagi Alonso. doer mengaku dirinya ingin Bertarung di hadapan publik meraih hasil positif di GP sendiri, pembalap berke- Eropa yang hasilnya nanti bangsaan Spanyol itu justru ingin dipersembahkannya AP gagal menyelesaikan balapan untuk Felipe Massa. akibat kecelakaan dengan Badoer mengaku tidak mobil Kazuki Nakajima. Kini, sabar untuk berlaga di Sirkuit patkan apa yang diimpikan- yang dipersembahkannya Alonso bersiap untuk mena- Valencia menggunakan mobil nya. untuk Massa. Selain itu, Ba- klukkan Valencia. Ferrari F60. Setelah sekian Pembalap Perancis ter- doer berharap Massa cepat “Tahun lalu, saya harus lama menunggu kesempatan sebut berkilah dirinya ingin pulih dan kembali membalap. keluar dari lomba ketika ba- ini, Badoer akhirnya menda- mendapatkan hasil positif “Saya harus katakan, pi- lapan belum genap satu pu- kiran pertama saya ketika ber- taran. Jadi saya benar-benar ada di trek adalah Felipe ingin membalas itu semua di (Massa), karena saya benar- akhir pekan ini. Saya berharap benar takut melihat kece- kami bisa meraih podium,” lakaan yang menimpanya. tukas Alonso, Rabu (19/8). Kini saya berharap bisa kem- Penampilan di kualifikasi bali secepat mungkin,” ujar GP Hongaria akhir Juli silam Badoer. (m33/ap) membuat pembalap berusia 28 tahun itu optimistis bisa mencapai hasil terbaik di Va- DEPARTEMEN KEUANGAN REPUBLIK lencia. “Performa kami di Ho- PENGUMUMAN ULANG LELANG EKSEKUSI HAK TANGGUNGAN INDONESIADIREKTORAT JENDERAL BEA DAN CUKAI ngaria menunjukkan kema- Menunjuk pengumuman Lelang Kedua Eksekusi Hak Tanggungan pada tanggal 23 Juli 2009 dan Berdasarkan Pasal 6 UUHT No. 4 Tahun 1996, PT Bank Danamon Indonesia, Tbk. akan melakukan KANTOR WILAYAH SUMATERA UTARA juan. Mobilnya sangat cepat Lelang Eksekusi Hak Tanggungan dengan perantaraan Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Kisaran terhadap: KANTOR PENGAWASAN DAN PELAYANAN dan kami bisa meraih pole. Sesuatu yang membuat saya 1. THOMAS SUMARTIONO, Jalan Diponegoro No. 151, Kel. Kisaran Baru, Kec. Kota Kisaran TIPE A3 TELUK NIBUNG Barat, Kab. Asahan terkejut,” lanjut Alonso. Sebidang tanah seluas 607 m2 berikut bangunan diatasnya, Sertifikat Hak Milik No.169/Prapat JALAN BESAR PELABUHAN TELUK NIBUNG TELP. 0623-92036 Janji atas nama Thomas Sumartiono, terletak di Buntu Pane Gang Seruni, Kel. Prapat Janji, Kec. Buntu Pane, Kab. Asahan TANJUNG BALAI 21331 FAKS. 0623-596556 Harga Limit: Rp.80.000.000,- Setoran Uang Jaminan: Rp.16.000.000,- Pasang Iklan 2. ZA. SUZANTA, Jalan Urip Sumodihardjo, Gang. Olah Raga, Kel. Gendana, Kec. Rantau Prapat, ✆ 4528431 Kab. Labuhan Batu. Sebidang tanah seluas 958 m2 berikut bangunan diatasnya, Sertifikat Hak Milik No.2598/Siringo- PENGUMUMAN LELANG Ringo atas nama Zainal Arifin Suzanta, terletak di Jalan. Senam Kel. Siringo-ringo, Kec. Rantau HP. 081370328259 Utara, Kab. Labuhan Batu Harga Limit: Rp.120.000.000,- Setoran Uang Jaminan: Rp.24.000.000,- Nomor : PENG-01/WBC.02/KPP.05/PANLE/2009 Email: 3. MASLINA BORU BARUS, Jalan Lintas Sumatera, Kel. Aek Kanopan, Kec. Kualuh Hulu,Kab. Dengan perantaraan Kantor Pelayanan Kekayaan Negara dan Lelang Kisaran, Kantor Pengawasan Labuhan Batu dan Pelayanan Bea dan Cukai Tipe A3 Teluk Nibung akan melaksanakan Pelelangan atas 1.758 Sebidang tanah seluas 791 m2 berikut bangunan diatasnya, Sertifikat Hak Milik No.184/Gunung (seribu tujuh ratus lima puluh delapan) roll tekstil yang berada di Gudang Tempat Penimbunan Melayu atas nama Maslina Barus, terletak di Jln. Lintas Sumatera Desa Gunung Melayu. Kec. Kualuh Selatan, Kab. Labuhan Batu Pabean Kantor Pengawasan dan Pelayanan Bea dan Cukai Tipe A3 Teluk Nibung dengan harga Harga Limit: Rp.300.000.000,- Setoran Uang Jaminan: Rp.60.000.000,- limit sebesar Rp 59.068.800,00 (lima puluh sembilan juta enam puluh delapan ribu delapan ratus 4. UNTUNG, Dusun Sosopan Kumbar Pekan Tolan, Desa Pekan Tolan, Kec. Kampung Rakyat, Kab. rupiah) dan pelaksanaan lelang dilakukan pada : Labuhan Batu PIMPINAN DAN ANGGOTA DPRK ACEH SINGKIL SERTA SEKRETARIAT DEWAN a. Sebidang tanah seluas 192 m2 berikut bangunan diatasnya, Sertifikat Hak Milik No.268/Pekan Hari / Tanggal : Rabu / 26 Agustus 2009 Tolan atas nama Untung, terletak di Dusun Sosopan Kumbar, Kel. Pekan Tolan, Kec. Kampong Mengucapkan terima kasih atas suksesnya pelaksanaan : Rakyat, Kab. Labuhan Batu Waktu : Pukul 10.00 WIB sampai dengan selesai Harga Limit: Rp.100.000.000,- Setoran Uang Jaminan: Rp.20.000.000,- Rapat Paripurna Istimewa Dalam rangka b. Sebidang tanah seluas 1.998 m2 berikut bangunan diatasnya, Sertifikat Hak Milik No.308/ Tempat : Kantor Pengawasan dan Pelayanan Bea dan Cukai Tipe A3 Teluk Nibung Pekan Tolan atas nama Untung, Agustina, Vivi Erwinda, terletak di Dusun Sosopan Kumbar, Jalan Besar Pelabuhan Teluk Nibung, Tanjung Balai PENGUCAPAN SUMPAH/JANJI ANGGOTA DPRK ACEH SINGKIL PERIODE 2009-2014 Kel. Pekan Tolan, Kec. Kampong Rakyat, Kab. Labuhan Batu Pada hari Selasa 18 Agustus 2009 di Gedung DPRK Kampung Baru, Singkil Utara Harga Limit: Rp.85.000.000,- Setoran Uang Jaminan: Rp.17.000.000,- Syarat - syarat lelang : c. Sebidang tanah seluas 1.993 m2 berikut bangunan diatasnya, Sertifikat Hak Milik No.129/ KEPADA : Pekan Tolan atas nama Untung, terletak di Dusun Sosopan Kumbar, Kel. Pekan Tolan, Kec. 1. Peserta lelang wajib menyetorkan uang jaminan sebesar Rp 12.000.000,00 (dua belas juta - Bupati Aceh Singkil dan Unsur Muspida plus Kampong Rakyat, Kab. Labuhan Batu rupiah) ke rekening Bendaharawan Penerima KPKNL Kisaran di Bank Sumut No. 3235-0 dan Harga Limit: Rp.50.000.000,- Setoran Uang Jaminan: Rp.10.000.000,- - KIP dan Panwaslu Kabupaten Aceh Singkil sudah efektif selambat - lambatnya 1 (satu) hari sebelum pelaksanaan lelang; - Kepala Dinas. Badan dan Kantor dalam Kabupaten Aceh Singkil 5. ABDUL KODIR, Dusun IV,Desa Simpang Gambus, Kec. Lima Puluh, Kab. Asahan Sebidang tanah seluas 223 m2 berikut bangunan diatasnya, Sertifikat Hak Milik No.178/Simpang 2. Pemenang lelang diwajibkan membayarkan pelunasan harga lelang dalam waktu 3 (tiga) hari - Para Pimpinan Partai Politik dalam Kabupaten Aceh Singkil Gambus atas nama Abdul Kodir, terletak di Dusun III Desa Simpang Gambus, Kec. Lima Puluh, kerja setelah ditunjuk sebagai pemenang lelang; - Para Pimpinan Perusahaan HGU Kabupaten Aceh Singkil Kab. Asahan Segenap lapisan masyarakat Aceh Singkil dan pihak lain yang tidak bisa kami sebutkan Harga Limit: Rp.31.000.000,- Setoran Uang Jaminan: Rp.7.000.000,- 3. Apabila pemenang lelang tidak melunasi kewajibannya, maka ia dinyatakan wanprestasi dan satu-persatu. Yang akan dilaksanakan pada uang jaminan akan disetorkan ke Kas Negara dan ia akan dimasukkan ke dalam DAFTAR HITAM Hari, tanggal : Jumat, 28 Agustus 2009 Pukul : 10.00 WIB s/d Selesai LELANG; Atas Partisipasi Dan Dukungannya Pada Peresmian Tersebut Tempat Lelang : Ruang Lelang Kantor Pelayanan Kekayaan Negara dan Lelang (KPKNL) Kisaran, Jalan. Prof. H.M. Yamin,S.H. 47 Kisaran 4. Peserta lelang dapat melihat barang yang akan dilelang sampai dengan 1 (satu) hari sebelum Dari pelaksanaan lelang; PIMPINAN SEMENTARA DAN ANGGOTA DPRK ACEH SINGKIL Syarat-syarat lelang: 1. Peserta lelang wajib menyetorkan uang jaminan ke rekening Bendaharawan Penerima KPKNL 5. Informasi lebih lanjut dapat diperoleh di Kantor Pengawasan dan Pelayanan Bea dan Cukai Kisaran di Bank Sumut Cabang Kisaran Ac. 3235-0 dan sudah efektif selambat-lambatnya 1 (satu) PUTRA ARIYANTO, SE H. AMIRUL M. BAHAR, SH H. SAZALI, S.Sos hari sebelum pelaksanaan lelang; Tipe A3 Teluk Nibung, Jl. Besar Pelabuhan Teluk Nibung Tanjung Balai, Telp. 0623-92036, dan Ketua Wakil Ketua Sekretris Dewan 2. Pemenang lelang diwajibkan membayar pelunasan harga lelang dalam waktu 3 (tiga) hari kerja Kantor Pelayanan Kekayaan Negara dan Lelang Kisaran, Jl. H. M. Yamin No. 47 Kisaran, setelah ditunjuk sebagai pemenang lelang; Masruman Hj Kamaiyah Budi Hendrawan Asmudin 3. Apabila pemenang lelang tidak melunasi kewajibannya, maka ia dinyatakan wanprestasi dan Telp. 0623-41427. uang jaminan lelang akan disetorkan ke Kas Negara sebagai pendapatan Negara dan ia akan Siswati, SKM H Fakhrudin Pardosi. H Mairaya Nazli dimasukkan ke dalam DAFTAR HITAM LELANG; Teluk Nibung, 20 Agustus 2009 4. Peserta lelang dianggap telah mengetahui keberadaan dan kondisi objek lelang apa adanya (as is); H Safriadi, SH Sondang Manik Frida Siska, SPt Hasbi 5. Informasi lebih lanjut dapat menghubungi PT. Bank Danamon Indonesia, Tbk, Divisi Self Em Ketua Panitia Raja Aminullah Ali Hasmy Agustizar Wartono ployed Mass Market, telp. (061-8461791), (081375705805) atau Kantor Pelayanan Kekayaan Negara td. dan Lelang (KPKNL) Kisaran, Telepon : (0623) 41427 atau (0623) 7032574 Tobal Manik Abdi Suka Anhar Tamiruddin Taufiq Asbaruddin H Syafril Hrp, SH Saprudin, SH. Medan, 20 Agustus 2009 Johny Haposan TT NIP. 060094991 PT Bank Danamon Indonesia,Tbk
  9. WASPADA Kamis 20 Agustus 2009 Medan Metropolitan 9 Ternak Kaki Empat Dikosongkan Tiga Hari Lagi MEDAN (Waspada): Pj Walikota Medan kaki empat. “Kami menantikan janji Pak namunrealisasinyayangdibutuh- Rahudman Harahap mengultimatum peternak “Kita harapkan untuk tahap Walikota untuk menertibkan kan. “Kami sangat mengharap- awal masyarakat sudah mengo- ternakbabi.Sudah30tahunwarga kan keberanian Pak Rahudman babi khususnya di Kecamatan Medan Denai songkan ternaknya dalam waktu disini khususnya umat muslim untuk segera mengosongkan sudah harus mengosongkan ternaknya dalam tiga hari ini,” ujarnya. resah dengan ternak babi karena ternakbabi.Sebagaiorangnomor waktu tiga hari ini. Menanti janji setiapmelaksanakanibadahyang satu di Medan jangan hanya Sedangkan Nazir Masjid Al tercium adalah aroma limbah mengumbar janji kepada Kemarin, Rahudman Hara- empat. Selain itu, wilayah itu juga Ihsan Jalan Tangguk Bongkar IX, babi. masyarakat,” tegasnya. hap bersama Sekda Dzulmi Eldin terlihat kumuh dan bau tidak se- Kel. Tegal Sari Mandala II, Kec. “Sudah berulang kali warga Pantauan Waspada di dan Kapoltabes Medan Kombes dap sangat menyengat di hidung. Medan Denai Zulkifli bersama disinimintaPemkoMedanuntuk lapangan, saat rombongan Pj Pol Imam Margono bersama “Saya harapkan untuk tahap tokohmasyarakatlainnyamenga- menertibkannya.Namunsampai Walikota memasuki lokasi ternak unsur Muspida lainnya meninjau awal ternak babi mulai dikosong- takan, Pj Walikota jangan hanya saat itu belum terlaksana,” hampir mendapat hadangan dari sejumlah titik peternakan babi kan, terutama yang berada dekat berbicara untuk menertibkan ujarnya. peternak. “Kami tidak bersedia ilegal daerah itu, yang sudah lama rumah ibadah. Ini tidak bisa dita- ternakbabiyangselamainisangat Ditambahkan, masyarakat kalau ternak kami dikosongkan,” membuat masyarakat menderi- war-tawar lagi dan harus diko- meresahkan masyarakat. janganhanyadiberikanjanji-janji, ujarnya warga di sana. (h10) ta. Rahudman tampak terkejut songkan dalam waktu tiga hari melihat banyaknya peternak di ini. Untuk itu, camat beserta lurah sana. “Saya minta kepada ma- dan Kepala Lingkungan segera melakukan sosialisasi terhadap Peradilan Tak Sehat Waspada/ME Ginting syarakat yang memelihara ternak babi agar dalam waktu tiga hari ini sudah mengosongkan ternak- masyarakat agar jangan terjadi gejolak,” ujarnya. Sementara itu, Kapoltabes Cikal Bakal Mafia Peradilan MENINJAU: Pj Walikota Medan Rahudman Harahap (tengah) didampingi Kapoltabes Medan Kombes Pol Imam Margono bersama rombongan meninjau lokasi ternak babi di Kec. Medan Denai, Rabu (19/8). nya dari lokasi itu,” katanya. Medan Kombes Pol Imam Mar- Rahudman menegaskan, gono mengatakan, masyarakat Panusunan Harahap, Ketua PN Medan pengosongan ternak babi harus sangat diharapkan kesediannya MEDAN (Waspada): Peradi- prilaku pencari keadilan meng- “Sebagai hakim kita harus direalisasikan sesegera mungkin mengingat wilayah itu tidak diperbolehkan untuk ternak kaki untuk mengosongkan lokasi ternak babi karena wilayah itu merupakan larangan beternak lan sehat tidak akan pernah ter- wujudkalaupara pencarikeadilan halalkan segala cara terkadang dibarengi tingkah laku sebagian menghadapi semuanya sebagai kritikan untuk lebih memper- PT Kobasco Tidak Konsisten Penumpang Sriwijaya Air menghalalkan segala cara untuk memenangkan perkara. “Bagi sebagian orang berper- aparat pengadilan tertentu yang mudah tergiur atau lemah atas godaan yang menjadi cikal KKN. dalam ilmu hukum dan lebih mendekatkan diri kepada Allah SWT,” ujarnya. Penuhi Hak TKI kara bukan lagi mencari keadilan, “Situasiinilahyangmelahirkan Diamengingatkan,vonisyang MEDAN (Waspada): Pihak syaratan dan telah mengajukan keberangkatan menjadi TKI ke Terlantar tapi untuk memenangkan per- istilah ‘mafia peradilan’. Bila ini dibacakan di persidangan bukan Perusahaan Jasa Tenaga Kerja klaim kepada perusahaan asu- negeri jiran 27 Februari 2008 kara. Baginya, menang baru adil tidak diskapi bersamam maka keputusan pribadi hakim yang Indonesia (PJTKI) PT Kobasco, ransi Mitra Dana Athmaraksa merasa tersiksa dengan ketidak- MEDAN (Waspada): Ratusan penumpang Sriwijaya Air dan kalau kalah baginya hakim citra peradilan akan rusak di mata bersangkutan tetapi berubah terlantar di Bandara Polonia akibat pesawat yang akan mereka tidak konsisten terhadap janji berkantor di Jalan Setia Budi pastian penampungan kerja di tidak adil,” kata Ketua Pengadilan masyarakat,” ujarnya. menjadi putusan pengadilan. jaminan hak bagi Tenaga Kerja Medan melalui Badan Nasional sana.“Berminggu-mingguselama tumpangi itu terlambat berangkat 5 jam ke Penang dan Jakarta, Rabu (19/8). Tinggi Sumut Kimar Saragih Saragih mengharapkan, Ke- Untukitu,baikburuknyaputusan Indonesia (TKI). “Saya kecewa Perlindungan Tenaga Kerja penampungan, makan tak jelas Dari informasi penerbangan Sriwijaya Air, alasan penundaan Siadari pada acara serahterima tua PN Panusunan Harahap dan yang dijatuhkan nama pengadi- dengan pelayanan pihak PT NasionalpadaDinasTenagaKerja dan diperlakukan macam TKI berangkat karena terkendala teknis operasional pesawat jenis Boeing jabatan Ketua Pengadilan Negeri para hakim dapat membangun lanlahyangdipertaruhkan“Jangan Kobasco Medan,” ujar salah Sumatera Utara. illegal,” ketusnya. 737-300 itu. Seharusnya bertolak ke Penang pukul 07.20 menjadi (PN)Medandari Sunaryokepada dan menegakkan supermasi sekali-sekalilupahidupinisingkat, seorang TKI, Yanti Nurmaslan Nyatanya, beber Yanti Nur- Kilang Bionic yang dijanjikan pukul 12.10. Dari 147 penumpang pesawat dengan nomor Panusunan Harahap di gedung hukum di PN Medan. jadi berbuatlah yang baik selagi Siregar, di Medan, Kamis (13/8). maslan, ketika ditelusuri semua- PT Kobasco pada awal keberang- penerbangan Sj-102, sebanyak 12 orang membatalkan berangkat. utama PN Medan, Rabu (19/8). Buat putusan adil masih sempat,” katanya. Menurut Yanti Nurmaslan, nya bohong. “Saya sudah tanya- katankeMalaysia,tidakmenerima Belasan penumpang dalam kondisi sakit untuk berobat ke Penang Hadir para hakim PT Sumut Pada kesempatan itu, Saragih Sementara itu, Panusunan dia bersama sejumlah rekannya kan ke Disnaker dan perusahaan TKI. Setelah beberapa kali terpaksa tergolek di atas kursi roda. dan PN Medan, unsur Muspida mengimbau para hakim mem- Harahap sebelumnya menjabat dipulangkan Februari 2009 ke asuransi dimaksud, tidak ada tawaran para agen TKI mereka “Saya pasrah saja dan menunggu kapan pesawat bisa berangkat,” Kota Medan serta dan sejumlah buat putusan yang adil meski Wakil Ketua PN Jakarta Pusat. Medan setelah PT Yamakoh pengajuan klaim atas nama saya tolak untuk bekerja di rumah kata Ponten Ginting, 74, sambil menunggu istrinya, NagolemTarigan, pimpinan organisasi advokat dan sebagian orang belum mengang- Sedangkan Sunaryo mendapat Precision di Negeri 9 Nilai Serem- oleh PT Kobasco,” ujarnya kesal. makan, akhirnya mereka dipe- 68, di atas kursi roda.Warga Jalan Dipo Asahan ini mengaku berulang undangan lainnya. gap baik karena tidak memenuhi jabatan baru sebagai hakim tinggi ban, Malaysia, dinyatakan bang- Ditambahkannya,ketikahasil kerjakan di PT Yamakoh dan kali naik pesawat ke Penang. “Kali ini terlambat lebih kurang 5 jam.” Lebih lanjut, kata Saragih, keinginannya. di PT Denpasar. (h05) krut menyusul krisis global penelusurannya kembali dikon- akhirnya bangkrut,” paparYanti. Leny, petugas SriwijayaAir ketika dikonfirmasi tidak membantah melanda dunia waktu itu. firmasikan kepada Burhanuddin, BurhanuddinbosPTKobasco ada penundaan beberapa jam alasan teknis operasional. “Rute Sesuai peraturan pemerintah jawabannya malah tidak sedap. yang dikonfirmasi, Rabu (19/8) Medan-JakartaSriwijayaSJ-015 juga terlambat berangkat seharusnya berangkat pukul 10.20 menjadi pukul 15:00,” ujarnya. (m32) APBD 2010 Tidak dan janji pihak PT Kobasco ber- kantordiJlGapertaUjungMedan, “Yang saya urus ribuan orang, jadi kalau memang belum mengatakan, kalau perusahaan tempat bekerjaYanti di Malaysia akan mengajukan klaim asuransi terdaftar dalam pengajuan klaim tidak bangkrut. “Seharusnya Sesuai Visi Misi Gubsu setelah pemulangan itu. Namun, hingga saat ini status pengajuan asuransi, nanti saya ajukan lagi,” ujar Yanti menirukan jawaban kontrak kerjaYanti di perusahaan tersebut 2 tahun, namun karena klaim itu semakin tak jelas. Burhanuddin. yang bersangkutan bermasalah MEDAN (Waspada): Pem- sedang dihadapi Sumut saat ini cenderung tidak realistis dan Burhanuddin, bos PT Ko- Lebih jauh wanita kelahiran kemudian dipecat pihak provsu mengajukan Rancangan yaitu, persoalan kesehatan, terkesanhanyadibuat-buat.Serta basco, yang berulang kali dihu- Langgapayung, 8 Agustus 1987 perusahaan. Karena dipecatYanti APBD (R-APBD) Sumatera Utara pendidikan, lapangan pekerjaan. program-program dalam angga- bungiYanti Nurmaslan mengaku ini membeberkan, dia bersama tidak mendapat klaim,” jelas tahun anggaran 2010 yang dipro- Namun, kata Fadly, ternyata isi ran belanja yang ternyata tidak telah melengkapi sejumlah per- delapan rekannya sejak awal Burhanuddin. (m39) yeksikan mencapai Rp3,730 draf RAPBD Sumut 2010 banyak mengatasi persoalan masyarakat triliun.NamunisiRAPBDtersebut elemen yang belum terdorong Sumut secara substantif. ternyata dinilai tidak sesuai dengan visi-misi Gubsu, Syamsul secaraberimbanguntukmenyuk- seskan visi misi Gubsu. Seperti “Ternyata jumlah program yang langsung untuk masyarakat September, Tarif Tol Naik 15 Persen Arifin. bidangpertanianyangseharusnya sangat sedikit. Banyak anggaran “APBD Sumut 2010 ternyata menjadi leading sektor agar yang dihabiskan ternyata untuk MEDAN (Waspada): Terhi- kan dua tahun sekali. “Besaran Sementara itu, Kepala PT Jasa belum mencerminkan visi misi rakyat tidak lapar. bidang-bidang yang sifatnya tungsejakbulanSeptembertahun kenaikan tarif tol yang kita ajukan Marga (Persero) Tbk Cabang Gubsu, rakyat tidak lapar, rakyat Pengamat Kebijakan Publik adminsitratif,” ujarnya. ini, tarif jalan tol Belmera akan 15 persen, namun itu belum pasti Belmera, Ir Ricky Distawardhana Waspada/Abdullah Dadeh tidak sakit, rakyat tidak bodoh Sumut, Dadang Darmawan, juga Apalagi, Dadang menilai naik sebesar 15 persen. Hal itu karena harus disesuaikan dengan mengatakan, selama tahun 2008, TERTIDUR: Beberapa penumpang Sriwijaya terlihat tertidur dan rakyat punya masa depan,” menilai isi APBD Sumut 2010 pembahasanRAPBDSumut2010 dikatakan Sekretaris PT Jasa Mar- besaran inflasi berjalan dan harus BUMN itu telah menyumbang- lemas di atas kursi roda menunggu berangkat ke Penang, Rabu kata anggota DPRDSU, Fadly ternyata masih jauh dari harapan ini terkesan terburu-buru dan ga (Persero) Tbk, Okke Marlina mendapatpenetapandariMenteri kan pajak bumi dan bangunan (19/8). Nurzal, kepada wartawan me- tentang realisasi visi-misi Gubsu. penuh kepentingan elit-elit didampingi Kepala Cabang PU,” jelas Okke. (PBB) kepadaAPBNsebesarRp4,2 nanggapi nota keuangan Ran- “Ternyata tidak ada korelasi Pemprovsu dan elit DPRDSU Belmera, Ir Ricky Distawardhana, Selain itu, tarif tol awal dan milyar. “Itu terealisasi karena Rabu (19/8). penyesuaiannya diperlukan NJOP tanah dikuasai perusahan India Peringati Hari cangan APBD Sumut 2010 yang disampaikan pada rapat pari- antara visi-misi Syamsul-Gatot denganisiRAPBD2010yangtidak periode ini. Sebelumnya, Gubsu me- Menurut Okke, kenaikan tarif untuk kepastian pengembalian ini sangat tinggi” katanya. jalan tol dihitung berdasarkan atas investasi yang dilakukan Akibat kenaikan tarif jalan tol Kemerdekaan Ke-62 purna di gedung dewan, Rabu (19/8). memihak kepada rakyat. Visi- misi dengan isi RAPBD benar- nyampaikan nota Belanja daerah pada R-APBDSumut 2010 dipro- kemampuanbayarpemakaijalan, termasuk investasi selama masa itu seluruh pelayanan harus MEDAN (Waspada): Masyarakat India memperingati HUT Fadly yang juga Ketua DPW benar tidak sesuai,” katanya. yeksikanmencapaiRp3,730triliun besar keuntungan biaya oprasio- operasional antara lain pelebaran disesuaikan dengan standar. Di kemerdekaannya ke-62 di halaman Konsulat Jenderal India di Medan Partai Persatuan Pembangunan Dadang menilai, banyak ke- atau meningkat sebesar nal kendaraan dan kelayakan in- dan penggantian atau perbaikan jalantoltidakbolehadapersimpa- di Jalan Uskup Agung Sugio S.Pranoto Medan, Sabtu (15/8). Bertindak (PPP) Sumut itu menjelaskan, visi rancuan dalam isi RAPBD Sumut Rp114,606 miliar atau sekitar 3,17 vestasi. Besaran tarif jalan tol ter- jalan. ngan yang bersifat menghalangi sebagai inspektur upacara adalah Konjen Sukumaran. misi Gubsu sebenarnya sangat 2010 yang diajukan Pemprovsu persen dibanding belanja daerah cantum dalam perjanjian pengu- “Waktu kenaikan tarif tol laju kendaraan pengguna jalan. Upacara yang dimulai pukul 08.30 itu didahului dengan menukik dengan persoalan yang seperti, target pendapatan yang pada APBD 2009. (h11) saha jalan tol serta pemberla- bukan dibuat berdasarkan ke- Selain itu di jalan tol juga tidak penggerekanbenderadiiringilagukebangsaan.Dilanjutkanpembacaan kuannya bersamaan dengan mauan perusahaan tapi telah bolehadalubangataubadanjalan naskah pidato Presiden India Pratibha Devisingh Patil yang dibacakan pengoperasian jalan tol. terencana dan merupakan per- yang rusak. “Bahkan jika berhenti Konjen Sukumaran dan Deputi Konsul Dinesh Setia. Presiden India mengatakan, kemerdekaan yang diraih bukan diperoleh begitu saja, tetapi dimenangkan dengan perjuangan panjang Sosialisasi 3R Dan PITA Pemberlakuan tarif tol awal dan penyesuaiannya ditetapkan oleh Menteri PU dan akan dilaku- wujudan rencana perusahaan yang telah diatur dalam UU No 38 tahun 2004,” tambah Okke. terlau lama di jalan tol, tidak boleh dan akan didatangi petugas patroli,” pungkas Ricky. (cre) dan berat. Tidak terhitung berapa banyak pria dan wanita, yang berjuang bagi pembebasan dari belenggu penjajahan, mereka Di Empat Kecamatan merapatkan barisan dalam kesatuan pejuang kemerdekaan. Dengan diilhami oleh kepemimpinan Mahatma Gandhi dan MEDAN (Waspada): Duo yang kini menjadi permasalahan “Program 3R dan PITA harus Gubsu Minta Tirtanadi seruannya yang didasarkan pada prinsip-prinsip Ahimsa dan Satyagraha, mereka menunjukkan semangat yang keras. Mereka bertekad melalui kesulitan karena semata-mata ingin agar negaranya Dewi dikenal aktif di dunia lingkungan hidup, Ir Purnama Dewi, MM dan Dewi Budiati TJ besar di dunia. Sampah, kata dia, menjadi masalah bagi masyarakat, dan disosialisasikan kepada masyara- kat Medan. Ini sangat membantu kita mengatasi permasalahan Cepat Atasi Gangguan Air merdeka dan rakyatnya bebas untuk menentukan nasibnya. Upacara itu dihadiri ratusan warga India yang berada di Medan Said kembali mensosialisasikan sebagian belum memahami sampah. Jika keinginan mewu- MEDAN (Waspada): Gubsu ISO yang diterimanya kepada Administrasi dan Keuangan, dan Sumut. Pihak Konjen beramah-tamah sambil menikmati 3R yakni reuse, reduce dan recyle bagaimanamengatasinya.Karena judkan lingkungan bersih dapat meminta Dirut PDAM Tirtanadi Dirut PDAM Tirtanadi Sjahril Mangindar Ritonga dan Sekre- makanan. di empat kecamatan di kota Me- ituPemkoMedanterusmelanjut- tercapai maka yang dibutuhkan beserta jajarannya meningkatkan Effendy Pasaribu. taris Dewan Pengawas Nelson SukumaranmerupakanKonjenbarumenggantikanMadanChhabra dan antara lain, Medan Amplas, kan dan mensosialisasikan 3R ke masyarakat adalah semangat mutu pelayanan kepada ma- Gubsu memberikan perha- Parapat, Gubsu memberikan yang telah habis masa dinasnya. Konjen baru itu tiba di Medan dua Medan Helvetia, Medan Marelan seluruh masyarakat di Medan. tinggi dan mau berjuang mem- syarakat sehingga kekurangan tian besar terhadap keluhan pela- isyarat betapa dirinya sangat hari sebelum Hari Kemerdekaan India, 15 Agustus. (m07) dan Medan Johor. “Jika terus disosialisasikan, maka berikan yang terbaik bagi lingku- yang masih ada bisa diatasi. yanan air bersih. Keluhan itu menginginkan kekurangan yang Sosialisasi dilakukan empat keuntungan melaksanakannya ngannya,” ujarnya. “Apa yang dicapai PDAM terjadi bisa juga akibat faktor di masih ada bisa diatasi, demi Peziarah Mulai Ramai hari dimulai 18 Agustus hingga 21Agustus.Selainkeduanya,pem- akan dirasakan oleh masyarakat ke depan,” kata dia. Dewi mengimbau seluruh camat dan lurah di Medan me- Tirtanadi saat ini, sangat ditentu- luar kewenangan PDAM Tir- mewujudkan mutu pelayanan kanpengalamandanjamterbang tanadi seperti bencana alam dan yang terbaik. MEDAN (Waspada): Bulan Ramadhan sebagai pertanda akan bicara program itu, Ir Armaniar Sementara, Dewi Budiati TJ nyahuti permasalahan sampah pengelola. Namun kekurangan faktor eksternal lainnya. Namun Dirut PDAM Tirtanadi Sjahril dimulainya puasa tahun ini tinggal beberapa hari lagi. Sejumlah dan Ny Ainun, lurah dan serta Said turut mengkampanyekan ini. “Keseriusan camat dan lurah pekuburan di Medan Utara sejak beberapa hari yang lalu terlihat yang masih ada di sana-sini harus Gubsu berharap gangguan Effendy Pasaribu mengatakan, pesertalingkunganhiduplainnya. PITA atau pilah tanam kepada menjalankan kedua program ini ditangani serius dengan solusi distribusi air minum bisa diatasi ISO9001adalahsuatupersyaratan mulai ramai dikunjungi penziarah. Purnama Dewi yang men- masyarakat. Dalam melanjutkan dibutuhkan. Diharapkan camat Berbagai alasan diungkapkan peziarah sebagai alasan kujungan yang terprogram,” kata Syamsul dengan cepat. Gubsu meminta bagi sistem menajemen mutu jabat Kepala Badan Lingkungan program 3R, Dewi Budiati mem- dan lurah mampu ikut menya- Arifin seusai menerima sertifikat perhatian Sekda RE Nainggolan yang mengacu pada standar mereka ke kuburan. Ada yang mengaku sebagai tradisi dan ada HidupkotaMedankepadawarta- berikan masukan kepada masya- darkan masyarakat untuk terus juga yang mengatakan kalau berziara itu baik dilakukan guna ISO9001:2008danISO14001:2004 dalamkapasitasnyasebagaiketua internasional. Tujuannya untuk wan, Rabu (19/8), mengatakan, rakat bagaimana caranya memi- melaksanakan program 3R dan dari PT TUV NORD Indonesia Dewan Pengawas PDAM Tirta- menjamin agar PDAM Tirtanadi mengingatkan bahwa yang hidup pasti akan mati. program 3R penting disosialisasi- lah tanam, baik menanam sam- pilah tanam. Jika semua ini Di pekuburan ikatan keluarga besar (IKB) Sabar-Rasyid yang melalui Ridho Umbu Z Gea di nadi bersama seluruh jajaran bisa memenuhi persyaratan yang kan kepada masyarakat, sehingga pah basah maupun memanfaat- terwujud maka hasilnya akan rumahdinasgubernur,Jumat(14/ pengawas lainnya . diharapkan pelanggan dan berada di komplek Masjid Al Abrar, Jalan Yos Sudarso Km 12,5, dapat menumbuhkan kesadaran kan sampah kering serta dinikmati masyarakat juga,” tegas Kelurahan Titi Papan, Kecamatan Medan Deli, sekitar 100 KK dari 8). Gubsu mengucapkan selamat Sementara itu, pada perte- peraturan yang berlaku secara keluarga itu hadir dalam ziarah dan doa bersama yang dipimpin masyarakat terhadap sampah mengajarkan metode daur ulang. Dewi.(m08) atas perolehan sertifikat itu muan dihadiri Direktur Opera- terus menerus hingga dapat ketuanya, Fazli Ansyari, SS, Minggu (16/7). ketika menyerahkan sertifikat sional, Fahmi Johan, Direktur memberikan kepuasan. (m19) Pada sejumlah kuburan yang mereka ziarahi telah dimakamkan leluhur keluarga Sabar- Rasyid yang merupakan salah satu kelompok keluarga pembuka daerah Titi Papan pada zaman dulu. “Kuburan ini sudah lama dan kami merupakan generasi kedua dari mereka,” Islam Tidak Mengenal Kekerasan kata Syahrizal SE, wakil ketua IKB Sabar- Rasyid didampingi Arifin Hani, Bendaraha dan H Amin Awar, SPd selaku pembina. (cre) MEDAN (Waspada): Dewan BKPRMI Medan respek dengan terdepan menangkal semua isu Pimpinan Daerah Badan Komu- kehidupan beragama. “Ini sangat negatif itu, karena sama-sama Gudang Miras Setia Budi nikasi Pemuda Remaja Masjid Indonesia (DPD BKPRMI) Kota diperlukan guna membentuk pribadi beriman dan bertakwa,” kita ketahui apa yang dilakukan dan dinyatakan mereka sebagai Medan menyelenggarakan ujarnya, berharap BKPRMI perjuangan Islam adalah tidak Digerebek tabligh akbar dan menyambut Medan dengan semangat tabliqh benar. MEDAN (Waspada): 1.543 Botol minuman keras (miras) berbagai bulan suci Ramadhan 1430 H di akbar dapat mempelopori “Islam tidak mengenal keke- halaman Masjid Darul Huda Jl. kebersihan kota Medan. rasan, bom-mengebom. Indo- jenis disita polisi dari sebuah gudang di Jalan Setia Budi Medan, Kusuari Medan, Sabtu (15/8) Sebelumnya, Ketua DPD nesia bangsa yang aman dan ne- Selasa (18/8) malam. “Miras itu kita sita karena tidak memiliki izin. malam. KNPI Medan, Zulham Effendi Si- gara yang tenteram,” kata dia Ini juga bagian dari operasi penyakit masyarakat,” kata Kepala Satuan Hadir Sekda Medan, Dzulmi regar mengatakan, saat ini pemu- mengajak anak bangsa menjaga I Tipidum AKBP Yustan Alfiani kepada wartawan, Rabu (19/8). Eldin,AsistenKessos,FaridWajedi, da dan bangsa menghadapi ba- NKRI dari upaya pemecah Yustan menjelaskan, meski pemilik miras Krisman Hutauruk, Ketua Partai Demokrat Medan, nyak tantangan dengan derasnya belahan ukhuwah Islam. 36, turut diamankan, namun tidak bisa ditahan karena jenis Deni Ilham Panggabean, Ketua globalisasi, sehingga banyak re- Sementara, Rektor UMSU pelanggarannya hanya tindak pidana ringan dan administrasi. “Hanya DPD KNPI Medan, Zulham maja menjadi korban penyalah- Bahdin Nur Tanjung dalam tau- kita kenakan wajib lapor, karena hanya pelanggaran administrasi,” Effendi Siregar, Direktur gunaan narkoba dan seks bebas. siahnya mengutarakan Nabi Mu- jelasnya. Keuangan PT Inalum, Asrul Belum lagi saat ini Indonesia hammad SAW selalu menguta- Botol-botol miras itu di antaranya merek red label, mansen, Waspada/ist Hasan, Ketua BKM Darul Huda, khususnya umat Islam terserang makan kepentingan umat di atas vodka, VSOP sea horse, anggur merah, kamput, cawan mas, Mc , SOSIALISASI: Kepala Badan Lingkungan Hidup Medan, Ir Purnama Dewi, MM didampingi Zulkifli, dan jamaah masjid. opini menyesatkan, menyatakan kepentinganpribadi.Kehadiranya Donald, james martin, bacardi, controw dan lainnya. Selain sebagai Dewi Budiati TJ Said, aktivis lingkungan hidup, pada acara sosialisasi 3R yakni reuse, reduce dan Walikota Medan, Rahudman sebagian umat Islam mengan- sebagai utusan Allah di muka tempat penyimpanan miras, gudang itu juga merangkap tempat recyle serta PITA (pilah tanam), Rabu (19/8). Sosialisasi itu dilaksanakan untuk menumbuhkan Harahap, melalui Sekda menga- dalkan kekerasan. Dia berharap bumi untuk menyempurnakan tinggaltersangka.Hinggasore,tersangkamasihdiperiksaintensif.(m11) kesadaran masyarakat terhadap sampah. takan, kegiatan ini membuktikan BKPRMI bisa menjadi baris akhlakul karimah. (m11)
  10. 10 Medan Metropolitan WASPADA Kamis 20 Agustus 2009 Silaturahim Kapolda-Ulama Poldasu Tumpas Penyakit Masyarakat MEDAN (Waspada): Kapoldasu Irjen Pol Drs dengan634tersangka.Sedangkan nyai karisma di mata masyarakat. bulan suci Ramadhan lebih H Badrodin Haiti berharap kalangan ulama dan sasaran operasi ini, katanya lagi, Dukungan penuh untuk sama kondusif dan tenang sehingga menyangkut penyakit masya- memberantas Pekat ini sangat masyarakat tidak merasa resah tokoh agama untuk berperan memerangi rakat seperti, perjudian, nar- diharapkan dan menjadi ujung dalam beribadah. Menurutnya, Penyakit Masyarakat (Pekat) untuk lebih koba, perampokan, prostitusi tombak keberhasilan utama ada 5 tujuan dari ajaran Islam. menekan maraknya angka kejahatan akibat dan minuman keras. Sedangkan untuk menghapuskan Pekat di Yakni,menjaga/mengawalagama kasus narkoba semakin hari bu- tengah masyarakat. Sebab, mem- Allah SWT, jiwa, akal, keturunan pengaruh Pekat ini. kan semakin surut tetapi kian berantas Pekat tidak bisa dikerja- dan harta benda. Karena itu, meningkat. kan sendiri oleh aparat penegak dalam menjaga jiwa tidak boleh Meskipun kondisi Sumatera Syah, mantan Sekretaris Umum “Narkoba bisa berkurang hukum saja, tetapi keterlibatan sewenang-wenang, apalagi Utara khususnya Kota Medan MUI Sumut A. Muin Isma, jika semua pihak ikut berperan semua pihak termasuk tokoh sampaimenghilangkanjiwaorang sudah kondusif dari terutama KakanwilDepagsuSyarifulMahya dalam memberantasnya. Tidak agama dan ulama. lain.Diajugamenyebutkan,Islam menjelang dan sesudah Pilpres, Bandar, KakandepagKotaMedan saja tugas aparat kepolisian, tetapi Menyambut datangnya adalah agama yang damai, bukan tetapi tetap perlu waspada dan H. Abd. Rahim, pengurus MUI jugaulama,tokohagamadanpim- Ramadhan, Kapoldasu berharap agama kekerasan. Hal ini tidak siaga. Demikian dikatakannya Kabupaten/Kota se-Sumut dan pinan Ormas harus turut berpe- selama bulan suci Ramadhan seperti ditudingkan orang Islam saat berlangsungnya silatura- pimpinan Ormas Islam. ran serta kelompok sosial terkecil, diharapkan kondusifitas Kamtib- sebagai agama teroris. him MUI Sumut dengan jajaran Lebihlanjutdikatakan,selama yakni kepala keluarga,” ujarnya. mas dapat diwujudkan sehingga “Dalam Islam memakai prin- Poldasu di Aula MUI Sumut, berlangsungnya operasi Pekat Ulama harus berperan umat Islam dapat melaksanakan sip ‘husnuz zhan’ (berprasangka Rabu (19/8). sejak 8-18 Agustus, jajaran Pol- Menyikapi dan mengantisi- ibadahnya dengan baik. baik). Jadi, Islam tidak membe- Hadir dalam kegiatan ini dasu berhasil menangani 900 pasi hal ini, Kapoldasu berharap Islam agama mulia narkan terorisme,” tegasnya. Ketua Dewan Penasihat MUI kasus dengan 2.209 tersangka. paraulamadantokohagamabisa Sebelumnya, Ketua Umum Dia berharap melalui perte- Sumut Maslin Batubara, Ketua Sedangkan kasus terbanyak berperan dengan cara menyam- MUI Sumut H Abdullah Syah da- muan untuk memberikan kese- Umum MUI Sumut Abdullah perjudian sebanyak 200 kasus paikan penyuluhan keagamaan lam sambutannya mengatakan, jukan, ketenteraman dan keda- kepada masyarakat. Apalagi, silaturahim MUI dengan Kapol- maiandalammenjalankanibadah Polisi Tangkap Pelaku tokohagamadanulamamempu- dasuuntukmenciptakansuasana puasa Ramadhan. (m36) Waspada/Surya Efendi DIANGKUT PAKSA: Puluhan polisi berusaha menangkap para pengunjukrasa yang diantaranya Curanmor, Perampokan menolak penggusuran pedagang kaki lima di depan Balaikota, Rabu (19/8). Sejumlah pengunjukrasa MEDAN (Waspada): Tim Khusus Reskrim Polsekta Medan Baru Mantan Kadisduk Dihukum 1 Tahun yang berusaha memblokir ruas Jalan Kapt. Maulana Lubis akhirnya diangkut ke dalam truk. menangkap tiga tersangka kasus pencurian sepeda motor (curanmor) dan perampokan dari lokasi berbeda, Selasa (18/8) malam. Satu diantaranya pernah ditembak pada 2004 tersangkut kriminal. TersangkacuranmoradalahMN,29,pendudukDesaAekTampang MEDAN (Waspada): Mantan Kepala Dinas Kependudukan (Kadisduk) Kota Medan Yusri danyadisita,bilatidakmencukupi diganti dengan pidana penjara selama 6 bulan,” kata I Ketut. pemutahiran data pemilih dan penduduk berkelanjutan khusus untuk Pilgubsu tahun 2008 Pengunjukrasa Padangsidimpuan. MN selama di Medan indekos di Jalan Gatot Subroto Simpang Barat. Darinya, polisi menyita barang bukti satu unitHondaSupraFitBK6069UJwarnahitam.Sedangkanduatersangka Ramadhan Siregar dihukum 1 tahunpejaradiPengadilanNegeri Atas putusan itu, kuasa hu- kum terpidanaYusri Ramadhan sehingga total dana yang diterima mencapai Rp4.067.287.600 miliar Di Balai Kota Ditangkap Medan, Rabu (19/8), dalam kasus Siregar, HMK Aldian Pinem dan Dalampelaksanaankegiatan- lagi, BS alias Budi, 37, dan E alias Eko W alias Eko, 21, penduduk MEDAN(Waspada):Poltabes Pemko mengratiskan biaya seko- Pemko menanggung seluruh Jalan Setiabudi. Petugas menyita barang bukti satu unit Suzuki Shogun korupsi anggaran pemutakhiran SupritaGintingmenyatakanpikir- nya, ternyata dana APBD 2007 data Pilgubsu 2008. pikir untuk menentukan sikap senilai Rp2 miliar yang digunakan Medan mengamankan 26 orang lah di Medan. Selain itu, mereka pembiayaan masyarakat kurang BK 3631 UQ, tas warna hitam merek Sophie Martin dan dompet yang berunjukrasa di Balai Kota meminta Pemko menghapus mampu,tidakmampudanwarga berisi uang Rp50.000. Vonis majelis hakim diketuai selanjutnya. Hal serupa juga hanya sebesar Rp670.751.000 dan Kapolsekta Medan Baru AKP M Adenan AS kepada Waspada I Ketut Sudira lebih ringan 6 bulan disampaikan terpidana lainnya sisa Rp 1.329.249.000. Sedangkan Medan karena dianggap meng- kekerasan di dunia pendidikan miskin di luar masyarakat yang mengatakan, terkuaknya kasus curanmor di basement Pasar Petisah dari tuntutan Jaksa Penuntut dan JPU. dana P-APBD 2007 yang digu- ganggu ketertiban umum. Dalam yang selama ini masih terjadi. memperoleh dana Jaminan itu berdasarkan laporan masyarakat. Umum(JPU),HenriTarigan,yang Dalam amar putusannya, nakansebesarRp392.558.000dan aksinya, mereka menutup ruas Petugasberusahamembubarkan Pemeliharaan Kesehatan Dari pengakuan tersangka MS, kata Adenan, dia mencuri sepeda meminta terpidana divonis 1 majelishakimmengatakan,ketiga sisanya Rp 1.674.729.600. jalan sehingga memacatkan lalu mahasiswa yang menutup jalan (Jamkesmas). motor karena tergiur kunci kontak yang tergantung di sepeda motor tahun 6 bulan penjara. terpidana terbukti secara sah dan Dari sisa dana dari APBD lintas. mendapat perlawanan, akhirnya Pendemo juga menolak itu. Rencananya barang curian itu akan dijual untuk modal usaha. Vonis serupa juga dijatuhkan menyakinkan bersalah sebagai- dan P-APBD 2007 senilai Rp Mahasiswa yang ditahan 26 mahasiswa ditangkap. Program Medan Sehat karena Dalam kasus ini, korban Masri Djoyo, 57, penduduk Jalan Sempu, polisi itu menuntut pembebasan Pada hari yang sama dua mendiskriminasikan rakyat Kelurahan Sekip, sudah membuat pengaduan. (m31) majelis hakim kepada pejabat mana diatur pasal 3 UU No 31 3.003.978.600 ternyata, hasil audit Disduk Kota Medan yang lain, tahun 1999 tentang tindak pidana saksi ahli dari BPKP Sumut me- uangsekolah,langsungmenjalani gelombang pengunjuk rasa juga dengan membeda-bedakan jenis pemeriksaandiruangjuruperiksa mendatangi Balai Kota. Keduany penyakit yang ditanggung. Siti Salamah (bendahara) dan koruspi yo pasal 55 ayat 1 ke 1 nyebutkan kerugian negara atau (juper) unit Jahtanras Poltabes. mengatasnamakan dari Dewan Sementara itu, massa DPW Lisna Amin (Kasubdis Pelayanan KHUPidana. perbuatanketigaterpidanasenilai Kapoltabes Medan Kombes Kesehatan Rakyat (DKR)Medan APKLI Sumut meminta walikota dan Pendataan). Selain menghu- Perbuatan ketiga terpidana Rp753.934.379 juta. Jumlah itu Pol. Imam Margono yang dikon- bersamaDPWAPKLI Sumut yang agar tidak melakukan penggu- kum 1 tahun penjara, majelis ha- menimbulkan kerugian negara tergabung dalam berbagai kegia- fimasi wartawan mengatakan, memerotes penggusuran peda- suran PKL tanpa memberikan kimjugamenjatuhkandendaRp50 mencapai Rp753 juta.Terungkap tan yang mendukung program para mahasiswa yang diperiksa gang kaki lima (PKL). solusinya. Selain itu, pendemo juta subsider 2 bulan kurungan di persidangan, kasus dugaan pemutakhiran data itu. akan menjalani pembinaan. “Se- M Taufik R. Pakpahan dan meminta walikota memperbo- kepadamasing-masingterpidana. korupsi bermula, 15 Mei 2007, Dalam pelaksanaan kegiatan telah itu mereka kita pulangkan.” Juliana Serevina Sihombing me- lehkan masyarakat untuk berjua- Disamping itu, majelis hakim DisdukMedantelahmemperoleh yang dilakukan oleh ketiga terpi- Sebelumnya,paramahasiswa ngatakan, massa DKR menuntut lan di area Pasar Petisah. Usai me- juga membebani para terpidana alokasi dana APBD 2007 sebesar dana banyak anggaran yang fiktif yang tergabung dari beberapa Pemko mengalokasikan dana di nyampaikan aspirasinya, kedua membayar uang pengganti Rp2 miliar, yang diperuntukan seperti, sosialiasi program SIAK universitas di Kota Medan meng- APBD sebesar 15 persen untuk kelompok massa yang datang kerugian. UntukYusri Ramadhan untuk kegiatan pembangunan yang dilakukan di Gedung Dhar- gelar unjukrasa di depan Balai anggarankesehatansesuaistandar secaraterpisahinimembubarkan Siregar senilai Rp101 juta. Kemu- dan pengoperasian Sistem ma Wanita seyogianya 10 hari Kota. Mereka menuntut agar WHO. Pendemo juga meminta diri dengan tertib. (m39/h10) dian,SitiSalamahdanLisnaAmin Administrasi Kependudukan menjadi tiga hari, anggaran nasi masing-masing Rp251 juta. (SIAK) terpadu. kotak dan snack , sewa komputer, Waspada/Ismanto Ismail DIINTEROGASI: Kapolsekta Medan Baru AKP M Adenan AS menginterogasi tiga tersangka curamor dan perampokan, Selasa “Jika dalam kurun waktu 1 bulan setelah putusan berkekua- Kemudian, pada 14 Desem- ber 2007 kembali mendapat alat tulis kantor yang mendukung program tersebut, hingga Amanah Property Gelar tan tetap para terpidana tidak da- alokasi dari P- APBD 2007 sebesar pencetakan kartu pemilih pada (18/8) malam. pat membayar, maka harta ben- Rp2.067.287.600 untuk kegiatan Pilgubsu 2008. (h05) Paket Kemerdekaan RI Karyawan Madani Hotel Adakan Kerja Bhakti Keluarga Korban Pembunuhan MEDAN (Waspada) : Kebu- tuhan akan desain bangunan dan sinar matahari masuk secara maksimal kedalam rumah. Hal pasokan oksigen bagi para peng- huninya,” ujarnya. MEDAN (Waspada): Dalam menyambut bulan suci Ramadhan 1430H yang jatuh pada 22 Agustus 2009, keluarga besar terdiri dari Minta Penyidikan Intensif bukan hanya sekedar sebagai pelengkap melainkan mendu- kung dalam berprospek, yang ini menjamin kesegaran udara di dalam rumah,” ujarnya. Di perumahan ini, lanjutnya, H Ismed Ismail menyatakan, selain menawarkan konsep healthtyliving,desainGrahaIndah para karyawan Madani Hotel Medan mengadakan kerja bhakti antara tidak hanya sekedar tempat terdapat lebih kurang 152 unit Kelapa Gading dirancang untuk lain mengecat dan membersihkan sebagian Masjid Raya Al-Mahsun MEDAN(Waspada):Keluarga informasi yang mereka terima kejadian penghuni rumah hanya korban pembunuhan di Jalan sangat tidak masuk akal peristiwa korban beserta isterinya dan tinggal ataupun tempat bekerja. dengan 70 persen telah terisi, dan memaksimalkan privasi para Jl. SM Raja Medan, mulai Jumat (14/8). Pimpinan Amanah Property, iniakandikembangkanlagidengan penghuninya. Selain mengguna- General Manager Madani Hotel, Dedi Nelson Farchrurrozy Bandung, Kelurahan Pasar Baru, itu sebagai tindak pidana pen- pembantu rumah tangga Ng. H Ismed Ismail menyatakan, pembangunan tahap ketiga kan sistem one gate way, sebagian mengatakan kepada Waspada disela-sela pembersihan Masjid Raya Kecamatan Medan Kota, resah curian dengan kekerasan seba- Serangkaian peristiwa itu Ng bangunan tidak hanya sekedar dengan membangun sebanyak besar jalanan didalam cluster di- yang sangat artistik, kegiatan tersebut dikaitkan dengan syukuran dan meminta kepolisian meng- gaimana Pasal 365 Ayat 2 huruf- diperiksa sebagai saksi dan kini tempat tinggal ataupun bekerja 38 unit lagi. desainkuldesak(sistemjalanyang 2 tahun Madani Hotel sebagai satu-satunya Hotel Syariah yang usuttuntassekaligusmengungkap e KUH Pidana. Sebab, tidak ada dalam perlindungan polisi sesuai melainkan bagaimana penghuni “Disini selain ada fasilitas hanya memiliki 1 ujung hidup). identik mengetengahkan martabat dan etika sekaligus mewujudkan adanyasangkaanaktorintelektual satupun barang milik korban ketentuan berlaku. merasa nyaman dan betah di olahraga, keamananan 24 jam, “Yang pastinya di lahan lebih ukhuwah Islamiyah terutama bagi para tamu yang berkunjung. yang mengakibatkan meninggal- yang hilang atau dicuri tersangka, Anehnya, lanjut Irfan, dalam dalam suatu bangunan dengan listrik, PDAM, juga terdapat club kurang 6 ha nantinya akan diba- Kata Dedi, kegiatan ini didukung oleh Himpunan Keluarga Syariah nya Kesuma Wijaya Mei 2009. sementara antara korban dan pemeriksaan saksi Ng mengakui desain minimalis sesuai dengan house yang memungkinkan ngun tidak hanya perumahan Madani (HKSM) dengan ketua Syafwan, sekretaris Denny Sinaga, Haltersebutdisampaikanpe- tersangka juga tidak saling kenal ia lupa menutup pintu, dan yang budget yang dipunya. penghuni rumah akan semakin dengan berbagai type melainkan, Marketing Manager Fahmi sehingga pekerjaan yang positif ini dapat ngacara/kuasa hukum keluarga dan tidak pernah berinteraksi. paling mengetahui keadaan “Halinilahkitacobatawarkan betah. Apalagi dalam waktu dekat sekolah, fasilitas olahraga seperti terselenggara dengan lancar. korban SukamtoWijaya, Advokat Juga menurut kami tidak ada rumah termasuk posisi saklar kepada masyarakat kota Medan akan diresmikannya masjid di kolam renang, badminton, listrik, “Kami juga ikut berpartisipasi membersihkan jalan-jalan IrfanSuryaHarahap,SHdariKan- tindakpidanapenganiayaanberat listrik adalah Ng. Lalu, setelah 30 yang sibuk dengan berbagai komplekperumahan,haliniakan PAM, play ground, pasar tradisio- dilingkungan sekitar Madani Hotel bekerjasama dengan masyarakat. torHukumHarahap&Patnerdan sebagaimana pasal yang disang- menit kejadian ada pihak me- kegiatan dalam menjalankan semakin indah ketika beribadah nal, dan lainnya,” ujarnya. Puncak acara digelar 16 Agustus 2009 dengan mengundang 200- Ibeng S. Rani, SH kepada warta- kakankepadatersangkayakni351 ngaku keluarga datang ke tempat bisnisataupunusahanyamasing- padabulanRamadhannantinya,” Namun, lanjutnya, bagi ma- an anak yatim dari berbagai panti asuhan di Kota Medan serta ceramah wan di kantornya, Rabu (19/8). Ayat 2 KUH Pidana. kejadian perkara (TKP) dan masing,” ujarnya. lanjutnya kembali. syarakatyangberminat,pihaknya agama dengan mengundang ustadz,” kata Dedi menambahkan MenurutIrfan,selaintersang- ’’Sesuai fakta, maka tindak anehnya tidak diketahui siapa Diamencontohkanbeberapa Setelah sukses mengem- memberikan diskon khusus yang juga ada lounching promosi. (m25) ka ZNN, juru parkir Jalan Selat pidana tersebut adalah pembu- yang menghubungi mereka perumahan yang dibangunnya, bangkankawasanACM,Amanah dikemas dalam acara Amanah Panjang, warga Jalan Bhayang- nuhan sesuai Pasal 338 KUH sebab telepon dicabut tersangka. seperti ACM (Adress Cempaka Property mulai melebarkan Property Gelar Paket Kemerde- Pedagang Tempe karaSampali,Medan,yangsudah tertangkap dan menjalani peme- PidanadanPasal339KUHPidana. Bahkan, bisa Pasal 340 atau Dikemukakannya, sudah hampir tiga bulan penyidikan Madani) yang terletak di Jl. Ga- perta Ujung yang dibangun sayapnyakedaerahpinggirankota Medan seperti daerah Klambir. kaan RI 64 Tahun dengan poto- nganmencapaiRp64juta.“Tentu- Bawa Ganja Dibekuk riksaan, diharapkan pihak kepo- lisian dalam hal ini Polsekta Me- pembunuhanberencana.Karena faktanya sebelum kejadian saklar kasus pembunuhan tersebut mengakibatkan keluarga korban memakai konsep healthty liv Rumah-rumahyangadadicluster ing. Sebuah perumahan yang digagas denganmother concept, sebuah nya hal ini berlaku pada pameran yang kita gelar di Medan Fair MEDAN (Waspada): Karena penghasilannya dari berdagang dan Kota lebih intensif dan pro- listrik dimatikan sehingga rumah resah karena sampai kini tidak ini didesain khusus untuk konsep yang kental tentang kede- Plaza mulai tanggal 10 s/d 23 tempe tak cukup memenuhi kebutuhan rumah tangganya, Juniardi, fesional mengusut dugaan aktor korban menjadi gelap-gulita, kunjung memperoleh kepastian memaksimalkangayahidupsehat katan dengan alam. Agustus,” ujarnya kembali. 32, warga Jalan Besar Delitua Gang Banteng nekad menjual ganja. intelektual dibalik itu sekaligus sedangkan pintu rumah terbuka apa motif pembunuhan itu. yang banyak dianut keluarga “Graha Indah Kelapa Gading Dimana, lanjutnya, paket Akibatnya, pedagang tempe tersebut terpaksa meringkuk dalam mengungkap apa motivasi atau tidak terkunci. Selain itu, Dia menambahkan, selaku muda saat ini. ini nantinya dibangun di daerah tersebut bisa berbentuk uang sel Polsekta Delitua, Senin (17/8). Dari tersangka Juniardi, polisi pembunuhan tersebut. tersangka beraksi menggunakan kuasa/pengacara keluarga kor- “Dengan banyaknya bukaan KlambirV Medan, dan tentunya tunai, bebas angsuran rumah 6 menyita ½ kilogram daun ganja kering dan 1 unit sepeda motor melalui desain jendela yang lebar konsep go green akan semakin kali, bebas administrasi, bebas Astrea BK 5373 DJ sebagai barang bukti. ‘’Keluarga korban merasa alat yang bukan dari rumah ban patut menduga ada keterli- banyak kejanggalan, dan sangat korban,artinyatelahdipersiapkan batan aktif pihak lain dalam kasus serta ruang terbuka di area bela- kental. Banyak area hijau didalam asuransi, bebas bea ganti nama, KanitReskrimPolsektaDelitua,IptuHendrikTemaluru,didampingi kang menjadikan sirkulasi udara cluster menambah limpahan dan lainnya. (m38) Waka Polsekta Delitua, Iptu W Sidabutar menjelaskan, tersangka ingin mengetahui apa motif sebe- lebih dulu serta adanya penca- pembunuhan Kesuma Wijaya Juniardi ditangkap malam hari ketika sedang mengendarai sepeda narnya atas pembunuhan Kesu- butan jaringan internal telepon,’’ tersebut sehingga dimintakan motor di kawasan Jalan Kebun Sayur Kelurahan Delitua Barat. “Saat distop, tersangka sedang membawa bungkusan koran berisi daun ganja kering. Bungkusan ganja tersebut sengaja diletakkan maWijaya tersebut,’’ papar Irfan. Dikemukannya,berdasarkan ungkapnya. Dijelaskannya, pada waktu dilakukan penyelidikan dan penyidikan lebih intensif.(m34) Anak Bermasalah Hukum di atas dan diduduki tersangka sembari mengemudikan sepeda motornya,” sebut Iptu Hendrik yang baru saja menerima piagam penghargaan dari Kapoltabes MS karena turut berhasil membongkar Berhak Dilindungi kasus 5 senjata api di wilayah hukum Poltabes MS. MEDAN (Waspada) : Setiap tan dengan penanganan anak denganpihak-pihakterkaitdengan Dijelaskan Kanit Reskrim, saat bungkusan koran tersebut dibuka anak yang bermasalah dengan bermasalah dengan hukum tetap penanganan anak baik instansi ternyata berisikan ganja kering yang siap dikemas dalam beberapa hukum, berhak mendapatkan ada, antara lain, karena kurang- pemerintah maupun swasta. amplop kecil. Selanjutnya, pedagang tempe tersebut digelandang perlindungan baik fisik maupun nya sosialisasi peraturan perun- “Kita menyadari sepenuhnya dalam sel Polsekta Delitua. mental spiritual maupun sosial dang-undangan, sehingga mengapa anak harus diperlaku- Kepada petugas, tersangka Juniardi mengaku barang terlarang sesuai dengan prinsip konvensi pemahaman dan pelaksanaan kan khusus ? Karena mereka itu diperolehnya dari tersangka Bmb, warga Jalan Kawat VII hak anak dan Undang-Undang dari peraturan perundangan bagiandarigenerasimuda,potensi Tanjungmulia, dan akan dijual kepada pembelinya berinisial An Perlindungan Anak yakni non dalam penanganan anak masih dan penerus cita-cita bangsa. di Delitua. Menurut tersangka Juniardi, dirinya membeli 1 kilogram diskriminasi, kepentingan terbaik bervariasi. Memiliki peranan startegis dan ganja kering dari tersangka Bmb seharga Rp1. 200.000 dan dijual bagi anak, hak hidup dan ber- Meskipun anak berkonflik punya ciri serta sifat khusus dan kembali kepada pembelinya Rp1.450.000. (cat) kembang dan penghargaan dengan hukum itu diadili dalam memerlukan perlindungan serta terhadap pendapat anak. pengadilananak,penanganannya pembinaan dan berhak untuk Dua Jurtul Togel Diringkus Demikian disampaikan Asisten Kesejahteraan Sosial diharapkan sesuai dengan pertimbangan kepentingan ter- dapat hidup, tumbuh kembang dan berpartisipasi secara wajar,” MEDAN (Waspada): Dua juru tulis (jurtul) judi toto gelap yang Setdaprovsu, Drs H Asrin Naim, baik anak. kata Elmawati. selama ini beroperasi di Jalan Prof HM Yamin Gang India, Medan saat membuka kegiatan advokasi Sementara nara sumber AKP Nara sumber Catur Irianto, Perjuangan, diringkus tim Reskrim Polsekta Medan Timur. aparat penegak hukum dan LSM Elmawati menyebutkan, pe- SH menyebutkan, pengaturan Kedua tersangka Marno dan anggotanya Juliana, 47, Minggu dalam penanganan anak ber- nangananterhadapanakberkon- penyelenggaraanpengadilanbagi (16/8), dijebloskan ke dalam sel. Sedangkan polisi menyita barang masalah dengan hukum berlang- flik dengan hukum di jajaran anak telah diatur melalui UU No bukti berupa kertas rekap berisikan nomor-nomor tebakan, pulpen sung di ruangan Kenanga Kantoo Poldasu sesuai dengan ketentuan 3 Tahun 1997 dan Undang-Un- dan satu handphone plus Rp120 ribu hasil penjualan. Gubernur Sumut. Hadir Kepala hukum yang berlaku. Misalnya dang No 23 Tahun 2002 Tentang KapolsektaMedanTimur,AKPYatimSyahriNasution,menjelaskan, Biro Pemberdayaan Perempuan saja, apabila anak sebagai ter- Perlindungan Anak. Sedangkan kedua tersangka sudah lama menjalankan bisnis illegal tersebut secara sembunyi-sembunyi. Namun, kegiatan tersebut tercium Anak Dan Keluarga Berencana, sangka,pihakpenyidikakanmen- perlakuan terhadap anak dalam oleh petugas yang menyaru sebagai pembeli. Vita Lestari, dan nara sumber cari alternatif terbaik bagi kem- pengadilan anak, sidangnya “Saat kedua tersangka sedang menulis togel, polisi langsung AKP Elmawati serta Catur Irianto bang tumbuh anak seoptimal dilakukan secara tertutup. Anak menyergapnya,” jelas AKP Yatim. SH, sedangkan para peserta mungkindanberusahamenjauh- yang masih berumur 8 s/d 12 Begitu disergap mendadak, kedua tersangka pasrah, apalagi berasal dari LSM, stakholder dan kananakdariproseshukumformal. tahunhanyadikenakantindakan, polisi menemukan beberapa lembar kertas rekap berisikan nomor- Waspada/M.Thariq masyarakat peduli anak. Di samping itu, dalam me- dikembalikan kepada orang tua- nomor tebakan dari pembelinya. TERTIDUR DI PULAU JALAN: Seorang ibu diduga tuna wisma duduk sambil tertidur di pulau Lebihlanjutdikatakan,masa- nangani kasus anak bermasalah nya,ditempatkanpadaorganisasi Guna pengusutan lebih lanjut, kedua jurtul togel tersebut jalan persimpangan Jalan Flamboyan Raya-Setiabudi Medan. Sangking kelelahan, ibu ini melayang’ ‘ lah yang dihadapi dalam melak- dengan hukum, pihak kepolisian sosial atau diserahkan kepada dijebloskan ke dalam sel Polsekta Medan Timur. (cat) tidak lagi menghiraukan suara hangar bingar kendaraan. Foto diambil, Jumat (14/8). sanakan ketentuan yang berkai- sudah menjalin kerjasama negara. (m36)
  11. WASPADA Kamis 20 Agustus 2009 Medan Metropolitan 11 UISU Pimpinan Sariani Sah MEDAN (Waspada): Koordinator Kopertis Thaib, Ketua Umum Yayasan selaku Pj Rektor UISU), Prof tidak mengakui legalitasYayasan Wilayah I Sumut-NAD mengumumkan UISU Usman Pelly, Ketua Pembi- Basyaruddin (dosen dpk Kopertis Helmi Nasution dan Indra Guna- na Yayasan UISU Hj Sariani AS, Wilayah I selaku Pj Rektor UISU) wan. Selanjutnya, agar memberi- Universitas Islam Sumatera Utara (UISU) RektorUISUHUsmandancivitas termasuk Rektor UISU dr Chairul kan pelayanan administrasi dan pimpinan Hj Sariani AS adalah sah. akdemika lainnya. Mursin adalah tidak sah. Karena akademik dan memerintahkan RektorUISUmengumumkan kedua Pj rektor dan rektor tidak seluruh dosen hanya bekerja dan Hal itu berdasarkan keputu- sah UISU Hj Sariani AS sebagai lulusan wisudawan terbaik yakni diangkat olehYayasan UISU yang menerima perintah dariYayasan san Direktorat Jenderal Pendi- yayasan induk,” ujarnya. AnnikeAstriaIPK3,75(FH),Suriati sah yaitu,Yayasan UISU dibawah UISUyangsahdibawahpimpinan dikan Tinggi (Ditjen Dikti) cq Menurut Zainuddin, penga- IPK 3,8 (FAI), Sri Maharani IPK pimpinan Hj Sariani AS dengan Hj Sariani AS. Bagi dosen yang Kopertis Wilayah I Sumut-NAD kuan Dikti cq Kopertis Wilayh I 3,67 (FE), Sita Purnilawati IPK 3,67 Ketua Yayasan Usman Pelly. membangkang akan dikenakan mengakui UISU yang sah adalah Sumut-NAD ini berpijak pada (FS Inggeris), Diah Eka Sari IPK Adapun ijazah yang sah adalah sanksi PP No 30 tahun 1980 atau UISU pimpinan Hj Sariani AS putusan hukum MA dan putusan 3,79 (FKIP), Dahliati Sinaga IPK yang ditandatangani Rektor diatur kembali penempatannya dengan Rektor H. Usman. inkracht PTUN. 3,49 (FISIP), Syukri Ibrahim IPK Usman yang diangkat olehYaya- sebagai dosen PNS. Seusai memberikan sambu- Sementara itu,Wisuda UISU 3,55 (FP), Cashtry Meher IPK 3,13 san Hj Sariani AS. Yang lain tidak sah tan di hadapan 651 wisudawan lulusan periode II TA 2008-2009 (FK), M Husni Malik Hasibuan M. Sofyan juga mengemuka- Sementara itu, Menteri Sosial UISU, Koordinator KopertisWila- dilaksanakan di Convention Hall IPK 3,52 (FT), Mara Gunung Ha- kan legalitas ijazah lulusan UISU RI Bachtiar Chamsyah yang juga yah I Sumut-NAD, Zainuddin, Hotel Danau Toba Internasional rahap IPK 3,75 (Magister Mana- dipermasalahkan yaitu, TDR Wakil Ketua Yayasan UISU me- Rabu (19/8), mengatakan hal itu (HDTI) dihadiri Menteri Sosial jemen), Pari IPK 3,8 (Magister (tandadaftarregistrasi)bagidokter ngatakan, sesuai dengan kepu- saat jumpa pers. RI Bachtiar Chamsyah, Kadis Sastra) lulusan UISU tidak diberikan oleh tusanhukumyangditetapkanMA, “Persoalan UISU sudah sele- Pendidikan Sumut Bahrumsyah, Ijazah tidak sah KKI/KDI, Program Pascasarjana Yayasan UISU yang sah dibawah sai dan tidak perlu ada lagi kera- Koordinator Kopertis Wilayah Sementara itu, laporan hasil USU hanya merekomendasikan kepemimpinan Hj Sariani. guandimasyarakatatasketetapan I Sumut-NAD, Zainuddin, guru audit investigasi masalahYayasan calon mahasiswa yang ijazahnya “Itumemanghasilkeputusan Waspada/Surya Efendi pemerintah ini bahwa UISU yang besar hukum Islam, Hasballah UISU, Depdiknas Inspektorat ditandatangani oleh rektor yag hukum,” ujarnya kepada warta- JENGUK PEJUANG: Gubsu, H Syamsul Arifin, SE mencium tangan HT Nurdin dalam kunjungan Jenderal M. Sofyan dalam surat- sah, Usman. Demikian juga wan diVIP room Bandara Polonia di kediaman tokoh pejuang yang juga ayah kandung mantan Gubsu Alm HT Rizal Nurdin di Jl. HMI Cabang Medan Dilantik nya tertanggal 13 Agustus 2009 kepada Mendiknas dengan tem- Program Pascasarjana Unimed hanya menerima calon mahasis- Medan menjelang bertolak ke Jakarta, Rabu (19/8) siang. Hayam Wuruk Medan, Selasa (18/8). Gubsu dan Wagubsu hari itu menjenguk para pejuang yang uzur dalam rangka HUT ke-64 Kemerdekaan RI. MEDAN (Waspada): Kapoltabes Medan, Kombes Pol. Imam busan Sesjen Depdiknas, Dirjen wa apabila putusan hukum Menurut Bachtiar, Dirjen Margono, menghadiri pelantikan Himpunan Mahasiswa Islam DiktiDepdiknas,KopertisWilayah melalui MA telah ditetapkan. Administrasi Hukum (AHU) (HMI) dan KOHATI HMI Cabang Medan periode 2009-2010 di I Sumut-NAD Depdiknas, Ins- Ijazah ditarik Depkumham juga telah melihat Gelangang Mahasiswa H Anif Universitas Negeri Medan (Unimed), Sabtu (15/8). Hadir Pj.Walikota Medan diwakili Asisten III, FaridWajedi, sesepuh pekturInvestigasiItjenDepdiknas mengatakan hasil audit atas legalitas Yayasan UISU adalah Inspektorat Jenderal M. Sofyan memerintahkan seluruh ijazah yang telah dikeluarkan dan langsung keberadaan UISU (Uni- versitas Islam Sumatera Utara). DenganadanyasuratDirjenAHU Tender Di Dinkes HMI Sumut Delyuzar, Sekretaris Jendral PB HMI, Ahmad Nasir Siregar, mahasiswa dan undangan lainnya. Ketua DPD KNPI Kota Medan, Zulham Effendi Siregar mengung- yayasan Hj Sariani AS sebagai yayasan yang sah. Untuk itu, M. Sofyan melalui ditandatangani oleh Pj Rektor DjaniusDjamin,Basyaruddindan Chairul Mursin agar ditarik Depkumham mendaftarkan Yayasan UISU dalam lembaran negara, berarti menurut UU Banjir Sanggahan kapkan, sebagai salah satu kekuatan mahasiswa terbesar, HMI diminta suratnya memberikan kesim- kembalidandigantidenganijazah No.28/2004 hanyaYayasan UISU dapat bersinergi dengan KNPI serta kekuatan OKP lainnya untuk MEDAN (Waspada): Dinas paketVaccine Refregerator, kulkas Untuk itu Ketua Lembaga pulan bahwa dengan terbitnya yangditandatanganiRektorUISU di bawah pimpinan Hj Sariani Kesehatan Kota Medan banjir penyimpananvaksindanmenjadi PemantauPengadaanBarangdan menyukseskan program pembangunan Kota Medan. putusan MA berarti semua ijazah yang sah, Usman. yang diakui pemerintah, Karena itu KNPI berharap kepada pengurus HMI Cabang Medan dengan surat sanggahan dari pe- peserta penawar terendah Jasa, Joshua Lase meminta UISU yang ditandatangani oleh Ditjen Dikti cq Koordintor sementara yang lain tidak sah. serta tender yang kecewa atas dengan spesifikasi 100 persen proyekdiDinasKesehatanMedan yang baru dilantik mengedepankan program kerja berbasis prestasi dan kinerja, agar bisa lebih mengaktualisasikan HMI sebagai organisasi Djanius Djamin (dosen Unimed Kopertis Wilayah I Sumut-NAD (m29/m32) kinerja Panitia pengadaan barang sama persis dalam RKS yang dilelang ulang untuk menda- mahasiswa Islam yang disegani di semua sisi dan lini. danJasadalamproyekAPBD2009 diminta pihak Dinas Kesehatan patkan pelaksanaan pelelangan Menurut Zulham, momen bersejarah Kemerdekaan RI yang sudah 64 tahun, menuntut generasi muda khususnya Kota Medan untukberpikirdanbekerjakeras,sehinggadapatmenapakipembangu- Heboh Mantan Kadis yang baru saja diumumkan. Sanggahan itu mengindikasikan banyaknyamasalahdalamproses kota Medan. Namun, panitia memenang- kan perusahaan lain yang mena- yang jujur, bersih dan bebas dari KKN sehingga mendapat barang berkualitas dengan harga yang nan serta kehidupan bermasyarakat dengan prestasi yang harus lebih baik. Pj Walikota Medan, Rahudman Harahap diwakili Farid Wajedi Kesehatan Medan Bunuh Diri tender. Ketua Lembaga Pemantau Pengadaan Barang dan Jasa, Jo- warkan barang yang berbeda spesifikasi dan tidak dilengkapi registrasi Depkes sebagai salah pantas demi kepentingan masyarakat luas. Yoshua juga mengimbau menyampaikan rasa bangganya kepada HMI Cabang Medan sebagai mitra Pemko melaksanakan pembangunan. “Jadilah oposisi yang PH: Minta Polisi Usut Penyebar Isu shua Lase, SH menyatakan, ba- satu penilaian penting untuk lembaga penegak hukum ber- menegur secara konstruktif, dengan cara santun dan berpendidikan,” nyaknya surat sanggahan peserta pengadaan alat-alat kesehatan. peran aktif mengawasi bila harap Farid. MEDAN (Waspada): Heboh, hanan Rutan kesetrum saat dia ini klein Umar Zein sehat wal afiat tenderkemejapanitiapengadaan “Ini hanya salah satu contoh saja,” melihat adanya indikasi men- Adapun pengurus HMI Cabang Medan periode 2009-2010 yang beredar rumor di kalangan warta- menjemur pakaian. Tapi, bukan di Rutan T.Gusta Medan, jadi isu barangdanjasa,hanyabisaterjadi ujarnya. curigakan selama proses lelang dilantik; Ketua Umum Dedy Andika Syahputra, Sekretaris Umum wan, mantan Kepala Dinas Kese- Umar Zein. itu sasat dan tidak bertanggung bila tidak ada transparansi selama Contoh lainnya yang disam- berlangsung. Edi Gunawan, Bendahara Ahmad Ruluwat Simanjuntak dilengkapi hatan Medan, Dr Umar Zein Berbagai sumber yang dihu- jawab,” kata Iskandar. proses lelang berlangsung. paikanJoshuaLase,dalamproyek “Potensi-potensi masalah ketuabidang,wakilsekretaris,wakilbendahara,dandeparteman.(m15) tewasbunuhdiridiRutanT.Gusta bungi wartawan tidak diketahui Di tempat terpisah, Umar “Jika tidak ada transparansi, pengadaan komputer, panitia yang dapat menimbulkan keru- Medan. dari mana, siapa orang pertama Zein yang dikonfirmasi Waspada tentu yang muncul adalah memenangkan peserta dengan gian bagi negara seperti masalah Sejumlah petinggi Rutan menyebarkan fitnah itu, dan apa mengaku sudah mendapat kabar pertanyaanmengenaikredibilitas penawaran tertinggi, padahal ini, hendaknya langsung men- T.GustaMedanyangdikonfirmasi tujuanya. Polisi harus menyelidiki tentang beredar isunya yang pelaksanaan tender,” ujar Joshua sejumlah peserta memberi dapat perhatian, sehingga bisa wartawan membantah isu me- dan menangkap penyebar isu menyebutkan dirinya bunuh diri. Lase di Medan, Rabu (19/8). Da- penawaran lebih rendah dengan dicegah secara dini,” ujarnya. nyebutkanDirekturRSUPirngadi sesat itu. “Saya sudah mendengar isu itu. lam kesempatan itu dia didam- spesifikasisamapersissepertiyang Sementara itu, Kadis Kese- Medan non aktif yang dipersang- Sementara itu, kuasa hukum Banyakjugayangbertanyakepada pingi Sekretaris Sudirman Sinaga, diminta Dinas Kesehatan Kota hatan Kota Medan dr. Edwin kakan terlibat kasus korupsi saat Umar Zein, OK Iskandar, SH saya,” ujarnya. SH. Medan. Effendi, MSc yang dihubungi menjabat Kadis Kesehatan Me- dikonfirmasi Waspada menye- Ketika ditanya tanggapannya Yoshua mencontohkan, pe- Akibatnya, negara harus Waspada melalui telefon, Rabu dan tersebut bunuh diri lembaga salkan merebaknya isu sesat terhadap isu tersebut, Umar Zein ngaduan dari sejumlah rekanan membayar lebih mahal puluhan (19/8) sore, tidak menjawab. itu. itu.”Polisi harus segera mengung- berpendapat, ada orang-orang yang menduga adanya tender juta rupiah untuk barang yang Begitu juga dengan Sekretaris “Tidak benar itu, siapa bilang kap siapa pelaku dan apa tujuan- yang tidak bertanggungjawab akal-akalan di Dinas Kesehatan diminta dalam proyek tersebut, DinasKesehatanKotaMedandrg. diabunuhdiri,infosesatdantidak nya orang itu menyebar isu tidak bermaksud memojokkannya Kota Medan seperti yang dialami danmungkinmenderitakerugian Usma Polita tidak mengangkat bertanggung jawab tidak usah bertanggung jawab,” pungkas dengan isu bunuh diri. “Mudah- oleh CV Meta Sondra. Perusaha- ratusan juta rupiah untuk paket- telefonnya saat dihubungi dipercaya, soalnya beliau saat ini Iskandar. mudahan,Allahmenjauhkansaya an itu, menurut dia, ikut dalam paket proyek lainnya. Waspada.(m26) sehat walafiat, “ kata Kepala Dia mengatakan, pihaknya dari perbuatan seperti itu,” Rutan T Gusta Medan, Amran sedang mencari tahu dari mana ujarnya. Silalahi menjawab wartawan. Sumberlainyanglayakdiper- asal usul isu sesat tersebut. “Tidak tertutupkemungkinankamiakan Merebaknya isu itu, meng- ingatkan wartawan dengan peris- Pengurus Bazda Diingatkan cayajugamenguatkanpenjelasan menempuh upaya hukum, agar tiwa bunuh diri tersangka kasus Waspada/ist Karutan T.Gusta Amran Silalahi. Kata sumber itu, memang dua pelaku penyebar isu ditangkap,” pungkas Iskandar. korupsidiDinasPendidikanSumut, M Pandiangan di rumah tahanan Laksanakan Amanah PENGURUS HMI: Kapoltabes MS, Kombes Pol. Imam Margono, hari lalu ada salah seorang ta- “Allhamdulillah, hingga saat T.Gusta Medan.(h05/m26) bersama Zulham Effendi Siregar, ST dan Drs Farid Wajedi, MSi MEDAN (Waspada): Gubsu dinasi yang dilaksanakan dengan masyarakat muslim membayar memberikan ucapan selamat kepada pengurus baru HMI Cabang mengingatkan pengurus Bazda temaDengan audit wajar tanpa zakat ke lembaga. Medan. Pesta Buku 2009 Ditutup (badan amil zakat daerah) Sumut agar benar-benar melaksanakan syarat kita mantapkan penghim- punan zakat mampu membawa Kemudian,masihrendahnya kepercayaan masyarakat terha- Amir Hamzah Sukses MEDAN (Waspada) : Pesta dengan penerbit yang akhirnya itu, pemenang lomba juga me- amanah, karena yang dikelola dalah harta umat Islam. perubahan signifikan dalam upaya menghimpun potensi dap institusi pengelola zakat dan belum meratanya sosialisasi kebi- Buku 2009 yang berlangsung di masyarakatdenganbuku.Äpalagi nambah hadiah dari Bank Sumut Meriahkan HUT RI halaman Badan Perpustakaan penyelenggarannya bersifat ker- berupa buku tabungan. Gubsu diwakili Kakanwil Depagsu, Drs. H. Syahriful Mahya umat melalui zakat. Sebelumnya ketua panitia jakan dan peraturan perundang- undangan zakat. Di samping itu MEDAN (Waspada):Yayasan Universitas Tengku Amir Hamzah Daerah, Arsip dan Dokumentasi jasama dengan dengan lembaga Rp1,5 miliar Bandar, MAP menegaskan itu pelaksana Nisful Khoiri, M. Ag masih dominannya pendekatan telah melaksanakan berbagai perlombaan dengan meriah dan sukses, Sumatera Utara (BPAD) resmi dan kelompok lain. Penanggungajawabpameran pada pembukaan rapat koordi- menyebutkan, Sumut sebagai zakat secara individu dibanding dalam rangka memeriahkan HUT Ke-64 RI, belum lama ini. ditutup, Minggu (16/8). Rahudman mengaku, per- dari IKAPRO Dedy Hendrico nasi Bazda se Sumut di Asrama daerahyangberpendudukmayo- pendekatan melalui system. Kegiatan yang dipusatkan di kampus Universitas Amir Hamzah Acara penutupan yang pustakaan saat ini bukan lagi diwakili Haris menjelaskan, Pesta Haji Pangkalan Masyhur Medan, ritas muslim memiliki potensi Justru, tujuan kegiatan yang (UNHAM) JalanWillem Iskandar Medan Estate itu melibatkan seluruh dilakukan PjWalikota Medan, Drs sebagai tempat penyimpanan Buku 2009 selama 10 hari ber- Jumat (14/8). zakat yang sangat besar. Karena- diikuti 49 peserta ini adalah untuk komponen dari lembaga yang berada di bawah naungan yayasan H Rahudman Harahap dihadiri buku dan pemanfaatan teknologi langsung sukses, dimana setiap Menurut Gubsu, potensi za- nyasudahpastipengelolaanzakat mensosialisasikan hasil audit seperti pimpinan yayasan, universitas dan fakultas. Selain itu, dosen, Ka Kanwil HAM Sumut, Mashudi informasi akan tetapi berfungsi harinyapengunjungmembludak kat di Sumut cukup besar meng- dan penyalurannya dianggap Bazdasu dengan hasilWajar Tan- mahasiswa pengawai dan pimpinan Perguruan Nasional UNHAM SH, Kadis Tenaga Kerja Sumut, sebagai pusat pembelajaran dan mencapai ribuan. ingat mayoritas penduduk di sebagai ranah memiliki prospek pa Syarat dalam rangka meman- (SMP dan SMA/SMK). Tua, muda dan remaja hanyut dalam Drs Rapotan Tambunan, Kadis pusat kegiatan masyarakat untuk Sedangkan transasksi pem- daerah ini adalah muslim. Akan cerah, bahkan diyakini mem- tapkan transpransi pengelolaan kemeriahan lomba truf, tenis meja, lari goni dan tarik tambang. Pendidikan Medan, Drs Hasan berdiskusi, menulis, meneliti dan belian buku per hari mencapai tetapi, potensi yang besar itu tidak punyai imbas yang signifikan jika zakat oleh Bazdasu, meman- Perlombaan semakin ramai diisi hiburan band oleh siswa Perguruan Basri MM, Ketua DharmaWanita wisata baca. Karenanya kegiatan Rp120 juta atau selama 10 hari berimbang dengan penerimaan dieksploirasi sebagai salah satu tapkan strategi penghimpunan, Nasional UNHAM. Sebagai puncak kemeriahaan diadakan upacara BPAD Sumut, Nyonya H Tama sepertiiniharusterusditingkatkan pameran mencapai rata-rata Rp zakat yang diperoleh Bazda yang solusi memerangi kemiskinan merekomendasi terbentuknya bendera pada 17 Agustus 2009 di lapangan sepak bola kampus Syaiful,anggotaDPD-RIParlindu- untuk mencetak SDM yang 1,5 miliar. Dia menjelaskan, dari tersebut. sangat kecil. yang sejalan dengan semangat Forum Zakat Daerah (Fofza) ngan Purba SH MM, dan sejum- berkualitas melalui budaya baca pendapatan stand per hari di atas Keberadaan Bazda, lanjut visi dan misi Gubsu. Sumut. Upacara yang dipimpin Rektor UNHAM Tarmizi, SH., M.Hum, lah kepala Kantor Perpustakaan massal, mudah dan murah. Rp800.000,-sedangkanterbanyak dihadiri Ketua Yayasan H. OK Chairuddin, SH, Pembantu Rektor Gubsu,merupakanharapanyang Namun,lanjutNisful,realitas- Dalam kesempatan itu Kabupaten/kota. Anggota DPD RI terpilih, Par- mencapai Rp15 juta, jika dirata- cukup besar bagi masyarakat nya zakat yang terkumpul oleh Gubsu menerima hasil audit I Ir Try Koryati, MP dan Pembantu Rektor II/III Ir. Basyarullah Lubis tetap berjalan selama 1 jam meski hujan rintik-rintik. Pj Walikota Medan, Drs H lindunganPurbaSHmenyatakan rata kali 20 stand mencapai rata- kurang mampu. Apalagi setelah lembaga yang dibentuk pemerin- Bazda Sumut dari kantor Menyangkut HUT RI, Basyarullah mengatakan sebagai anak Rahudman Harahap, MM dalam cara pandang masyarakat mo- rata Rp150 juta. terjadinya himpitan ekonomi tah khususnya Baz masih belum akuntan Sofyan Syafri & Partner bangsa, memperingati HUT RI tidak sekadar melaksanakan berbagai pidatonya mengatakan, kema- dern saat ini harus berubah, tidak Sementara menjelang penu- akibatkrisisyanghinggakinibelum signifikan dan maksimal. Hal ini perwakikan Medan diserahkan kegiatan bersifat serimonial. Namun, perlu menjadi perhatian, juan minat baca di Sumatera memandangorangdarisegiharta tupanpameranterjadiaksiborong dapat diselesaikan secara baik. disebabkan;belumterbangunnya H. Takiyuddin Hasibuan, SE, bagaimana mengisi pembangunan bangsa yang majemuk ini dengan Utara tidak terlepas dari peran tapi dari segi ilmu dan melihat buku dari siswa Yayasan Pergu- Gubsu berharap rapat koor- secara maksimal kesadaran MSi.(m14) tetap berpegang dengan kerangka persatuan dan kesatuan. serta BPAD bekerjasama dengan bukuyangdibaca.Kemajuanper- ruan Sultan Iskandar Muda (YP lembaga lain seperti Ikatan Pe- pustakaan saat ini tidak terlepas SIM) Medan dipimpin Ketua “Saat ini dua hal itu semakin memudar akibat digilas kepentingan sesaat yang berusaha membodohi rakyat,” ujarnya. (m15) nerbit Indonesia (IKAPI), Pengu- rus Besar Angkatan Melayu Indo- dari kepemimpinan yang meli- batkan orang lain. DewanPembinaYPSIM,drSofyan Tan didampingi Yayasan Finche Kerusakan Lingkungan Hidup Hari Ini USU Peringati nesia (PB AMMI), Lembaga Baca Tulis (ElBeTe), Forum Lingkar Sementara, Kepala BPAD Sumut, Drs Syaiful Syafri, MM SE, MSi. Selain itu, Anggota DPD RI, Parlindungan Purba, Ka. Diatas Ambang Batas Dies Natalis Ke-57 Pena (FLP), Anmiasi Sumatera Utara, Forum Alumni Teropong menambahkan, berbagai lomba yang digelar seperti lomba mem- Kanwil HAM Sumut, Mashudi, SH,KadisTenagaKerjaSumut,Drs MEDAN (Waspada) : Rusak- Hudyastuti dilakukan tiga pen- reuse, recyce dan recovery (3R) MEDAN (Waspada): Universitas Sumatera Utara (USU) akan (FORMAT)danTeropongUMSU. baca Braille bagi penyandang Rapotan Tambunan dan Ketua nya lingkungan hulu sungai me- dekatan. Pendekatan pertama dan menggunakan energi terba- memperingati Dies Natalis ke-57 dengan acara puncak dilaksanakan Dijelaskan,kegiataninipantas tuna netra, menulis cerita rakyat, Panitia, Syahril Tambuse, SH dan nyebabkansulitnyamemperbaiki dengan menerapkan standar rukansepertipenggunaanpotensi di gedung Auditorium USU, Kamis (20/8) yang akan dimulai pukul dibanggakan karena pesta buku pidato bahasa Inggris dan lainnya PjWalikota Medan menyerahkan kerusakan lingkungan hidup ter- yaknitidakbolehmelebihistandar panas bumi, potensi radiasi 09:30. ini mendekatkan masyarakat akandikemassecarakhususpada hadiahkepadapemenangLomba utama air dan udara di Indonesia. limbah, air dan standar udara. matahari, potensi mikro hidro, Demikian disampaikan Ketua dan Sekretaris Panitia Dies Natalis dengan penulis, masyarakat waktu yang akan datang. Selain Membaca Braille. (m36) USU ke-57 Prof. Ismet Danial Nasution, drg, Ph.D, Sp.Pros(K) dan Deputi VI Kementrian Ling- Pendekatan lain melalui pende- potensiangindanpotensibiofeul. Prof. Dr. Ir. Armansyah Ginting melalui Koordinator Humas, Bisru kungan Hidup, Ir Sri Hudyastuti katan mekanisme pasar yakni KetuaPanitiaDrIrMTurmuzi Hafi, S.Sos, M.Si di Kampus USU, Rabu (19/8). di Medan, kemarin menyatakan produk yang dihasilkan harus Lubis MS mengatakan seminar Bisrumenjelaskan,acaratersebutakandiawalidenganPembukaan kondisi sungai di Indonesia memiliki label berwawasan nasional tersebut sebagai salah SidangTerbuka Universitas Sumatera Utara dalam rangka Peringatan banyak yang tidak bersih lagi, dan lingkungan. satu acara rangkaian Dies Natalis Dies Natalis Ke-57 oleh Rektor USU Prof. Chairuddin P Lubis, DTM&H, jika hal itu tetap dibiarkan maka “Karena itu kami, saat Departemen Teknik Kimia USU SpA(K), kemudian disusul dengan sambutan Ketua Majelis Wali manusia akan cepat mengalami melakukan pendekatan produk ke-30 dan Temu Alumni Teknik Amanat (MWA) USU, H. Muhammad Imral Nasution dan Sambutan sakit. bersih yaitu membuat Kimia USU 2009. Gubernur Sumatera Utara, H. Syamsul Arifin, SE. “Hal ini harus segera diper- perencanaan pabrik mulai dari Selain, Menteri Lingkungan Selain itu, lanjut Bisru, pada sesi orasi ilmiah akan diisi oleh Prof. baiki jika manusia ingin menjaga hulu sampai barang jadi. Kalau Hidup RI, juga menampilkan Irma Guru Besar Fakultas Psikologi USU dengan judul orasi “Peranan kesehatannya maupun lingkung- itu bisa dihasilkan bagus maka pembicara dari Jepang dan Psikologi Dalam Menjawab Fenomena Psikologis masyarakat Indonesia”. annya,” ujarnya pada Seminar akan lebih efisien untuk energi, MalaysiayakniYamadaMaskidan Direncanakan puncak acara Peringatan Dies USU Ke-57 ini, NasionalTeknik Kimia USU 2009, meminimalkandanpemanfaatan ProfDrNikMeriamNikSulaiman selain akan dihadiri Gubernur beserta pejabat tertinggi lainnya di Jumat (14/8) di Pengadilan Semu limbah serta segala macamnya,” serta Kadis Lingkungan/Kepen- Sumatera Utara maupun Kota Medan, juga akan dihadiri Ketua Fakultas Hukum USU. Seminar ujar Sri Hudyastuti didampingi dudukan Medan, Ir Purnama KomisiVIII DPR RI, para konsulat jenderal negara sahabat. Disamping itu, dilaksanakan Departemen Ir Renita Manurung MT dan Ir Dewi Daulay MM dan Ir Hadi itu acara tersebut juga dihadiri oleh seluruh unsur sivitas akedemik Teknik Kimia USU bekerjasama Seri Maulina, MT. Chairunnas dari PT Pertamina USU mulai dari guru besar hingga mahasiswa, pegawai atau karyawan IkatanAlumniTeknikKimiaUSU. Sri Hudyastuti yang mewakili UP IV Cilacap dengan moderator USU. Sri Hudyastuti mengatakan Menteri Lingkungan Hidup Prof Ir Panahatan Hasibuan M.Pd dan Bisru menyebutkan, 20 Agustus ditetapkan sebagai Dies Natalis dirinya belum mengetahui secara (Hon) Ir Racmat Witular dalam Ir Desman Zega. USU berdasarkan Rapat Senat Universitas dan Surat Dirjen Dikti pasti berapa besar angka kerusa- seminar itu mengatakan industri Seminar yang dibuka Ketua No. 1211/DIT/2002 tanggal 19 Juni 2002. kan air sungai di Indonesia tapi sangat berperan dalam mengu- Departemen Teknik Kimia USU, Dia juga mengatakan, hingga saat ini USU telah berkembang Waspada/Anum Saskia dengan demikian pesat dengan 13 fakultas dan Sekolah Pascasarjana FOTO BERSAMA: Anggota DPD RI, Parlindungan Purba, Ka Kanwil HAM Sumut, Mashudi, secara umum sudah banyak. Hal rangi dampak perubahan iklim. Ir Renita Manurung MT itu, turut yang terdiri dari 19 program studi S-3, 34 program studi S-2, 19 SH, Kadis Tenaga Kerja Sumut, Drs Rapotan Tambunan dan Ketua Panitia, Syahril Tambuse, SH itubisadilihatdaristandarkerusa- Peranan yang diharapkan itu hadir Ketua Ikatan AlumniTeknik program studi SP-1, 5 program studi Pendidikan Profesi, 46 program dan Pj Walikota Medan menyerahkan hadiah kepada pemenang Lomba Membaca Braille pada kan lingkungan di Indonesia. adalah penghematan energi dari Kimia USU, Ir Herbun Darlin dan S-1, 15 Program studi D-3, dan 6 program studi D-IV dengan jumlah penutupan Pesta Buku Sumatera Utara 2009 di halaman Perpustakaan Daerah Sumut, Jalan Brigjen Untuk mengantisipasi keru- sektor industri 15 - 30 persen, para alumni Teknik Kimia USU mahasiswa mencapai 30 ribu orang. (m41) Katamso Medan, Minggu (16/8). sakan lingkungan, ungkap Sri memanfaatkan limbah melalui dari berbagai angkatan. (m41)
  12. 12 Opini WASPADA Kamis 20 Agustus 2009 BulanSabitDiTubuh NahdlatulUlama Hasyim Muzadi maju menjadi cawapres sebagai organisasi sosial-keagamaan Oleh Umar Syadat Hasibuan mendampingi capres Megawati dalam terbesar di Indonesia, sekaligus kekuatan pemilu 2004 yang gagal total. Pada tahun civil society di negeri ini? Saya kira, nyaris yang sama, ia pun mencalonkan diri kem- saja demikian. P ascapemilulegislatif(pileg)2009, kembali ke khittah dan menarik diri dari bali menjadi ketua umum PBNU pada Namun begitu, entitas NU tetaplah pertanyaan di atas sudah me- keikutsertaan koalisi di dalam PPP . muktamar Donohudan di Solo tanpa bisa merupakan jangkar kehidupan kebang- ngemuka di kalangan aktivis Tetapi perlu diingat, bahwa kekece- dibendung oleh kalangan NU pro-khittah saan dan kenegaraan. Dalam sejarahnya muda Nahdlatul Ulama (NU). waanpolitikinisebenarnyahanyaberpusat lantaran cabang-cabang NU sudah mera- NU adalah kekuatan rakyat sekaligus or- Berkaca pada hasil pileg yang ditandai pada kekecewaan representasi di dalam sakan“barokah kongkrit” (baca: gizi, seba- ganisasi keagamaan yang menjaga nilai- tragisnya perolehan suara parta-partai tubuh partai belaka. Di dalam tubuh NU gaimana dinyatakan cabang luar Jawa) nilai persatuan dan kebangsaan. Karena berbasis warga nahdliyin, daya pesona NU sendirinyaristidakditemukanfragmentasi dalamdukungannyakepadaketuaumum. itulah dalam segala tindak tanduknya se- nampaknya tidak lagi bisa dikapitalisasi politik yang sungguh-sungguh nyata di Belakangan Hasyim Muzadi juga me- cara tanpa pamrih diabdikan sepenuhnya olehelitnyasendiriuntukmeraupdukung- massa akar rumput. Loyalitas massa NU lakukanpolitisasiserupadenganmemobi- kepada bangsa.Tak pernah tercatat dalam an politik dari konstituen. masiheratterikatdenganparaelitnya.Dan lisasi NU struktural untuk mendukung bukusejarah,kekuatansosialiniberkhianat Terbukti pada pileg lalu partai berbasis itulah yang membuat elit NU begitu per- pencalonanpasanganKhofifahIndarPara- terhadap negara dan bangsanya. caya diri ketika memutuskan diri keluar wansa dalam pemilihan gubernur (pilgub) Tetapi NU sebagai sistem organisasio- TAJUK RENCANA NU seperti PKB dan PPP gagal mendulang suara maksimal dalam pemilu. Bahkan dari PPP . JawaTimur –tindakan yang dikritik secara nal jelas tidak bisa dilepaskan dari suatu PKB yang dianggap resmi partainya kaum Bahkan bisa dinyatakan, momentum keras dan pedas oleh Rois ‘Aam KH Sahal tipe kepemimpinan terkait dengan bagai- Nahdliyin harus kehilangan lebih dari “kembali khittah” pada tahun 1984 telah Mahfudzdisebuahmediamassanasional, mana seorang manajer mengelola organi- separuh kursinya di parlemen. PKB hanya memper(di)satukannyarissemuakompo- menyusulkemudianmobilisasidukungan sasi tersebut. Sayangnya, dalam satu de- Belajarlah Setia Dengan Rakyat meraup 4,9% suara, berkurang jauh dari perolehan suara pemilu sebelumnya yang mencapai total 12% suara nasional. De- nen NU baik para pengurus yang duduk di dalam struktur NU maupun kelompok intelektual,cendekiawandanaktivismuda secara vulgar terhadap pasangan JK-Win dalam pilpres lalu. Bila pada masa khittah, kelompok kadeterakhiriniNUdipimpinolehseorang aktor yang lebih bercirikan kepemimpinan transaksionalketimbangberkaraktertrans- mikian pula PPP yang gagal memperta- NU dalam satu barisan untuk mensukses- “organisatoris” dan independen berada formasional. Kita sekarang tidak lagi men- K etidaksetiaan merupakan suatu nilai yang seharusnya bisa hankan perolehan kursinya di parlemen. kan khittah. Mahrus Irsyam (1994) menye- di barisan terdepan kekuatan“non-politik” jumpai sosok kiai pesantren yang terlibat menjadi nilai utama dalam pelaksanaan kehidupan. Namun Tengara pudarnya pesona politik NU but mereka ini sebagai penggerak budaya, yang memberikan warga NU rasa bangga, luas dan mendalam dalam gerakan sosial kemudian banyak orang yang tetap menjadikan kesetiaan ini diperkuat kembali oleh hasil pemilu atau para pekerja kebudayaan yang meru- gengsi dan bermartabat di hadapan pe- dan kebudayaan –sebuah posisi yang presiden(pilpres)8Julilaluyangmemposi- pakangabunganantarakelompok“organi- merintah, masyarakat dan dunia interna- membuat para kiai dan ulama memiliki hanya sekedar manfaat semata. Pada alam demokrasi dan sikanpasanganJusufKalla-Wirantoberada satoris”dalamstrukturNUsebagaikekuat- sional. Kini massa NU nampak merasa kedudukan yang sangat kuat sebagai pe- keterbukaan saat ini , maka kesetiaan seseorang kepada partai politik hanya pada posisi buncit perolehan suara. Pa- an utama dan kelompok independen atau dikecewakanolehkalangan“organisatoris” mimpin masyarakat setempat. berdasarkan manfaat yang diperolehnya. sangan JK-Win yang didukung secara te- kelompok bebas kaum intelektual penyo- yangsecaravulgardanseenakperutsendiri Betapatidak,sebagaimanadicatatoleh Orang akan memilih parpol bukan lagi karena fanatisme tetapi rang-terangan oleh para kiai khususnya kong khittah. terlibat dalam arena politik praktis dan Hiroko Horikoshi (1976) yang menulis ten- Ketua PBNU Hasyim Muzadi, hanya me- Bagi kelompok “organisatoris” yang perebutan kekuasaan. Sementara di sisi tang pergulatan KiaiYusuf Tajri di Cipari, berdasarkan apa prestasi parpol itu. Itu dapat dilihat pada pemilu 1999 nempati posisi terbawah dari piramida disokong oleh kelompok independen ini, yang lain mereka bersikap acuh tak acuh, Garut,JawaBarat,kiaitidakhanyaberperan , PDI-P menjadi pemenang pemilu karena masyarakat menilai partai itu perolehansuarasementarasetelahpasang- khittah 1926 menempati kedudukan yang diam seribu bahasa, terhadap isu-isu ke- pasif sebagai cultural broker atau makelar sebagai penyelamat. Sedangkan Partai Golkar meraih nomor dua. Sedangkan an SBY-Budiono dan Megawati-Prabowo. paling tinggi dan dipandang sebagai jalan masyarakatan seperti nasib umatnya sen- budaya seperti yang ditulis oleh Geertz, pada pemilu 2004, PDI-P kalah (nomor dua) karena masyarakat menilai Padahal mobilisasi struktural yang terbaik yang akan membawa NU meraih diri yang menjadi korban semburan lum- tetapi justru menjadi pelopor perubahan digalang Hasyim Muzadi tidaklah main- kembali masa kejayaannya. Kejayaan itu pur Lapindo di Porong, Sidoarjo, Jawa yang berperan aktif menyiasati problem pemerintahan Megawati saat itu dianggap gagal. Sedangkan Partai Golkar main.LewatberbagaiforumHasyimhabis- bisa dicapai bila kekuatan kolektif NU me- Timur. sosial dan menyusun agenda perubahan menjadi pemenang. Pemilu 2009, keadaan lebih baik sehingga masyarakat habisan mempromosikan JK-Win sebagai narik diri dari “politik kekuasaan”, dan Oleh karenanya amat bisa dimengerti, yangdianggapnyasesuaidengankebutuh- menilai pemerintah berhasil sehingga Partai Demokrat menjadi pemenang. calon presiden yang murni merepresenta- kembali pada visi fundamentalnya untuk bila dalam berbagai perhelatan politik an nyata masyarakat lokal. Masyarakat menilai pemerintah yang berhasil adalah keberhasilan Presiden sikankaderNU.JusufKallamemangmasih mengejewantahkannilaipolitikkebangsa- regional maupun nasional akhir-akhir ini Fungsi sosial dan kebudayaan inilah tercatatsebagaimustasyarPWNUSulawesi an dan kenegaraan lewat agenda-agenda warga NU lebih cenderung memperlihat- yang pelan-pelan mulai ditinggalkan oleh Susilo Bambang Yudhoyono yang merupakan pendiri dan Ketua Dewan Selatan, tetapi toh itu tetap tak mengubah pemberdayaan dan peningkatan kualitas kan semacam “pembangkangan politik” kelompok“organisatoris” di dalam tubuh Pembina Partai Demokrat. preferensi politik kaum Nahdliyin. Berda- hidup masyarakat. terhadap perintah para elitnya ketimbang NU.DangejalainitelahmembuatNUnya- Harus disadari yang paling utama adalah bagaimana kesetiaan pada sarkan survey nasional yang dirilis LSI, JK Barangkali gejala inilah yang membe- mentaatinya. Seperti ditulis dalam sebuah ris kehilangan marwah, gengsi dan marta- hanya merebut hati 10% kalangan pemilih dakan antara kekecewaan politik tiga artikel berjudul “Dawuh Kiai, Maaf Saja” batnya dalam kehidupan sosial dan politik partai politik hanya didasarkan pada keuntungan semu semata. Para NU,bandingkandenganSBYyangmenca- dekade lalu dan kekecewaan politik masa dalammajalahTempopekanlaluyangme- dewasa ini. Situasi yang sulit dipertang- pengurus partai politik hanya menjadikan rakyat subjek semata setelah pai dukungan 64% suara mereka. kini. Sementara kekecewaan politik masa rekam kemenangan JK-Win di sejumlah gungjawabkan dihadapan umat ini tentu berhasil mereka kemudian ditinggalkan. Inilah yang kemudian menjadi lalu menghasilkan respon produktif oleh pondok pesantren Jawa Timur, namun saja harus diakhiri. Kepemimpinan model persoalan pokok mengapa banyak Kekecewaan Akar Rumput NU kalangan NU terutama terhadap margi- tidak diikuti oleh warga sekitar pesantren Ketua Umum Hasyim Muzadi yang telah Tentusajaironiinidiam-diammelahir- nalisasi politik kekuasaan, belakangan ini yang justeru sebagian besar menyontreng memporak-porandakantradisikhittahdan kemudian masyarakat yang melihat kan pertanyaan: benarkah suara para pe- justeru gejalanya memperlihat suatu ano- pasangan SBY-JK. tatanan kultural maupun struktural NU Intisari ketidaksetiaan partai politik dengan mimpin NU kini tidak lagi didengarkan mali. Kekecewaan politik masa kini justeru Barangkali itulah ekspresi politik dari harus segera dihentikan. Dan saya kira ini masyarakat. Pada akhirnya masyara- umatnya; dan apakah keengganan massa dialami oleh massa akar rumput NU yang apayangdisebutJamesScott(1990)sebagai hanya bisa dilakukan dengan dua hal. NU terkait dengan kekecewaan umat ter- diekspresikansecaralangsungkepadapara “seniperlawananorang-orangyangkalah” . Pertama, seluruh kekuatan NU yang Kesetiaan sangat dibu- kat muakmanfaat semu dari partai ngambil dan kemudian hanya me- hadap perilaku elit yang mempolitisasi elitnya sendiri yang cenderung terobsesi Mereka adalah warga NU yang semakin progresifdanpro-khittahhendaknyabersa- NU di satu sisi dan pengabaian elit terha- oleh kekuasaan politik. ditinggalkan oleh elitnya sendiri dan berja- ma-sama menolak figur yang hanya ingin tuhkan untuk menjadi- politik itu sendiri. dap persoalan-persoalan keumatan di sisi Mungkin bila mau disebut, figur Ketua rak dengan pesantren lantaran keber- memperdagangkan NU untuk kepenting- kan semangat pemba- Saat ini, Susilo BambangYudhoyono yang lain. Umum PBNU Hasyim Muzadi bisa di- adaannya justeru mengisolasikan diri dari an pribadi. Kedua, NU di masa mendatang DalamsejarahNU,kekecewaanpolitik nyatakan sebagai prototipe sosok“organi- denyutnadimasyarakat.Karenaterpinggir- harus dipimpin oleh figur kiai/ulama yang ngunan menjadi lebih dan pasangannya Boediono ditetapkan Komisi Pemilihan Umum sebagai pe- memang sudah menjadi bagian dari pe- satoris” yang obsesif terhadap kekuasaan kan oleh pesantren yang cenderung lebih memiliki komitmen utama dan pertama- ngalaman pahit dalam keterlibatannya ini. Akrobat politiknya telah menunjukkan intim dengan kekuasaan, maka wajarlah tama terhadap kemurnian khittah. Ini ar- kuat. menang pilpres 2009. Tentu saja rakyat di panggung politik nasional. Pada pemilu betapa ia tidak hanya bertolak belakang bilakemudiannyarisseruanpolitikapapun tinya, pemimpin NU tidak boleh melibat- banyak berharap dan berharap banyak 1952 misalnya, NU keluar dari Masyumi dengan komitmen dan cita-cita khittah entah dalam bentuk fatwa maupun kepu- kandirididalamkancahpolitikpraktisatau dari keduanya. Kondisi perekoomian karena“dikadali” oleh Masyumi. Semen- 1926 yang sudah lama diamini sebagai tusanbahtsul masail ataupun orasi-orasi transaksi-transaksi politik semacamnya. tara itu pada 1982, NU keluar dari PPP “budaya politik” baru di lingkungan NU politik yang ditujukan untuk membang- Sebaliknya, mereka harus benar-benar rakyat yang tidak menentu ditambah lagi dengan angka kemiskinan yang akibat akumulasi kekecewaan kiai-kiai NU sejak muktamar Situbondo 1984, tetapi kitkan sentimen kultural ke-NU-an tak ikhlas tanpa pamrih dan total seratus per- secara kasat mata semakin membesar ketimbang hasil survei dan sensus terhadapkebijakanpolitikpartaipimpinan juga telah menanamkan benih-benih prag- mempan lagi mengobati luka. Di mata sen dalam mengurusi jam’iyah,memikir- Badan Pusat Statistik menjadikan persoalan Indonesia semakin mem- Naro yang menyingkirkan kader-kader matisme politik dalam bentuknya yang warga, fatwa sudah tak lagi bertuah! kan masalah umatsekaligusmengayomi NUbaikdilevelkepengurusanpartaimau- paling“tulen”dihampirseluruhlevelstruk- jama’ah.[] bubung. Tentunya inilah yang menjadi pokok persoalan di negeri ini adalah pun dalam pengajuan caleg di parlemen. tural NU mulai dari tingkat pusat hing- Sebuah Renungan bagaimana menyelesaikan sebegitu banyak masalah yang karut marut Kekecewaan politik inilah yang mendo- garanting-rantingstrukturalpalingbawah. Apakah dengan demikian Nahdlatul Penulis adalah Kandidat Doktor Ilmu di depan mata. rong para pemimpin NU waktu itu untuk Tentu masih segar dalam ingatan kita, Ulama telah kehilangan daya pesonanya Politik Universitas Indonesia Di sini sangat dibutuhkan jawaban yang tepat bagaimana menyelesaikan hal itu melalui visi dan misi yang disampaikan pada kampanye lalu.Tentunya kitaberkeinginanagarmenjadimasyarakatyangmaju.Tentunyahalitudiperlukan untuk mendorong pembangunan yang menjamin pemerataan seluas-luasnya didukungsumberdayamanusiaberkualitas,infrastrukturyangmaju,penerapan Semangat Proklamasi Dalam Promosi Kesehatan ilmupengetahuandanteknologi,pembangunanyangberwawasanlingkungan jahteraan , Proklamasi adalah kristalisasi rapkan , sehingga ketika dilingkungan se- serta didukung kondisi keamanan yang kondusif. semangat sebagai titik tolak memer- kitarnya akan ada rencana acara mobi- Sedangkan masyarakat yang religius adalah mendorong pembangunan Oleh Dr.Candra Syafei, Sp.OG dekakan bangsanya dalam meneruskan lisasi massa . Maka para pamong masya- nilai kejuangan dari para pahlawan dan rakat dapat memberikan masukan kepa- akhlak mulia generasi muda, saling mengormati, rukun dan damai, tidak para pendahulunya . Padahal riil didepan da para panitia penyelenggaranya dalam M diskriminatif serta mengabdi kepada kepentingan masyarakat luas dan erdeka ! Merdeka ! Merdeka, an adalah Peningkatan kerjasama lin- mata masih banyak ditemukan adanya memilih kegiatan agar tidak bermudarat menghormati hak azasi manusia. Hidup Negara Republik In- tas sektor . peningkatan perilaku pem- berbagaiketimpangan–ketimpanganyang kalau tidak bisa bermanfaat. Pemerintah Mewujudkan masyarakat yang sejahtera dan bersatu dalam kebhinekaan donesia , sekali Merdeka Te- berdayaan masyarakat dan kemitraan pada akhirnya berwujud pada masih agar mulai menganggarkan dana bantuan tap Merdeka…! Sekali Merdeka Tetap swasta. Peningkatan kesehatan ling- rendahnya derajad kesehatan oleh karena untuk dapat menstimulus kegiatan-kegiat- adalah mendorong pembangunan yang merata, pemanfaatan sumber Jaya , Jaya.. Negeriku ! , Makmur Bang- kungan .Peningkatan upaya kesehat- perilaku hidup dari masyarakat yang mer- an yang lebih meninggalkan kesan, bukan daya yang adil guna mewujudkan kesejahteraan masyarakat. Penegakan saku…! Sejahtera rakyatku…! . Begitu- an. Peningkatan Sumberdaya kesehat- deka tapi belum merdeka. yang sia-sia atau foya-foya, bahkan ada hukum dan mewujudkan tata pemerintahan yang baik adalah mendorong lah aneka pekik hinggar bingarnya se- an Peningkatan kebijakan dan mana- Maka semangat yang menggelora dan kegiatan lomba yang kurang ( ma’af ) me- terciptanya supremasi hukum dan masyarakatnya taat hukum. Inilah mangat memperingati hari Proklamasi jemen pembangunan kesehatan Pe- begitudahsyatnyaenergikejuangan,hanya manusiakan manusia , memang sih lucu Kemerdekaan RI yang ke 64 tahun , di- ningkatan Iptek Kesehatan Peningkat- bermainditatananpermainan-permainan yakniadalahlombaaksipanjatpinangyang sebenarnya yang diinginkan masyarakat dan mereka sangat membutuhkan setiap sudut pemukiman masyarakat an lingkungan sosial budaya belaka dan kurang esensi dan misi dari didepan telah disebutkan . Karena batang sebuah kesetiaan. Mereka menginginkan adanya perubahan yang baik. semuanya ramai menggelar berbagai Promosi Kesehatan adalah upaya perubahan kearah kemerdekaan hakiki. pinangyangjaditempatpanjatansebelum- Masyarakat berkeinginan adanya perubahan yang nyata ketimbang sekedar acara atraksi , mulai dari lomba makan membantu masyarakat agar mampu me- Sehingga kegiatan lomba yang diselengga- nya dilumpuri dengan gemuk/.Vaselin, program cakap-cakap semata. Inilah yang harus dilihat oleh para penguasa krupuk , lari kelereng , lari karung , tarik laksanakanperilakuhidupbersihdansehat rakan lebih terbius dengan acara hore-hore sehingga para pesertanya seolah olah tambang , sepak bola pakai kain , lom- (PHBS)untukmenolongdirisendiri,mela- yang sia-sia . Dan ini harus segera dikem- siap jadi ( ma’af monyet ) karena badan- sehingga tidak ada lagi mereka berkeinginan berkuasa dengan ba main pukul bantal diatas air , lomba lui pembelajaran dari oleh dan bersama balikan pada efek sosial yang lebih kondu- nya berlumpuran gemuk hitam yang re- memanfaatkan kesetiaan masyarakat sementara saat sudah duduk tidak truf gembira , lomba main catur , lom- masyarakat,sesuaisosialbudayasetempat sif dan efektif . Sehingga acara mobilisasi latif susah dibersihkan , belum lagi resiko ada lagi kesetiaan itu. ba dan lain- lainnya masih banyak & didukung oleh kebijakan publik yang massa yang begitu potensial apa salahnya keseleo dan patah tulang sangat meng- Oleh karenanya sudah saatnya perubahan yang paling diinginkan adalah lagi namun yang paling favorit adalah berwawasan kesehatan. dapat di setting kan pada kegiatan yang hantui., ironisnya aduh .. ! capeknya tidak bagaimana semuanya bisa setia bukan saat membutuhkan namun saat lomba panjat pinang yang sudah dari Misi promosi kesehatan adalah mem- lebih mendukung program peningkatan se-banding dengan hadiah –hadiah yang dulu selalu menjadi ciri khas tontonan berdayakan individu , keluarga kelompok derajadkesehatanmasyarakat.Yaknisama- dijanjikan , alamak ! dibutuhkan juga. Kalau begitu tentunya akan ada perubahan yang signifikan acara peringatan hari proklamasi ke- kelompok dalam masyarakat baik melalui sama mudah dilakukan misalnya lomba sehingga tidak ada lagi rakyat yang tertinggal.**** merdekaan RI yang sudah menjadi pendekatan individu dan keluarga mau- pekarangan bersih , lomba gosok gigi yang Penulis adalah Kepala Dinas Kesehatan warisan budaya turun–temurun. punmelaluipengorganisasiandanpengge- benar, lomba masak sederhana yang ber- Propinsi Sumatera Utara Semangat memperingati hari pro- rakan masyarakat. Membina suasana gizi, lomba kamar mandi dan WC yang Hubungi kami klamasi kemerdekaan Republik Indo- lingkungan yang kondusif bagi terciptanya sehat, Lomba menanam pohon, lomba nesia , memang luar biasa yang dilaku- PHBS masyarakat. Mengadvokasi para pe- lingkungan RW / RT yang bersih, lomba kan oleh masyarakat maupun para ins- ngambilkeputusan,penentukebjakandan kotasehat,Lombamenatahalaman,lomba KANTOR PUSAT Penerbit: PT Penerbitan Harian Waspada tansi pemerintah , semua pihak turut stake holders lain, kebijakan ber-wawasan membuat apotik hidup, lomba bayi sehat, SUDUT BATUAH Jalan Letjen Suprapto/Brigjen Katamso No. 1 Komisaris Utama: Tribuana Said ambil bagian dengan berbagai kegiat- kesehatan , integrasi promosi kesehatan, lomba posyandu mandiri, lomba Puske- Medan 20151 Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM an yang memobilisasi potensi masya- kemitraan sinergis pusat daerah swasta mas idaman, lomba gerakan cuci tangan Tel: (061) 4150858, Faks Redaksi: (061) 4510025, SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 rakat sehingga begitu serentaknya ma- – LSM investasi dibidang promosi kese- pakai sabun, lomba keluarga sejahtera, Faks Tata Usaha: (061) 4531010. * Presiden: Jangan halangi tanggal 25 Februari 1988 syarakat mengadakan lomba-lomba hatan dan program kesehatan lainnya. lomba cerdas cermat di bidang kesehatan E-mail Redaksi: pembangunan Anggota SPS No. 13/1947/02/A/2002 yang dapat menjadi sarana hiburan untuk anak-anak dan lain sebagainya. - Cuma Kualanamu agak KANTOR PERWAKILAN bagi masyarakat yang murah , meriah Setting Kegiatan Kegiatan yang beraroma kesehatan terlambat pak, he...he...he Percetakan: PT Prakarsa Abadi Press betul-betul dari dan untuk masyarakat Begitu besarnya semangat untuk masyarakatjustrubelumdantidakmuncul. Bumi Warta Jaya Jalan Letjen Suprapto/Brigjen Katamso No. 1 Misi Pembangunan Kesehatan yakni, merayakan dan memperingati hari pro- Hal ini perlu peran advokasi, sosialisasi dan Jalan Kebon Sirih Timur Dalam No. 3 * Pemda dilarang buat retribusi Medan 20151 menggerakan pembangunan nasional klamasi kemerdekaan RI namun mungkin bina suasana kepada masyarakat yang Jakarta 10340 sembarangan Tel: (021) 31922216, Faks: (021) 3140817. Tel: (061) 6612681 berwawasan pembangunan kesehatan, belum terfikirkan makna dan arti per- lebih hebat, karena sudah saatnya kita - Apalagi mengutip retribusi Isi di luar tanggung jawab percetakan mendorong kemandirian masyarakat ingatan hari proklamasi kemerdekaan berperilaku yang lebih kreatif dan produktif Jalan Ratu Syafiatuddin No. 21 C sembarangan untuk hidup sehat, memelihara dan me- sehingga kegiatan-kegiatan yang memo- dan tidak sekedar buang dana yang sia- Banda Aceh 23122 Harga iklan per mm kolom: ningkatkan pelayanan kesehatan yang bilisasi masyarakat belum dan kurang di sia alias manfaatnya miskin esensi pe- Tel & Faks: (0651) 22385 BW Rp. 11.000,- * Waspadai hujan lebat dan angin bermutu , merata dan terjangkau., meme- posisikanuntukmemotivasiyangmenggu- ningkatan derajad kesehatan masyarakat, FC Rp. 30.000,- kencang Jalan Iskandar Muda No. 65 Lhokseumawe lihara dan meningkatkan kesehatan gahartikemerdekaanitusendiri,kemerde- padahal bisa dilakukan. Halaman depan BW Rp. 33.000,- - Makanya Waspada Tel: (0645) 42109 individu , keluarga dan masyarakat beserta kaanadalah upayauntukmelepaskandari Perlu Dukungan Halaman depan FC Rp. 90.000,- lah...Waspada lah! l lingkungannya. belenggu permasalahan yang mengham- Dukungan pemerintah ataupun stake D oe Wak Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Ukuran kolom: 40,5 mm Kebijakan Pembangunan Kesehat- bat untuk mencapai kemajuan dan kese- holder dan swasta bonafide sangat diha- WASPADA Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang). Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi
  13. WASPADA Kamis 20 Agustus 2009 Opini 13 Infeksi HIV Dan AIDS Di Rutan feksi ini adalah manusia yang mengidap terbentuk dan mempunyai program kerja, Beberapa faktor risiko yang ditemukan meninggal setelah menjalani perawatan an dalam penanganan. Hal ini terutama virus itu dan manusia sehat yang menjadi antara lain: di Rutan adalah banyaknya kasus-kasus di RSUP H.Adam Malik Medan dengan in- berkaitan dengan masalah biaya untuk lingkungan pengidap HIV tersebut. narkoba (utamanya narkotik suntik/putaw) feksi oportunistik toksoplasmosis otak dan pengobatan dan lain-lain. Meski para pemimpin dunia telah ber- 1. Pokja Lapas/Rutan Sumatera Utara yang ditahan dan menjalani hukuman, ke- tuberkulosis paru. Sementara penderita 2. Lambatnya proses rujukan pasien janji menyediakan layanan untuk mengen- 2. Pokja Lapas/Rutan DKI Jakarta mungkinan terjadi penularan selama ber- AIDS lainnya dirawat di Klinik Rutan Klas ke rumah sakit yang berkaitan dengan dalikan laju infeksi dan menurunkan angka 3. Pokja Lapas/Rutan Jawa Barat ada di Rutan seperti pembuatan tatoo de- I Tanjung Gusta Medan. aturan keamanan Rutan dan pendamping- kematian, namun di beberapa negara ber- 4. Pokja Lapas/Rutan Jawa Timur ngan menggunakan jarum yang tidak steril, an dari pihak keluarga pasien. kembang seperti Indonesia masih belum 5. Pokja Lapas/Rutan Jawa Tengah atau penggunaan narkotik suntik secara Permasalahan perawatan 3. Komunikasi antara klinik Rutan de- Oleh DR. Dr. Umar Zein dan optimal dan banyak kendala. Lebih dari 25 6. Pokja Lapas/Rutan DIY Jogjakarta sembunyi-sembunyi. dan pengobatan ngan rumah sakit rujukan yang belum ter- juta orang telah meninggal akibat AIDS dan 7. Pokja Lapas/Rutan Bali Penggunaan jarum suntik di kalangan Dalam penanggulangan HIV/AIDS di bina dengan baik, serta terbatasnya rumah Dr.M.Sakti Siregar 4,3 juta orang terinfeksi HIV di tahun 2006. 8. Pokja Lapas/Rutan Sulawesi Selatan penghuni Rutan yang acapkali ditemukan Rutan Klas I Tanjung Gusta Medan ditemu- sakit rujukan yang dihunjuk. Perhitungan statistik Internasional adalah dengan menyuntikkan larutan ta- kan berbagai permasalahan, yang terdiri 4. Pembiayaan kesehatan bagi peng- A IDS adalah suatu sindroma yang membuktikan bahwa jumlah orang hidup Pengidap HIV dan penderita AIDS di blet Subutex atau tablet Diazepam secara dari masalah medis dan non medis. huni Rutan yang belum terjamin. melibatkan semua organ dan dengan HIV positif dalam darahnya sampai Indonesia terbanyak adalah pada pemakai intravena. Tindakan ini, disamping dapat Masalah Medis adalah : sistim tubuh penderitanya, se- tahun 2007 sebanyak 33,2 juta, 30,8 juta narkotiksuntik. Mayoritas penghuni Rutan/ menularkan HIV melalui jarum suntik yang 1. Terbatasnya fasilitas klinik, termasuk Saran dan penutup hingga penyakit ini melibatkan dewasa, 15,4 juta perempuan dan 2,5 juta Lapas adalah orang-orang yang berkaitan digunakan bersama, juga berisiko tinggi kondisi ruang rawat, obat-obatan untuk Penanggulangan HIV/AIDS di Rutan semua disiplin ilmu kedokteran. Jumlah diantaranya anak usia di bawah 15 tahun. dengan masalah narkoba. Data Ditjenpas untuk terjadinya infeksi melalui pembuluh infeksi oportunistik, sarana laboratorium dan perlu mendapat perhatian khusus, karena kasus yang ditemukan terus bertambah, Sedangkan jumlah kasus baru pada tahun Depkumham tahun 2007, jumlah pemakai darah dan keracunan obat/efek samping masalah makanan untuk orang sakit yang komunitas pengidap HIV dan penderita membuat penyakit infeksi menular lang- 2007 yakni 2,5 juta terdiri dari 2,1 juta de- narkoba sebanyak 25.283 orang (74 per- obat yang tidak memenuhi standar cara masih jauh dari standar gizi rumah sakit. AIDS berada di dalam satu area yang seha- sung ini bukan saja menjadi perhatian wasa dan 420.000 anak di bawah 15 tahun sen), pengedar sebanyak 8.200 orang (24 pemberiannya. 2. Terbatasnya tenaga medis yang ter- rusnya lebih mudah ditangani secara multi secara nasional, tapi juga menjadi penga- persen) dan produsen sebanyak 683 orang Data terbaru yang didapat dari hasil latih, baik dari tenaga dokter, perawat, ana- disiplin. Kondisi ini juga sangat potensial matan berbagai kalangan di dunia. Kelompok Kerja HIV/AIDS (2 persen). Jumlah total kasus narkoba yang Voluntary Counseling and Testing (VCT) lis dan ahli gizi. untuk objek penelitian berbagai disiplin HIV yang menjadi penyebab AIDS, ma- Pokja atau kelompok kerja merupakan menghuni Rutan/Lapas pada tahun itu dan pemeriksaan laboratorium darah 3. Masih kurangnya perhatian dan ban- ilmu kedokteran, sosial, hukum, agama suk ke dalam tubuh manusia dan berdiam kerjasama multistakeholder lintas depar- adalah 34.166 orang. Sudah dapat dipas- terhadap tahanan yang mempunyai faktor tuan dari berbagai pihak yang bertanggung dan antropologi. di dalam sel, kemudian menggunakan me- temen, instansi dan berbagai lembaga yang tikan jumlahnya saat ini lebih banyak. risiko sebagai pemakai narkotik suntik jawab dalam penanggulangan HIV/AIDS Narkoba sangat erat kaitannya dengan tabolisme sel untuk memperbanyak diri bekerja untuk merespon berbagai isu ke- (Intravenous Drug Users/IDU’s), ditemu- di Sumatera Utara, baik bantuan material HIV/AIDS, sementara kasus narkoba sudah dan berkembang. sehatan khususnya HIV/AIDS telah banyak Data di Rutan Klas I Tj.Gusta kan dari 20 orang IDU’s laki-laki dengan maupun dukungan bimbingan dan super- terkumpul sebagian besar di dalam Rutan/ Saat ini, HIV bisa dihambat pertum- dibentuk pemerintah dan swasta, termasuk Berita meninggalnya pasien AIDS di rentang usia 21-36 tahun, seluruhnya hasil visi serta promosi kesehatan. Lapas. Maka penanggulangan yang sinergi buhannya bahkan dihentikan sama sekali Pokja di Lapas/Rutan. Pokja yang saat ini RSUP H.Adam Malik yang dirujuk dari Rutan laboratorium positif HIV, delapan dian- Sedangkan masalah non medis yang antara keduanya seharusnya terwujud di dengan menggunakan kombinasi obat anti telah terbentuk selain Pokja Nasional di Tanjung Gusta baru-baru ini, menunjukkan taranya sudah menderita AIDS dengan in- ditemukan adalah: Rutan/Lapas. retroviral. Disamping virusnya yang meng- Direktorat Bina Khusus Narkotik, Ditjenpas bahwa Rutan merupakan tempat kasus AIDS feksi oportunistik tuberkulosis paru, 1. Kurangnya perhatian dari pihak ke- infeksi manusia seumur hidup, yang men- (Direktorat Jenderal Pemasyarakatan), dan pengidap HIV yang jumlahnya belum kandidiasis oral, dan toksoplasmosis otak. luarga penderita AIDS maupun pengidap Penulis adalah kolumnis Waspada dan jadi masalah dalam penanggulangan in- terdapat beberapa Pokja Provinsi yang telah bisa dideteksi secara pasti. Dari 8 penderita AIDS tersebut 1 orang HIV sehingga menimbulkan keterlambat- dokter Rutan Klas I Medan Ibukota Sipirok Untuk Masyarakat Tapsel ini pada Pilkada Tapsel 2005 silam. Saya vertikal yang dilengkapi dengan pusat bis- juan pemekaran tidak seharusnya bupati Setelah berhasil menguasai Sipirok berpikir Pak Bupati ini sedang tidak berpi- nis dan pertokoan, fasilitas umum, fasilitas melanjutkan rencana tersebut, pertahan- tentara Bonjol yang dipimpin Tuanku Rao Oleh Faisal Reza Pardede dato di depan ibu – ibu pengajian ataupun sosial, dan sarana pendukung seperti la- kan konsep tata ruang sebelumnya demi diangkat sebagai Gubernur Militer Padri, di hadapan peserta safari Jum’at yang sering pangan golf mini dan taman rekreasi. kepentingan seluruh masyarakat Tapanuli headquartereing di Sipirok dengan pusat P EMEKARAN merupakan upaya percepatan pembangunan yang berorientasi kepada pelayanan publik yang mudah, dekat, nyata bisa dira- sakan masyarakat serta bertujuan mense- Kota Padangsidimpuan. Hal ini tentu sangat merugikan masya- rakat Tapanuli Selatan. Potensi Pendapatan Asli Daerah (PAD) dan efek dari penempat- an pusat pemerintahan di wilayah sendiri dilakukannya dimana mereka pada umum- nya tidak akan memikirkan secara detail yang disampaikan oleh bupati. Tetapi banyak in- telektual maupun cendikiawanTapanuli Se- latan memperhatikan perkembangan ibu- Untuk mendukung rencana tersebut dituangkan lagi pada Rencana Detail Tata Ruang Kota (RDTRK) Sipirok 2007. Dengan kenyataan dan fakta tersebut di atas meru- pakan indikasi tentang ketidakpatuhan Selatan. Sejarah Sipirok Sipirok terbentuk dari migrasi marga Siregar dari Muara Siregar di pinggiran Da- pemerintahan tepat berada di Tor Pame- lean dan simbol – simbol kebudayaan yang ada di tempat tersebut langsung di buang dan dihancurkan termasuk batu megalit sebagai tempat duduk raja dan Datu Na- jahterakan serta memakmurkan masya- tidak bisa dirasakan masyarakat. kota ini dan tentu fakta–fakta yang diberikan terhadap UU no 37 Tahun 2007 dan me- nau Toba pada abad 15 atau sekitar ta-hun hurnuk karena dianggap simbol sesat dan rakat secara keseluruhan. Terkait hal tersebut di atas ditinjau dari olehbupatitersebutseharusnyadisertaikajian mang hingga saat ini laporan akhir RUTRK 1500 an. Struktur pemerintahan dan pem- berhala. Tepat pada tahun 1818 Tuanku Atas dasar tersebut berdasarkan kajian, perkembangan tentang perpindahan ibu- yang mendalam dari pihak terkait karena Sipirok belum diajukan ke DPRD sebagai bagian kekuasaan mulai dibentuk pa-da Rao menyerang tanah Batak dan diberang- potensi, dan uji kelayakan dalam pemekar- kota selama ini pada dasarnya Bupati Ta- ditinjau dengan fakta di lapangan saat ini Ranperda untuk dibahas dan ditetapkan tahun 1550 di Tambatan Gaja disekitar Aek katkan dari Tor Pamelean sehingga Sipirok an daerah, pemerintah pusat melalui suatu panuli Selatan tidak serius. Bahkan secara sangat bertolak belakang. sebagai Peraturan Daerah. Siguti sampai Tor Halihi, hal ini ditandai semakin strategis dan termasuk sebagai ketetapan UU no 37 dan no 38 Tahun 2007 terbuka Ongku P Hasibuan sebagai Bupati Sebagai salah satu contoh, bupati me- Hal tersebut sengaja diulur karena da- dengan dibaginya 3 tiga sitem kewilayahan tempat menetapnya sebagian tentara Bon- memekarkan Kabupaten Tapanuli Selatan Tapanuli Selatan malah ingin memindah- ngatakan Sipirok tidak sentralistik, padahal lam laporan akhir RUTRK Sipirok terimpli- sekaligus kekuasaan berdasarkan keturun- jol yang berjumlah 3.000 unit kavaleri (Buku menjadi 3 bagian yang terdiri Padang La- kan pusat pemerintahan ke Desa Tolang/ kalau kita melihat peta Tapanuli Selatan kasi yang dimaksud dengan Sipirok sebagai an Oppu Palti Raja Napa Napa ni Sibual- Tuanku Rao). was, Padang Lawas Utara, dan Kabupaten Maragordong dari Sipirok. yang memanjang dari Utara ke Selatan Sipi- ibukota berada dalam radius 9 km, sehing- buali yaitu Sayur Matua ke Rante Omas Berdasarkan rangkaian sejarah di atas Tapanuli Selatan sendiri sebagai kabupaten Kenyataan ini merupakan pembang- rok berada di tengah. Selanjutnya Fakta ga keberadaan Desa Tolang/kawasan Ma- sekitar Parau Sorat sekarang dan dikenal jelas diketahui Sipirok merupakan kota tua induk yang beribukota di Sipirok. kangan terhadap UU yang secara yuridis keadaan air lebih memungkinkan di Tolang ragordong sebagai lokasi pusat pemerin- dengan Kuria Parau Sorat, Sutan Parlin- dengan segala kekayaan peradaban yang Akan tetapi 23 bulan sejak UU tersebut Sipirok telah defenitif dan sah menjadi ibu- daripada Sipirok juga sangat kontras karena tahan yang direncanakan sebagaimana dungan ke Hasona sekarang terkenal de- masih harus dikembangkan. Rencana ditetapkan, ibukota sekaligus pusat pemerin- kota tanpa bisa ditafsirkan secara sepihak Sipirok sendiri mempunyai sumber air yang diajukan bupati dalam RDTRK Sipirok ngan Kuria Baringin, dan yang terakhir Pemerintah Kabupaten Tapanuli Selatan tahan KabupatenTapanuli Selatan tetap ber- oleh siapapun termasuk Bupati Tapanuli yang berlimpah dari Gunung Sibualbuali, bertentangan dengan laporan akhir RUTRK mendiami Tambatan Gaja dan dikenal de- memindahkan Sipirok ke Tolang tentu adadiPadangsidimpuan.Artinya,dibanding- Selatan. sedangkan Tolang sangat minim. Sipirok yang pada kenyataannya telah di- ngan Kuria Sipirok Godang (Sipirok Par- tidak mempunyai sumber acuan yang jelas. kan Padang Lawas dan Padang Lawas Utara Berbagai alasan yang dikemukakan oleh Berdasarkan fakta tersebut di atas diser- tandatangani oleh bupati sendiri. domuan, Sutan Pangurabaan 1925). Dari Dari fakta sejarah di atas yang menjadi tentu sangat ketinggalan dan terbelakang. bupati tentu harus disertai dengan pertim- tai beberapa pernyataan bupati mengenai Pengawasan penataan ruang tentunya sistem kekuasaan tersebut mempunyai pusat Kota Sipirok adalah Tor Pamelean Apabila Paluta dan Palas sudah bisa banganyangmempunyairasionali-tas,bukan perpindahan dan pertapakan ibukota se- melibatkan masyarakat, akan tetapi meli- wilayah masing – masing sehingga tercipta tepat di Kantor Camat sekarang dan sekali- memberikan pelayanan kepada masyara- mengada–adadenganmenyebutkanSipirok perti pada 11 Februari 2009 di Aula Kenanga hat sikap arogansi serta tidak adanya trans- masyarakat karakteristik yang sangat gus titik nol Kota Sipirok. Berbagai buku kat dan mulai membangun infrastruktur rawan gempa dahsyat dalam kurun waktu Sekretariat Bupati Tapanuli Selatan yang paransi pemerintah daerah terutama ketua menghargai satu sama lain, bersahabat, tentang sejarah Sipirok tidak satupun yang pemerintahan di wilayahnya sendiri, na- sekali dalam 30 tahun karena berada tepat mengatakan “Pelanggaran terhadap UU Bappeda Tapanuli Selatan yang memperta- gotong royong dan memegang teguh prin- mengatakan Tolang / Maragordong bagian mun Tapanuli Selatan yang justru sebagai di atas Patahan Semangko. no 37 Tahun 2007 tidak mempunyai sanksi nyakan keberadaan RUTRK Sipirok dimak- sip Dalihan Na Tolu dalam kerangka Ha- dari Sipirok karena yang menjadi batas ibu dari kabupaten baru tersebut masih Terkadang saya tersenyum sekaligus apapun karena bersifat pengaturan saja”. sud tentu tidak berpedoman kepada UU ruaya Mardomu Bulung sebagai simbol terakhir pada jaman dahulu sekalipun menumpang di rumah tangga Pemerintah sedih terhadap bupati yang juga saya pilih Sungguh ironis memang, pernyataan no 26 Tahun 2007 tentang penataan ruang. dari 3 unsur kekuasaan wilayah tersebut. adalah Desa Saba Tarutung yang berada seorang pejabat negara yang seharusnya Hak, kewajiban, dan peran masyarakat di- Atas dasar menjaga kerukunan dalam di wiliyah situmba dan ketentuan tersebut menjadi tauladan bagi masyarakat dalam abaikan begitu saja terutama pasal 60 dan mengantisipasi permasalahan di kemu- sejalan dengan ketentuan sebagaimana Dedi menjunjung dan penegakan hukum. Pada- 65 dari UU tersebut yang mengakibatkan dian hari tepat di Tor Pamelean (Kantor terangkum dalam RUTRK Sipirok dengan Foliopini Sahputra hal seorang pejabat negara disumpah un- tuk taat pada perundang – undangan yang berlaku seperti yang diucapkannya saat kepentingan masyarakat banyak didulukan oleh sikap ambisius dengan rencana – ren- cana yang tidak menyentuh rakyatnya. Camat sekarang) ditanam 3 pohon Beri- ngin sebagai simbol yang mempersatukan 3 kekuasaan. Maka setiap permasalahan pengembangan kota dalam radius 9 Km. Oleh karena itu pembangkangan terhadap UU no 37 Tahun 2007 yang dilakukan oleh dilantik. Penyebabnya adalah jika meninjau yang timbul pada saat itu diselesaikan da- Bupati Tapanuli selatan juga merupakan Rasa kecewa mendalam masyarakat kondisi Kota Sipirok yang sekarang masih lam sidang di bawah pohon Beringin ter- suatu bentuk penistaan sejarah para lelu- Tapanuli Selatan kepada bupati yang tidak memerlukan perbaikan disegala aspek dan sebut yang dikenal dengan Bona ni Asar. hur yang merupakan kekayaan budaya Bung, (Jangan) Merdeka Lagi amanah terhadap UU dan dengan nyata telah merugikan masyarakat. Percepatan pembangunan serta pelayanan masyarakat masih memerlukan pengembangan kota dengan infrastruktur yang memadai, renca- na bupati di Desa Tolang/kawasan Mara- Tempat tersebut menjadi suatu mahkamah dalam penegakan hukum dan yang menja- di hakim adalah Datu Nahurnuk didam- masyarakat Tapanuli selatan. Harapan dan Penutup ‘Secara paradoksal kemerdekaan adalah takdir bagi manusia’ untuk memakmurkan masyarakat sebagai- gordong dengan berbagai fasilitasnya tentu pingi oleh raja dari masing – masing kuria. Kota Sipirok yang ada sekarang meru- Jean Paul Sartre/filsuf mana tujuan pemekaran diabaikan oleh bukan sistematika prioritas pada saat ini. Berdasarkan keadaan tersebut daerah ini pakan akumulasi sejarah panjang dari za- Bule itu. Panggil saja namanya Mas Mike. percaya diri dikit kenapa sich! Isu itu sudah ambisi pribadi bupati yang tidak mempu- Kota Sipirok sendiri bila diakumulasi ha- makin hari bertambah ramai sekaligus man ke zaman, bila Sipirok dianggap ada Dia sedang riset tentang radikalisme di Indo- harus diganti, apa kek. Misalnya, ’Majuuu’ nyai kerangka kerja serta wujud nyata men- nya sekitar 100 ha, artinya dengan rencana menjadi pusat pertemuan baik untuk sejak tahun 1720 (sejak Pemerintah Bonjol nesia. Acara tujuhbelasan itu dia diberi ke- — ’Tumbangkan Dominasi China di Asia’, jalankan amanah untuk rakyat. bupati membangun kota baru seluas 275 ha berdagang, pendidikan adat, maupun tem- menempatkan wakilnya di Sipirok) maka sempatan memberikan kata sambutan. ’Kalah-kan Ekonomi Jepang’ atau ’Kerdilkan RUTRK Sipirok di kawasan tersebut menimbulkan pertanya- pat persinggahan para saudagar diTapanuli usia Kota Sipirok saat ini adalah 288 tahun. ’’Merdekaaaa.....’’ teriaknya di awal sambutan, Malaysia Dengan Jadi Besar’, ’Gantikan Posisi Secara geografis Sipirok berada ± 600 an rakyat atau masyarakat manakah yang pada saat itu. Setelah berkembang menjadi Ide membangun kota baru sebagai ibukota mengagetkan. Amerika’, etc, etc. Karena isu merdeka itu su- Meter di atas permukaan laut dengan luas akan dilayani. Fungsi pelayanan yang seha- kota penting di Tapanuli pada saat itu lebih dari Tapanuli Selatan tentu sangat merugi- Orang-orang yang hadir tersenyum dan dah harus tuntas, tas, tas, wilayah 53.599 ha yang terdiri dari 95 desa rusnya dioptimalkan dengan memangkas dikenal dengan nama “Sipirdot” karena kan masyarakat, bahkan dengan eskalasi membalasan pekikannya, Merdeka ! Seakan- taaaaaaaaas................... dan 5 kelurahan. Jumlah penduduk pada jarak pelayanan justru dengan rencana ter- sekitar Tor Pamelean banyak ditumbuhi pertumbuhan dua kali lebih cepat dari kota akan bule asal Kanada tersebut adalah pe- Dalam keyakinan bahwa kita sudah saat ini adalah 33.038 jiwa dengan 6.851 sebut menjadi berbanding terbalik. Pohon Pirdot sehingga masyarakat menye- normal maka diperlukan waktu 144 tahun juang ’45. Padahal dia hanya orang yang ingin benar-benar merdeka, ini lahan subur bagi rumah tangga, artinya tingkat kepadatan Bila bupati masih berkeyakinan penuh butnya Sipirok sampai dengan sekarang. lagi agar pusat pemerintahan di kota baru berakrab-akrab saja; dengan cara berbaur tumbuhnya kepercayaan diri sebagai bangsa. penduduk sekitar 61,64 jiwa/km. mengembangkan Kota Sipirok sampai ke Pada tahun 1720 pemerintahan Bonjol tersebut sama dengan Kota Sipirok saat dan melakukan apa yang biasa dilakukan Kemudian di dalam kepercayaan diri itu- Sesuai dengan rencana Pemerintah perbatasan Kecamatan Angkola Timur mulai memasuki wilayah Sipirok dengan ini. Dan tidak bisa dibayangkan berapa penduduk di mana dia berada. Dia jadi ndeso lah segala potensi bisa tumbuh menjadi Kabupaten Tapanuli Selatan Sipirok akan dengan Kecamatan Sipirok memang meru- menempatkan Bondanalolot Nasution di banyak biaya harus diperlukan memba- di wilayah di mana dia tak bisa tidak ndeso, prestasi. Lain halnya jika kita masih merasa dikembangkan sebagai kota jasa dan per- pakan suatu pandangan yang visioner dan Parau Sorat Sipirok yang bertugas mencari ngun kota baru, pembangunan jaringan dia bahkan akan jadi fundamentalis kalau ragu kalau sudah benar-benar merdeka. Sifat itu perlu dilakukannya. dagangan dan wilayah sekitarnya dikem- dianggap sebagai ide yang sangat hebat, kuda dari wilayah Toba dan Humbang un- pipa air, jaringan listrik, infrastruktur ragu-ragu ini bukan saja bisa mematikan Tapi tetap saja pekikan Mas Mike terasa rasa percaya diri tetapi juga bisa membunuh bangkan menjadi beberapa blok, seperti akan tetapi ingatlah Kota Sipirok sendiri tuk keperluan tentara Padri di Minangka- transportasi, pendidikan, fasilitas umum, asing. Bukan cuma karena spelling-nya yang semua potensi yang ada. Gak beda seperti pemerintahan, pendidikan, pariwisata dan masih kota terbelakang, sarana masih mi- bau. Dari informasi yang diterima peme- fasilitas sosial tentu tidak bisa diciptakan tidak pas, tapi ada sekat psikologis yang kuat orang yang ‘demam panggung’ yang lupa sebagainya seperti yang tertuang dalam nim, artinya marilah membangun kota ber- rintah Bonjol dari Bondanalolot Nasution secara instan. tentang perasaan in group dan out group. untuk mau ngapai. Rencana Umum Tata Ruang Kota (RUTRK) dasarkan embrionya karena Kota Sipirok tersiar kabar bahwa Sipirok merupakan Beberapa contoh pembangunan pusat Begitu juga, sambutan merdeka dari warga Sipirok 2006. belum seperti Kuala Lumpur. kota penting diTapanuli dengan akses sam- pemerintahan baru di Indonesia pada tidak kalah hambarnya; setengah hati dan *** Namun secara tiba – tiba pertengahan Konsep penataan ruang Sipirok sebe- pai ke wiliyah Toba. Maka secara perlahan umumnya gagal seperti ibukota Banggai ala kadarnya. 6 Tahun setelah kemerdekaan diprokla- 2008 bupati meluncurkan ide membangun lumnya juga sudah ada, dari berbagai kon- Bonjol terus memberikan pengaruhnya Kepulauan ke Salakan, pemindahan ibuko- Namun bisa jadi si bule lebih mengerti mirkan, M. Natsir mengingatkan bangsa kota baru di sekitar Desa Tolang/kawasan sep tata ruang Kota Sipirok belum pernah di Sipirok termasuk penyiaran agama Islam taTanggerang keTigaraksa gagal total karena apa maksud kata merdeka itu ketimbang Indonesia dalam artikel berjudul “Jangan Maragordong dengan luas 275 ha dimana dibuat pengembangannya sampai ke wila- hingga pada tahun 1816 tentara Bonjol mamfaatnya tidak maksimal dan terjadi warga di sana. Bukan karena Kanada juga Berhenti Tangan Mendayung, Nanti Arus bupati berencana akan membangun pusat yah Maragordong dengan kenyataan lebih yang berkedudukan di Benteng Rao mere- pembengkakan biaya. Oleh sebab itu tidak pernah dijajah Inggris dan Prancis, tetapi Membawa Hanyut.” Beliau mengatakan; Se- pemerintahan Kabupaten Tapanuli Selatan dekat ke salah satu ibukota kecamatan di but Sipirok sekaligus menghindari pengua- ada satupun alasan bupati memindahkan karena ’merdeka’ itu. Mungkin dalam hatinya karang timbul penyakit bakhil. Bakhil keri- dengan sistem terpadu pelayanan satu atap Padang Lawas Utara, Aek Godang. Dengan saan yang akan dilakukan oleh Inggris dari ibukotadariSipirokkeDesaTolang/Kawasan dia merasa geli gak ketulungan. ’Kok ya orang ngat, bakhil waktu dan merajalela sifat baik instansi horizontal maupun instansi kerendahan hati dan demi tercapainya tu- Tapian Nauli di Teluk Sibolga. Maragordong. Selama ini masyarakat Ta- Indonesia sukanya bernostalgia terus tentang serakah. Orang bekerja tidak sepenuh hati panuliSelatansudahterlalubanyakdirugikan merdeka. Kami aja yang dulu juga pernah lagi. Orang sudah keberatan memberikan dan dengan kerendahan hati meminta ke- dijajah gak gitu-gitu amat.’ keringatnya sekalipun untuk tugasnya sen- pada bupati tetap mengacu kepada UU no diri. Segala kekurangan dan yang dipandang 37Tahun 2007 dan ketentuan yang lain yang *** tidak sempurna, dibiarkan begitu saja. Tak 64 Tahun sudah kemerdekaan kita di- sebenarnya sudah mengikat. ada semangat dan keinginan untuk memper- proklamirkan. Dengan gagah berani dan pe- baikinya.Orang sudah mencari untuk dirinya Untuk lahan pertapakan sebagaimana ngorbanan yang tak terkirakan. Dulu pejuang sendiri, bukan mencari cita-cita yang diluar sering dikeluhkan bupati sebenarnya su- mengorbankan apa saja hinga kita kemerde- dirinya. Lampu cita-citanya sudah padam Harian Waspada. dah berungkali ditawarkan, bahkan sekitar kaan dari penindasan penjajahan. Tak ada yang bisa membantah, para pejuang itu telah kehabisan minyak,programnya sudah tamat, tak tahu lagi apa yang akan dibuat!” Bantahan Berita Saya sangat menyesali pemberitaan tersebut karena menyangkut nama baik seseorang, terlebih-lebih nama baik kedua tiga minggu yang lewat melalui Ir. Abdul Rahim Siregar (mantan Pjs Bupati Tapanuli menghadiahkan kemerdekaan kepada kita. M.Natsir 58 tahun lalu sudah memper- Dengan hormat, lembaga hukum di kabupaten Nias seperti Kejaksaan dan Selatan) atas nama Badan Pengkajian Pem- Tapi hari ini, seperti setiap tahun, tema kita ingatkan bahwa bangsa kita telah kehilangan Melalui surat ini saya sampaikan kepada bapak bahwa Pengadilan Negeri Gunungsitoli. bangunan Sipirok (BPPS) menawarkan masih belum beranjak dari merdeka, huihhh. orientasinya di dalam kemerdekaan. Kata sesuai dengan pemberitaan di surat kabar Harian Waspada Kami sangat menyayangkan pihak pihak wartawan bapak langsung kepada Ir. Riswan Daulay Ketua Setiap kali pekik merdeka yang sakral ’merdeka’ hanya dijadikan objek kepentingan yang bapak pimpin edisi kamis, 06 Agustus 2009 halaman 19 dengan kode a35 telah memberikan berita bohong dan bernuansa Bappeda Tapanuli Selatan lahan seluas 50 itu diteriakkan, maka debat yang kemudian tertentu dengan penghayatan yang berbeda. kolom 6-8 dengan judul berita “Ketua LSM dilaporkan ke polisi” fitnah dengan beraninya wartawan bapak menjadikan kami Ha (sertifikat hak milik) dan dijawab akan terjadi adalah siapa yang sudah merdeka dan Tentu saja begitu, Sartre juga tahu, se- maka perlu saya sampaikan bantahan sesuai UU Pers No 40 narasumber sementara kami tidak pernah bertemu ataupun disampaikan kepada bupati. Untuk itu Pe- siapa yang belum merdeka. Dan sekoyong- jatinya kemerdekaan itu melekat dalam di- Tahun 1999 tentang pers pasal 5 ayat 2 bahwa pers wajib ataupun memberikan keterangan pers kepada para wartawan merintah Kabupaten Tapanuli Selatan di- koyong banyak yang merasa belum merdeka. mensi kemanusiaan sejak lahir. Kemerdeka- memberikan hak jawab dan pasal 7 ayat 2 wartawan memiliki dalam permasalahan tersebut.Wartawan bapak tidak menghargai harapkan lebih pro aktif dengan mengajak Jangankan orang yang memang ’tersingkir’ an tidak bersifat eksternal dalam arti meru- masyarakat Tapanuli Selatan duduk bersa- dan mentaati kode etik jurnalistik sesuai dengan surat keputusan kaidah-kaidah sebagaimana disatur dalam KEJ, telah menyajikan dari persaingan sosial, bagi mereka yang da- pakan pemberian orang lain, melainkan ma membahas persoalan ini, termasuk lam level ’menengah’ pun merasa belum bersifat internal bahkan eksistensial karena dewan pers no : 03/SK/DP/III/2006 tentang Kode Etik Jurnalistik berita dengan i’tikad buruk dan telah melanggar KEJ pasal 4 tentang (KEJ). pebuatan menyajikan berita bohong dan fitnah. juga DPRD Tapanuli selatan karena selama merdeka. Bahkan mereka yang berlimpah ada dalam diri manusia dan menjadi perwu- ini tidak terlihat koordinasi yang baik antara kemewahan pun masih ngomongi belum judan martabat manusia. Perlu saya jelaskan bahwa dalam pemberitaan tersebut Melalui bantahan ini saya sampaikan untuk diketahui,kiranya merdeka. setelah saya pelajari dengan seksama mulai dari paragraf bapak pimpinan redaksi surat kabar Harian Waspada lembaga tersebut. Dengan begitu semoga Jadi kalau jiwa kita merdeka, penjajahan Debat seperti ini bukan saja tidak tidak itu tidak bisa merenggutnya walaupun pertama sampai akhir berita intinya “saya yang memberikan menyampaikan ralat atas pemberitaan tersebut karena ini cita – cita dari pemekaran terwujud dengan produktif tapi juga buang-buang energi dan mereka menduduki negeri kita. Jiwa kita ada- penjelasan kepada wartawan dalam hal tersebut”. Atas hal menyangkut nama baik seseorang dan lembaga hukum dan baik. Horas ! pikiran. Sudah saatnya dihentikan dan kita lah merdeka, secara resmi itu sudah diprokla- tersebut saya bantah dengan tegas dan menyatakan bahwa peradilan di kabupaten Nias. sudah harus beranjak. Kita ini sudah merdeka mirkan dengan tegas 64 tahun lalu. Apalagi saya tidak pernah memberikan keterangan pers kepada media Hormat saya Penulis Ketua DPP Naposo Nauli Bulung gitu-lo. Maka jangan lagi bicarakan soal sudah sekarang Belanda sudah jauh. Jadi bung, ma- cetak maupun media elektronik termasuk kepada wartawan Mesrawati Lase Napa Napa ni Sibualbuali Sumatera Utara atau belum merdeka. Sebagai bangsa, kita sih soal merdeka lagi? ( NNBS Sumut )
  14. 14 WASPADA Kamis, 20 Agustus 2009 FAX.4561347 1 CM Rp. 12.000 3 CM Rp. 36.000 5 CM Rp. 65.000 7 CM Rp. 91.000 9 CM Rp. 126.000 11 CM Rp. 165.000 IKLAN KHUSUS HARGA BELUM TERMASUK Khusus Medan Deli, Marelan, Labuhan, Belawan 2 CM Rp. 24.000 4 CM Rp. 48.000 6 CM Rp. 78.000 8 CM Rp. 104.000 10 CM Rp. 140.000 12 CM Rp. 180.000 6x1,5 kolom Rp. 120.000 PPN 10% Hub. 0812 6390 660 Iklan Anda Dijemput Bursa HYUNDAI Avega M/T ‘08. BK Medan. Tgn. 1 Asli dari baru. SUZUKI BALENO NEXT-G ‘03/04 Maron Met BK Mdn 1 Tgn. DP 36Jt, Angs: 3,2Jtx30 TOYOTA Kijang Commando Long ‘92 Warna biru met. 6 Speed. Lengkap. Bursa Bursa Bursa MENINGGALKAN RUMAH AUTOMOTIVE HONDA CITY NEW IDSi ‘04/05 Htm, Komplit. DP 16Jt. Angs. 3Jt Lgsg bw VR 17. Jok Klt, DP 40 Jt, Angs. 4,9Jtx25 Jl. HM. Joni Ujung 355 A (Sblh Futsal SEPEDA MOTOR BUTUH UANG KOMUNIKASI Informasi Pembaca plg Hub.76700976 BK Panjang. Radja) Hub. 0811 6557 30 - 77511 799 Hub. 0813 7588 7306 (Mossec) HONDA 100% baru semua. ANDA BUTUH DANA MENINGGALKAN RUMAH AC Bursa Automotive : Air Condition PS : Power Stearing PAKET # HINO PAKET MERDEKA # SUZUKI Carry MB Thn. 85. Karoseri Gajah Mada Warna Hijau. Velg Racing. Tape, TOYOTA Kijang Inova V Lengkap. Th. 2004 Bensin. Warna hitam, BK Medan asli. Harga Type cash / credit. ada Pro- Jaminan Apa Saja, Sertifikat Tanah. GROSIR PULSA, HARGA M-KIOS SUPER MURAH !!! Nama: ANWAR PASARIBU BR : Ban Radial PW : Power Window DP Ringan + Bunga Ringan. 167,5Jt Nego. Peminat Serius Hub. 0812 Proses Cepat, Syarat Mudah. Hub. * Simpati 20 = Rp. 19350,- Umur : 48 Tahun CL ND : Central Lock : Nippon Denso RT VR : Radio Tape : Velg Racing BK Mdn asli, mobil sgt mulus sekali gram Mer deka, Proses 061-8222774, HP 0816 314 1807 . Alamat: Stabat DB : Double Blower EW : Electric Window Gratis Bak Kayu dan Paket Rp. 14 Jt. Hub. (061) 76674598 6384 8050, 0813 6123 6076 Maaf TP. BU. Cepat. Hub. 08388 591614 * Simpati 10/As 10 = Rp. 9675,- ANDA BUTUH DANA TUNAI ??? ANDA BUTUH DAN TUNAI ANA Baju Biru Garis2, tinggi, kurus. menarik lainnya. TOYOTA Kijang Super Long CHEROKEE Jeep 4x4 M/T ‘95 4 OL. Good Condition, VR, BR 31”, PW, DP 23Jt (2,3Jt) Hub. 061-766 981 86 - SUZUKI Amenity Thn. 90/91. Warna hitam, Kontan dan Cepat, Jaminan BPKB Mobil Thn. ‘92 Up. Proses Cepat, BPKB Aman, Dana Langsung Cair. * Simpati 5 / As 5 = Rp. 5100,- Bagi siapa yang melihat Velg Racing. AC, Tape, BK Mdn asli. Mobil Thn. 94 A/C. TP. W. Abu2. YAMAHA Vega R New 2007. DHT. Espass 1.6 Maron Met ‘96. AC, VS, BR, 0813 70 311 500 mulus. Rp. 29Jt. Hub. 0812 64 150194 Hub. 0852 7590 9601 Hub. Mr. Yan’s: 061-91099966, 0815 344 70666 Juga Sedia deposit biasa harga bersaing mohon bantuan. Hub. DP 14Jt. Angs. 1 Jt. ub. 0813 7588 7306 Cocok untuk Lebaran. 1 Nama. BUTUH DANA / KREDIT MOBIL HP. 0813 7591 6097 Medan HONDA Civic Nova Thn. 1988. HUBUNGI SEGERA DAN DATANG LANGSUNG KE: DAIHATSU Feroza 94 - SUZUKI Carry Thn. 1991 W. Hitam BK Asli TOYOTA Kijang Rover 1993. AC, VR, BPKB, W. biru, H. 6.7 Jt, TP. Hub. Jaminan BPKB Mobil Min Thn. 89, Truk = ISTANA RELOAD = HP. 0812 6356 473 Stabat dijual. Hitam. Rp. 39 Jt. Mulus, siap pakai. Cantik. Hub. Medan. Kondisi bagus. Tape, PW, Warna Abu2 met. D. Se- (061) 4557607 - HP. 0812 6389 709 - Suzuki Carry Thn. 1986 W. Biru, BK Medan. dan mulus, siap pakai. Harga 47Jt. 77340899 - 0813 6218 6577 & Pick Up Th. 93. Via Leasing, Jl. Prof. HM. Yamin, SH. No. 448 Medan Hub. 061-91393518 Kondisi bagus. Hub. 0813 9712 7771 Hub. 0816 3130 912 Angsuran bisa diketahui. Hub. (061) (di depan showroom Honda) HILANG / TERCECER PAKET MERDEKA SP. MOTOR SUZUKI 7731 1945 / 0813 7000 0055 DAIHATSU Taft Rocky 4x2 Thn. 87. BK Asli HONDA Civic Ferio 1996 Dijual. SUZUKI Escudo 2.0 Thn. 2004. Bursa All Smash DP 800rb + Hadiah Langsung Tlp. 061-4149813, 061-76751444, HP. 0813 7563 1772 TELAH HILANG Medan, siap pakai. Mesin/body bagus Pemakai Tanpa Perantara. Phone: Coklat met, Plat BH. Rp. 122Jt. RENTAL MOBIL All Shogun DP 1,3Jt + Hadiah Langsung All Spin DP 800rb + Hadiah Langsung Bursa 1 Sertifikat Hak Milik No. M. 1005, SV No. 00886 An. Haji Sadikin. Desa Sidodadi Hrg. 40Jt/Nego. Hub. 0813 7588 2621 Hub. 0816 3113 953 Sky Drive DP 1,5Jt + Hadiah Langsung ELEKTRONIK DIJUAL HP BB BOLD 9000 MURAH DIJUAL R. Kec. Beringin, Kab. Deli Serdang. DAIHATSU BARU PROMO LEBARAN !!! AIHATSU BAR PROMO LEBARAN ARU 061-77820004 - 8852 7010 4756 SUZUKI BARU - (061) 77612356 Carry Pick Up..........DP 7 Jt-an RENTAL KIJANG KAPSUL + Supir=Rp. 300rb. Hub. USMAN: Satria FU 150 DP 3 Jt + Hadiah Langsung Menerima Tukar Tambah Semua Merek / Data Bisa dijemput. JUAL & BELI Langsung dari Batam. Hanya Rp. BERITA TERCECER Gran Max PU............DP 8Jt-an, Angs 2 JT-an HONDA Accord Cielo ‘97 V.Tect. Warna merah. Carry Minibus..........DP 16 Jt-an Hub. Dealer Resmi kami : SUN MOTOR (Depan Kodam 1 BB) TV, PS 1, 2, 3. Laptop, LCD Projector. Handycam 3.800.000. Harga nego. Pengambilan 1 buah SHM Nomor 575/Sumber Mulyorejo An. Sontiar XENIA Li VVT-i.........DP 15JT-an, Angs. 3JT-an Karimun Estilo .......DP 20 Jt-an APV........................DP 16 Jt-an 0813 7542 6297 Tel.: 8440241 / 77613995 - 0813 7592 6735 Camera, Keyboard, Kulkas, M. Cuci, Sound, dll. 4-10 Unit. Stock Terbatas & Beberapa Kerolina Br. Simorangkir atas tanah seluas 79M2 yang TERIOS TX VVT-i.......DP 23JT-an, Angs 4 JT-an K. Film. V. Kool BK Medan. Pjk Full 1 Thn. AC/ Grand Vitara..........DP 38Jt-an Hub. MARKET ELECTRONIC. Telp. 821.0097. 66900693. terletak di Jalan Soekarno-Hatta Km. 19 No. 337 VR/CD MP3 (Original Interior Asli) Hg. 75Jt Nego. Jl. Setia Budi No. 424B Dkt. Ring Road. Dapatkan Diskon Special & 3 T IKHLAS RENT CAR YAMAHA RX King Thn. 2009 BB LAINNYA. Hub.: Bpk. AMSYORI Kelurahan Sumber Mulyorejo Kecamatan Binjai Timur Hub. (061) 7634 5277 / 0815 333 12526 TOYOTA Kijang Commando Long 6 Dalam Kota: Innova G 300rb, Avanza G: 270rb Kota Binjai. Bagi yang menemukan harap SERIUS Hub. AGUSTINA (0852 7003 9888 / 7630 4788) Speed. Thn. 90/91, mulus, orisinil, lampu Luar Kota: Innova G 350rb, Avanza G : 330rb dijual. Harga Nego. JUAL / BELI/T.T. BARU/BEKAS TV, PS, Ampli, Spk. AC, Kulkas, M. Cuci, Laptop, 0813 8525 7977 menghubungi alamat tersebut diatas. DAIHATSU Feroza ‘94. BK Hitam, ISUZU PANTHER TOTAL ASSY TH. 93 grand extra. VR, BR, RTP, AC DB, Dingin, Termasuk supir diluar BBM. Hub. 0852 61182 406 Hub. 0813 9628 5866 Proyejtor, Fax, Handicam,Camera, Keyboard, dll BK Medan Warna abu2. AC DB, Tape, VR, Hrg. 48Jt Nego. Hub. 061-9135 6484 Hub. 4577146 - 7707 3637 JUAL BLACK BERRY Storm 9500 Rp. 3,5 Jt TELAH TERCECER WASPADA lengkap, 1 tgn. K. Mulus. Hrg. 49/Jt. BR, CL, Jok kulit. Body kaleng. Harga Rp. 54Jt Senang Hati, Jl. Sekip No. 67 A Hati, No. Surat tanah atas nama Marwan Yacob Nego. Hub. 0812 6533 324 Nego. Hub. 0816 312 4358 - (061) 7754 7323 TYT. LSX-EFI ‘01/02 Biru tua met. DP 23Jt. Angs: 3,2Jt. xpress Javelin 8900 Rp. 3,3 Jt, Bold 9000 Rp. 4,1 Jt Jl. SMA 2 Karang Sari Lk. VI Sari Rejo. DAIHATSU Taft GT 4x4 Thn. 85. Sudah MITSUBISHI BARU TYT LGX - DSL ‘01/02 Biru met, AC DB, VR, BR, LIGA INGGRIS Iphone 3G 16. GB Rp. 8 Jt & NOTE BOOK Luas 6.389M2 No. Surat: 594/105/SK/ SR/VIII/2000. Bagi yang menemukan jadi (dibangun) lihat mobil dijamin tertarik, full sound sistem, velg cobra, Ban 31 Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, Colt 110, 125 PS, Pajero Sport, L200,... PW DP 35. Angs. 3,7Jt. Hub. 0813 7588 7306 INDOVISION NOKIA ESeries NSeries GARANSI hub. Komp. Malibu Indah Raya Blok cangkol 5 baru. PS, PW, CL, TV, Hrg. 60Jt. TOYOTA 100% BARU Pemesanan Diantar Telp: 0813.7034.6677 G-39. Tidak dituntut dan akan Nego. Hub. 0812 64777 088 Serius Hub. (061) 76728071 / 0812 653 3319 AVANZA (READY),RUSH, INNOVA, FORTUNER, YARIS, VIOS, 061-76508041 / diberikan hadiah yang sepantasnya. MITSUBISHI LANCER EVO 3 PAKET DAIHATSU READY STOCK - Xenia VVT-I....DP Min 17 Jt-an - Pick Up Gran Max & Terios SUV... Thn. 93. W. Hitam. Lengkap, sgt ALTIS, CAMRY, HILUX. AVANZA Dptkan Paket Lebaran Hub. 0813 7512 7297 - (061) 7795 1428 0813 7512 4675 CATUR RELOAD TELAH TERCECER / HILANG Asli Surat Tanah atas nama : Alm. Suparman dengan DP Min. 8 Jt-an & 23 J-an mulus, sehat. BK Medan asli, jarang Pulsa Elektrik 1 Chips untuk semua TOYOTA Hard Top Diesel ‘80 Dijual Map. SPPT - 1358.7. Yang terletak Sdh. trmask Angs 1, Grs. 3 Thn. & Ass. Allrisk Hub. TEDDY CAPELLA 77884663 / 0812 6325 656 pakai Hub. (061) 77731399 AC, RT, VR, Ban Besar 31. Warna Bursa Operator deposit terjamin dan aman, stok lengkap all operator di Dusun VII Desa Pematang Juhar Labuhan Deli. Dengan batas2 Sebagai Berikut: NEW DAIHATSU PROMO (DISKON + HADIAH) NISSAN PROMO LEBARAN hitam, BK Pjng Rp. 55 Jt/Nego. KOMPUTER hanya dengan Rp. 100.000 sudah - Sebelah Utara berbatas dengan M. Ginting ...83 M Xenia DP 15 Jt-an dan Angs. 2 Jt-an, Terios DP 20Jt- Gran Livina, X Gear, Xr, Xtrail, Serena, Hub. Lsg. 0813 6198 8098 - Sebelah Selatan Berbatas dengan Arjo ........84M an dan Angsuran 4 Jt-an. Luxio DP 7 Jt-an dan Angs. bisa jualan pulsa dapat transaksi 4 Jt-an, Grand Max PU DP 7 Jt-an dan Angs 2 Jt-an. Navara, Latio, Bunga Rendah / DP Metro Star Com LAPTOP 2 nd - LX 300 + & ACCESORIS - Sebelah Barat Berbatas dengan Seni ...........98M Rendah/ Disc. Hub. 0812 6559 429 TOYOTA Avanza G 2005, Dell core2duo/1gb/160/wifi/DvdRW/m/L Rp. 4.9J *axioo 12 Inc-core2-2.0/1/160/Rw/WebCam/Wi...Rp. 4.55Jt melalui Yahoo Messenger dan HP. - Sebelah Timur Berbatas dengan Alm. Bahrum ...79,5M Hub. 0819 203 8742 / 061-77722561 acer Core2-2.0/1/80/dvdrw/Web/Cam/wifi...Rp. 4.5J *MSI Core2 1.6/512/80/Rw/Wifi/M/Lan Rp. 3.2Jt Menerima Master dan Resseler, Tercecer di seputar Jl. Perjuangan P. Brayan Bengkel. PEUGEOT 406 Thn.’01 Over Credit. DP Biru, BK Medan Asli. Hub. zyrex Core2 Duo 1.8/2Gb/120 Web Cam/Wifi Rp. 4.3 *MSI Core2 1.73/1Gb/80/Rw/Wifi/M/Lan Rp. 3.8Jt MURAH.....!!! Bagi yang menemukan harap hubungi: HP. 0813 7689 “DAIHATSU PAKET MURAH” Gran Max Pick Up ..DP 8 Jt’an Angs. 2 Jt’an 55 Jt. Sisa 10x Mls, mewah Spt Mercy. 0812 604 4294 zyrex Core2 Duo 2.0/1Gb/160/Web Cam/Wifi Rp. 4,4 *Zyrex Core2Duo 2.0/1G/160/Rw/W.Cam/Wifi Rp. 4.5/Grs Info lengkap Hub. Customer 7520 atau ke ALamat Jl. Perjuangan No. 15 P.B. Bengkel. Kec. Medan Timur. Tidak akan dituntut dan akan diberi Gran Max Mini Bus ...DP 15 Jt’an Angs. 3 Jt’an Biru met simpanan, siapa cepat dia Hp CQ 40 AMD X2-2.0/1 Gb/250/W.Cam/ATI Rp. 4.8Jt *acer AMD X2-2.0/1Gb/160/W.Cam/NVDIA/DVDRW Rp. 4.8Jt Service kami: hadiah sepantasnya. Luxio 15 D ...............DP 7 Jt’an Angs 4 Jt’an dapat. Hub. 0819 646470 / Nego TP. DIJUAL 2 Unit Mobil Kijang Grand Extra 12 inc-X WareCore2-1.7/1 Gb/120/Web Cam/Rp. 4.4Jt *12 inc-Xware Core2 1.8/1G/160/Rw/W.Cam/M/Lan Rp. 4.5Jt Telp/Fax: 061 7877531 Xenia 1.0 Deluxe .....DP 12 Jt’an angs. 3 Jt’an Thn. 94 W. biru metalik. H. 71 Jt Nego. LCD-PROJECTOR Toshiba - LX 300 + Lengkap - Accesoris LAPTOP & PC-Murah - Cantik & Bagus. HP: 0856 6180 081 Terios TX M/T ............DP 20 Jt’an Angs. 4 Jt’an Sirion D M/T ..............DP 20 Jt’an angs. 4 Jt’an SUZUKI Sidekick Drag One ‘98 Kijang Grand Extra Thn. 95 W. Abu2 tua metalik. H. 74 Jt Nego. Hub. 0812 6443 004 / 7777 8725 Metro Star Com - Plaza Millenium Lt. 3 - 081 6313 6328 - Buka Jam 11.30 Jl. Karya Wisata Komplek Johor Service Katelia Indah 194 ELEKTRONIK Hub. WINDI HP. 0812 607 8052 Flexi (061) 77402067 Silver Hub. 0812 6507 413 DIJUAL BU TOYOTA Corolla DX Tahun 1982, Ingin Promosikan AC JUAL /BELI, AC, KULKAS, SEKEN DAIHATSU Zebra Thn. ‘92. Model SUZUKI Carry Futura 1.3 dijual warna hitam, mesin sehat, Harga Rp. 18,5Juta/damai. Hub. 0819 866 311. Produk Anda DI JUAL, AC SEKEN, KULKAS, M. CUCI, T.T.BARU / BEKAS Hub. 4577146 - 7707 3637 Prima 21. Mesin & Body ok. Harga Thn. 94 Karoseri Alexander Senang Hati, Jl. Sekip No. 67 A 20,5Jt/Nego. Jl. Karya Rakyat No. warna abu2 met. Masih tgn. TOYOTA Avanza G Th. 04 warna Harian MAJU TEKNIK pertama. Harga 35Jt/Nego. biru met. Hub. Jl. G. Krakatau Gg. 7030118 5 (Sei Agul). Hub. 0811 635 375 Hub. 0812 6000 9496 berkat 1 No. 6 HP. 0813 6104 7788 WASPADA FORD Escape A/T. Thn. 2003. Silver Met, VR 18 Crom, BK Mdn Rp. 139Jt. Hub. 0812 6594 2789 SUZUKI BALENO THN. 2000 W. Coklat muda met, AC, Tape, lengkap, mesin sehat. Body sgt. mulus. Orisinil, jarang pakai. Hub. 0813 7618 8118. Harga 80Jt/damai. DIJUAL ANTARA SATU TOYOTA Kijang Commando Thn. 92/ 91 Asli BK Mdn, Biru Metalik. Toyota Kijang Capsul LX Thn. 2002. BK Mdn asli, biru metalik. Telp. 7863182 Media yang Tepat untuk Iklan Anda AC 76750084 KULKAS, M. CUCI DISPENSER (BERGARANSI) MURAH / BARU AC Hanya Rp. 2.090.000 + Pipa + Kabel + Garansi Cuci AC Rp. 20.000 NB: Bongkar Pasang, Tukar Tambah, Service Hub. Sumatera Jaya Jl. Gatot Subroto 401 dekat Simpang Barat Tel. 6963 8880 - 77555550 HP. 0813 9730 5020 Bursa PHOTO COPY HarianWASPADA Tempat Iklan Anda Bursa PERCETAKAN AGUSTUS Bursa ALAT MUSIK Jl. Jend. Gatot Subroto No. 198- A Tel. (061) 415 5678 Medan Jl. IR. H. Juanda No. 29 - 31 Tel. (061) 7350 777 - Medan Jl. Sei Batang Hari No. 6 Telp. (061) 4555928 - Medan Fax. 4152946 Service KONSTRUKSI Tumpat Sedot Jl. Setia Budi / Tj. Sari WC M. SAFII Telp.: Flexi: 8442271 77944642 Jl. Gatot Subroto Medan WC TUMPAT / SEDOT Hub. 0813 7035 7291 Jl. Jamin Ginting /Pd. Bulan WC Tumpat Sedot ANDA TUMPAT - SEDOT Hub. 8219951 Jl. Setia Budi No. 2 Jl. Brayan Medan WC 0812 642 71725 ADI 8442246 Telp.: Ada Garansi WC TUMPAT/ SAL. AIR 845.8996 0812.631.6631 Bergaransi/ Setia Luhur 160 F WC TUMPAT, Sal. AIR, K. Mandi TUMPA Tel. 7878078 NARO SERVICE Jl. Sisingamangaraja WC TUMPAT SEDOT TUMPA SEDOT Telp. 76352865 735.9504 ADA GARANSI
  15. Ekonomi & Bisnis 15 WASPADA Kamis 20 Agustus 2009 Harga Kebutuhan Pokok Melonjak Kuku Bima Raih Lagi Best Brand Award MEDAN (Waspada): Harga posisi yang baik menurut para saat Ramadhan. nasional terhadap variabel diterima Kuku Bima, terutama bahan kebutuhan pokok se- petani yaitu dijual Rp7.000 per Sementara itu Joni Sem- dan parameter tertentu di be- IBBA merupakan yang kesem- perti cabai merah, bawang kg di tingkat pedagang eceran, biring, pedagang sayur di pa- berapa kota besar di tanah air bilan kalinya. Selain itu peng- merah, kentang, tomat, te- sementara itu kentang naik sar tersebut, juga mengatakan selama kurun waktu tiga bu- hargaan lain yag diterima Ku- pung trigu, mentega, gula pa- menjadi Rp7.000 per kg. hal sama, para agen dan petani lan, dengan metode multis- ku Bima adalah Top Brand sir, minyak goreng dan lainnya Naiknya harga komoditas menjaga pasokan barang agar tage random sampling pada Award, Indonesian Customer kembali naik menjelang H-1 pertanian juga diikuti oleh tidak terlalu melebihi kebu- lebih dari 10 ribu responden Satisfaction Award (ICSA), se- Ramadhan. jenis bahan pokok lainnya se- tuhan masyarakat sehingga untuk mengetahui merek ter- bagai merek asli Indonesia dan Pantauan Waspada, Rabu perti minyak goreng yang saat harga cenderung melonjak baik dari berbagai kategori The Word of Mouth Market- (19/8), di Pusat Pasar Medan ini dijual Rp8.500 per kg, gula saat kebutuhan meningkat. produk dari MARS – Marke- ing (WOMM) Award 2009. harga cabai merah saat ini te- putih asal Lampung dari Harga cabai merah yang ting & Research, seperti pada “Kami senang, Kuku Bima lah kembali mencapai Rp24 Rp8.000 per kg naik menjadi biasanya di bawah Rp15 ribu tahun-tahun sebelumnya Ku- bisa mendapatkan berbagai ribu per kg. Para pedagang Rp9.500 per kg. per kg saat ini melonjak hingga Waspada/ist ku Bima kembali meraih peng- penghargaan. Tentunya ini memperkirakan harga komo- Mentega eceran tanpa ke- Rp24 ribu per kg dan diperkira- BEST BRAND: Sido Muncul hargaan The Indonesia Best akan menjadi tolak ukur bagi ditas tersebut akan mendekati masan dari Rp7.000 per kg kan akan kembali naik men- saat menerima best brand 2009 Brand Award (IBB) 2009 untuk kami untuk terus memperta- Rp30 ribu per kg saat H-1. dijual Rp12 ribu per kg, kacang capai Rp30 ribu per kg saat baru-baru ini. kategori jamu/suplemen/obat hankan kualitas produk kami. Sedangkan harga komodi- tanah dari Rp11 ribu per kg di- punggahan, katanya. penambah gairah pria dari Selain itu kami akan terus me- tas pertanian lainnya yang ter- jual Rp13.500 per kg. Semen- Lonjakan harga juga ter- MEDAN (Waspada): Me- MARS – Marketing & Research lakukan berbagai inovasi agar masuk kebutuhan pokok ma- tara itu harga tepung terigu, jadi pada bawang merah dan rek merupakan pencitraan da- dan Majalah SWA. semakin dicintai konsumen,” syarakat seperti bawang me- telur dan beras masih dijual bawang putih yang sebelum- ri sebuah perjalanan panjang Bertempat di Hotel Shang- ujar Direktur Utama PT Sido rah telah melambung hingga dengan harga stabil. nya sangat jarang dijual di atas yang sarat dengan nilai-nilai rila baru-baru ini penghargaan Muncul Irwan Hidayat. Waspada/Hang Tuah J Said Rp13 ribu per kg, bawang pu- Menurut Rahmat, peda- Rp10 ribu, saat ini bawang pu- dari perusahaan dimana me- diserahkan Asto Sunu Subroto, Selain itu guna menso- PELONJAKAN HARGA CABAI: Seorang pedagang sedang tih yang biasanya stabil di gang Pusat Pasar Medan, naik- tih Rp16 ribu per kg dan ba- rek itu diciptakan. Berawal dari President Director MARS sialisaikan produknya baru- menunggu konsumen di depan jualannya di kawasan Pasar Rp6.000 per kg saat ini naik nya harga bahan pokok terse- wang merah Rp13 ribu poer sebuah pemikiran yang dalam didampingi Kemal E. Gani, baru ini Kuku Bima Energi Petisah, Medan. Hampir seluruh bahan pokok mengalami menjadi Rp16 ribu per kg. but terjadi di tingkat distribu- kg, ujarnya. Harga tersebut dan kreativitas serta inovasi Chief Editor SWA dan diterima melakukan road show ke se- kenaikan harga memasuki bulan Ramadhan seiring dengan Harga tomat yang pernah tor yang menaikkan harga aki- masih berpeluang besar me- yang kuat, maka lahirlah se- Product Manager Kuku Bima jumlah daerah seperti Kepu- meningkatnya permintaan pasar. Termasuk harga cabai yang anjlok hingga Rp2.000 per kg bat terjadinya aksi borong un- ngalami lonjakan pada saat H- buah merek. Energi Ludwig Brasali. lauan Bangka – Belitung, Am- meningkat. saat ini telah menemukan tuk mencukupi stok pedagang 1 Ramadhan, sebutnya.(m40) Berdasarkan pada survei Banyak penghargaan yang bon dan Ternate.(rel) TANAH DIJUAL YAYASAN GLENI MEDAN DIBUTUHKAN PERAWAT GIGI Lokasi Jl. Bunga Sakura, Tanjung Slamat, Medan Uk. 60x150m, SHM, Cocok utk Gudang, SPBU, Perumahan, dll, Rp. 1 Jt/m2 MEMBUTUHKAN SEGERA Belum Menikah Hub. (061) 7656.6060 Siswa/i lulusan SMA/ sederajat untuk di didik Hub. 0816.319.9778 TANAH Dijual murah Uk. 10x165m tepi Jln menjadi Perawat Profesional di Akademi Perawat besar Medan - Sembahe Km. 21 dari P. Batu ± 2 Km dekat Ades, Harga Rp. 375 Jt/nego COLUMBIA ASIA MEDAN, T.A. 2009/2010. Bursa habis Hub. (061) 415.3451 Jaminan bekerja langsung di GLENI INTERNA- TIONAL HOSPITAL, bagi lulusan terbaik dan PROPERTY TANAH KAPLINGAN DIJUAL Daerah Kowilhan Namorambe, SK Camat selebihnya akan direkomendasikan di seluruh Informasi Pembaca 1. Jl. Pertanian Uk. 11x17, Harga Rp. 20 Jt Rumah Sakit di bawah naungan COLUMBIA 2. Jl. Madrasah Uk. 14x17, Harga Rp. 40 Jt Bursa Property Yang serius hub: (061) 7704.4550/ 0813.9719.9199 ASIA MEDICAL SERVICES seperti di Negara GR : Garasi LB : Luas Bangunan Vietnam, India, Indonesia & Malaysia KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan DIJUAL CEPAT/ B.U SEGERA DAFTARKAN DIRI ANDA KE: KT : Kamar Tidur RT : Ruang Tamu Tanah siap bangun, Jl. Sei Tuan No. 49 SHM: Sertifikat Hak Milik M. Baru, IMB, SHM, Sdh timbun pembeli AKPER COLUMBIA ASIA: serius h u b . ( 0 6 1 ) 7 7 7 7 . 5 1 7 0 - Jl. H. Abd. Manaf Lubis No. 58 (061) 846.1422 DIJUAL CEPAT RUKO 0812.602.5170 Gaperta Ujung Medan Rk. 2½ Tkt, Lengkap IMB, SHM, Luas Contact Person: Noni (HP: 0813.6172.7529) Bangunan 4x20m, Lt. Krmk, Tiap TANAH DIJUAL Uk. 23,5x42,5m, Pagar tembok keliling lantai 2 Km, Hal Kanopy, Samping Cocok untuk rumah tinggal KURSUS KOMPUTER CEPAT DICARI D III KEBIDANAN bangunan bebas udara, PLN, Air Jl. Elang No. 1 (Komp. B.I) Bursa BUTUH ALAT BANTU DENGAR? ALAT BANTU Bursa LPK PAULINE Untuk Ibu Asrama Hub. (061) PAM, Tersedia Sanyo dan Tangki Hub. 7780.5559 - 0811.605.559 PENGOBATAN Hub. MELTRA HEARING AID MELTRA PENDIDIKAN - Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) 7642.7222/ 0813.7658.4100 air 1000 lt di Lt. 3, Tembok keliling, Jl. Kediri No. 36 Medan Tel. 4516161 - Komputer Aplikasi Perkantoran Lengkap 350 Rb (1 bulan) PENGOBATAN KUSUK TERAPI TRADISIONAL - Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) Alamat Jl. Menteng 7/ 39 B DIJUAL/ B.U Dapat mengobati segala macam penyakit: - SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) DICARI ASS. SALON Kavlingan, 7x17m, 16 Jt, SK Camat Jl. SEKOLAH TINGGI ILMU KESEHATAN - - Merakit Komputer/ Lengkap................... 400 Rb (6 hari) Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) 3 orang yg mahir, Jl. Pelita P. Samping Ktr Pos, Lokasi sgt strategis, Cocok bisnis/ kel. Sempurna Gg. Sayur Sambi Rejo Timur, - Gula - Angin duduk - Belum mendapat - Pinggang/ Ginjal - Lemah syahwat/ - Desain Grafis Komplit............................. 500 Rb (1 bulan) (STIKes) FLORA ±3Km dari Stasiun KA Tembung Serius Impoten - web Programing (PHP, MSQL)................. 400 Rb (10 hari) Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Brayan Kota HP. 0813.9611.3000 Hub. 08126047373 hub. 0812.654.6161, Kredit DP 10 Jt keturunan Hubungi: IBU TINI Jl. Sei Batang Hari Ujung 170 Medan Telp. (061) 661.8367 Harga Rp. 700 Jt/nego (TP) HP. 0852 7524 0184 Jl. Seser No. 65 dari Jl. Suluh depan Kantor Telp. 844.2158 - 844.2159 Website: NB. Tersedia tempat tinggal TANAH DIJUAL CEPAT Gubernur Pancing/ Willem Iskandar MEDAN INDAH JAYA Kami Bergerak dibidang Jasa Bangunan Tnh di tengah kota Medan, SHM, Uk. 51m Bursa dan Siap Renovasi Rumah Anda. (P) x 24m (L) Lok Jl. Suka Jaya (dekat Ktr KUSUK TRADISIONAL IZIN MENDIKNAS RI PENDIDIKAN DIBUTUHKAN SEGERA Dijamin Rapi dan Memuaskan Anda Hub. 0813 7543 1894 (R. BUDI) Lurah Sukamaju) STM Kpg Baru, Sudah pagar beton keliling, Harga damai & LULUR Hub. MBAK DINA No. 14/D/O/2009 Tanggal 2 Maret 2009 Rekomendasi Pengurus Pusat PPNI DICARI SGR lls SLTA/ sdrj Unt diddk & lsg dislrkan mjd Guru KOLEKTOR RUMAH DIJUAL Rumah 2 Tingkat (Taman Kyota Blok Peminat (Muslim) Hub. 0813.6362.1588 0812.6499.1979 No. 482/PP.PPNI/S/X/2008 Tanggal 15 Oktober 2008 C-6) Jl. Setia Budi/ Jl. Mesjid, Aman Bersedia dipanggil ditempat Rekomendasi Kepala Badan PPSDM DepKes RI PG/TK Hub: Jl. KH. Wahid - Pria Umur ± 25 thn Security 24 jam Bursa Hasyim 92 Medan Tp. 453.3875 No. HK. 03.05/1/4/5652/2008 Tanggal 30 Desember 2008 Menerima Mahasiswa Baru - 456.9269, Jl. Karyawisata No. - Pendidikan min. D3 Hub. 0813.7563.2174 BUSANA / AKSESORIS “H. MOHD. RAWAL” 23 A Johor Tp. 786.1690 Medan, RUMAH DIJUAL SPECIALIST AMBEYENT TANPA OPERASI PECI MURNI T.A. 2009/ 2010 UNTUK PROGRAM STUDI: - Bekerja di bawah tekanan target Alamat Komplek Setia Budi Indah PUTUS SAMPAI KE AKAR2NYA DIJAMIN DICARI COLECTOR II Blok IV No. 65, Type 62, Luas Tanah ATAP & DINDING EURODEK TDK SEMBUH UANG KEMBALI GARANSI 1. Sarjana Keperawatan (S1 - Mempunyai kendaraan sendiri 144m2 Medan Hub Bpk. Sanjaya ALUMINIUM ZINC - AZ - 150 Pria umur maximum 24 thn, SMA, HP. 0819.7575.536 TEMPAHAN ISTIMEWA Ciri2 Ambeyen: Disekeliling Dubur Ada KEPERAWATAN) Angkatan I Benjolan Seperti Daging Tumbuh/Jerawat, Punya kenderaan + SIM C H. ADAM AKIL HSB 2. Akademi Keperawatan (Akper) Pandai berkomunikasi - Rajin, jujur dan bertanggung jawab DIJUAL CEPAT RUMAH Jl. Setia Budi No. 49 A 8223975 Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Angkatan XVII Jl. Garu II SM. Raja (Komp. Villa Harjo Sari Duduk Serba Salah. Nyeri (Ngilu). Dubur 3. Akademi Kebidanan (Akbid) HP. 0858.3183.1621 - Mengetahui wilayah Medan No. 26) Type 70, Uk. 8x15m (Tanah), Sudah Seperti Luka, Solusinya Datang dan Renovasi, SHM, 3 KT, 2 KM, Lokasi Strategis Bursa PAGAR EURO R Berobatlah ke Angkatan VIII LOWONGAN KERJA & Aman, Cocok untuk Muslim Pendaftaran Mulai Tanggal Lamaran diantar langsung ke: Serius hub. (061) 736.5695/ 0812.6018.6888 PERABOT GALVANIS “H. MHD. RAWAL” 6 s/d 23 Agustus 2009 Sebuah perusahaan Multinasional yang berak di TEMPAHAN MURAH PUSAT: Ingin Promosikan Testing Tgl 24 Agustus 2009 bidang pemasaran Mesin Jahit merk Singer, membutuhkan beberapa orang tenaga kerja yang Jl. Prof. HM. Yamin No. 450 A RUMAH DIJUAL Jl. Kemuning VI No. 162 Blok 5 Barat, Perumnas -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Simpang Pahlawan Tel.(061) 4563067 Produk Anda Informasi selanjutnya hubungi: Helvetia Medan, LT. 139m2, LB. 9x12m2 (SHM), Cabang I Kampus STIKes Flora: akan ditempatkan di Mall-mall Medan, pada posisi: Sales Counter (samping Showroom KTM) KT 3, KM 1, Kamar mandi 2, Garasi mobil, Fas. PAM, Tlep, Gas, Listrik 900 Watt dekat Sekolah Hub Telp. (061) 6618116 - 6616802 Jl. Bunga Harum (Benteng) No. 26 Suka Jadi belakang Brimob Pekan Baru Telp. (0761) 45368 HP. 0812.656.8700 Harian Jl. Rajawali No. 24 Medan 20122 Syarat: SD, SMP, Mesjid Hub Telp. (061) 844.3767 HP. 0813.6205.3538 SPRING BED DIJUAL MURAH Cabang II: Telp. (061) 845.4406 - 845.4407 WASPADA R - Pria, usia min. 23 tahun DIBUTUHKAN SEGERA Spring Bed 6 kaki 2 lapis Rp. 1.100.000 EUROMESH Jl. Jend. A. Yani No. 105 Telp. 845.4408 - 845.4409 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 (0641) 22457 HP. 0852.262010594 - Tamatan min. SMU/ D III BAJA U-50 HP. 0812.650.6377 Dalam Rangka pembukaan kantor RUMAH DIJUAL CEPAT Spring Bed 4 kaki 2 lapis Rp. 1.000.000 KOLOM PRAKTIS Langsa: 0852 6201 0594 - Dapat berkomunikasi dgn baik cabang baru di Medan, kami EURO R SPECIALIST MATA TANPA OPERASI PT. DELINDO SAIMONA, membutuhkan Jl. Sei Sikundur No. 7 Medan Spring Bed 3 kaki 2 lapis Rp. 900.000 - Menyukai tantangan Spring Bed 3 kaki Dorong Rp. 1.000.000 BAJA U-50 - Dapat disembuhkan sampai tuntas POLTEKKES - Berpenampilan menarik - Bagi yang berprestasi ada jenjang karir karyawan/ti untuk posisi: 1. ADMINISTRASI Baru, 2 Tkt, LT. 14,5x25,5m, 7 KT, 6 KM, Dpr 2, Ltk Strategis, Dkt Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802 SIAP PAKAI - LEBIH PRAKTIS & HEMAT - Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll Media yang Tepat Dr. RUSDI Antar lamaran lengkap ke: 2. RECEPTIONIST Medan Plaza, Harga nego DARI BESI BETON Khusus yg mau masuk angkatan minus jarak pandang +/- 7 Meter B/W (buta warna), juga dapat di sembuhkan untuk 3. SEKRETARIS Hub. 0813.6191.9366 Bursa PRODUKSI: PRODI D-III PENYALUR KHUSUS SINGER Jl. Pandu Baru No. 47 (dpn PDAM TIRTANADI) Medan 4. GUDANG 5. OFFICE BOY RAGAM PT. REZEKI PRIMA JAYA ABADI sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) Iklan Anda Paling lambat 3 hari setelah iklan ini terbit DIJUAL CEPAT Jl. Sutomo No. 436 Medan 20231 No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar & D-IV Dengan syarat: 1. Foto copy Ijazah terakhir, KTP, Rumah Bangunan Baru (Siap huni), PROGRAM COMPUTER (samping Bank Maspion) FISIOTERAPI LOWONGAN KERJA RESMI KE MALAYSIA PERUSAHAAN ELEKTRONIK TERKEMUKA DI MALAYSIA Foto 2x3: 2 lbr, CV, dll 2. Tidak sedang kuliah/ kerja Lebar 10,5mtr, Panjang 15 mtr, ELDASOFT Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA AHLI TERAPI KEJANTANAN ALAT VITAL DITANGANLI LANGSUNG PAKAR PENGOBATAN DARI BANTEN: Ingin - Bengkel Berdiri Sejak 1987 WESTERN DIGITAL (M) SDN. BHD - SELANGOR - KILANG COMPANY BUKAN OUTSOURCING ATAU KONTREK 3. Diutamakan lulusan thn 2009, SMU/ 3 Kamar Tidur Jl. Eka Warni III * Utk: - Toko - Swalayan - Produksi H. MOHD. YANI Promosikan K sederajat Hub HP. 0812.6027.5881 Terakreditasi MEMBUTUHKAN 1000 ORANG PEKERJA WANITA 4. Single, max. usia 24 thn 5. Pengalaman tidak diutamakan - Grosir * Garansi Seterusnya Bursa Terapi hebat dan luar biasa..!! ingin besar panjang keras kuat hasil ditempat.!!! silahkan dan buktikan datang langsung ketempat Produk PELUANG BISNIS PELOPOR PENDIDIKAN FISIOTERAPI INTERVIEW DI PENDAFTARAN : PT. MUTIARA KARYA MITRA : SETIAP HARI KERJA Lamaran lengkap di kirim langsung ke: HOME INDUSTRI Rumah permanen keramik 3 kamar dan Single User 1 Juta Multi User 2 Juta RAIH praktek kami mengobati dalam waktu relatif singkat dan hasilnya bisa langsung dilihat, pada saat itu juga, bukan sekedar janji, tapi bukti dalam pengurutan Anda garasi. Luas tanah 430meter, keliling kami tambah besar, panjang, kuat, tahan lama, permanen untuk selamanya... DI SUMATERA SELEKSI/ INTERVIEW : 22 AGUSTUS 2009 PT. DELINDO SAIMONA Telah Meluluskan 19 Angkatan PUKUL PERSYARATAN: : 08.00 WIB s/d SELESAI Jl. Pinang Baris No. 119 FF Ruko Palem tembok, dapat dijadikan industri rumah tangga. Lingkungan hijau dan nyaman. SEMUA COMPUTER Telp. 0888.503.8877/ 0812.350.3536 - Uang BONUS-BONUS - Perjalanan wisata Dijamin puas tanpa efek samping no suntik, silikon alami secara tradisional, serta bebas pantangan usia, ras dan agama Harian HUBUNGI SEGERA: Mas (depan Terminal Pinang Baris) Medan Yang Tersebar ke seluruh Indonesia A. PERSYARATAN UMUM PT. MUTIARA KARYA MITRA LOWONGAN PEKERJAAN Lokasi Jl. Pengabdian Gg. Satria Desa Bandar Setia - Sepeda motor - Mobil - Perjalanan ibadah - Rumah UNTUK PRIA: - Jadi Perkasa UNTUK WANITA: - Membersarkan payudara WASPADA 1. WANITA Jl. Kapten Muslim No. 89C Medan Harga Rp. 325 Jt Hub. 0811.609.752 Bursa Dengan bergabung menjadi member - Tambah ukuran panjang 13, 14, 15, 16, 17 - Belum punya keturunan Menerima Mahasiswa/i Baru 2. SEHAT JASMANI DAN ROHANI 3. TAMATAN SMP/ SMU/ SMA/ SEDERAJAT Telp. (061) 845.2956 DEKAT RUMAH SAKIT SARI MUTIARA Posisi : Interviewer (Kode: INT-MDN) Departemen: GBS/DA DIJUAL CEPAT MATERIAL BANGUNAN IFA Dahsyaat, Produk2nya lengkap: - Sepatu - Baju - Bumbu Masak - Cocokware 18, 19, 20 cm - Ukuran besar 2, 3, 4, 5 cm diameter - Ingin cepat jodoh - Buka aura penghasilan - Lemah syahwat, impotensi, ejakulasi dini - Pelaris usaha/ bisnis Media T.A. 2009/ 2010 4. USIA 18 S/D 25 TAHUN B. PERSYARATAN PENDAFTARAN (GROUP SARI MUTIARA) Tugas dan Tanggung jawab: 1. Mengikuti briefing survey 1 Unit Rumah Kondisi 90% Selesai. Jl. Eka Suka Depan Gang Eka Suka - Tas - Aksesories - Susuk HHK - Buku Pendidikan - Loyo, strouke, ambeyen, diabetes - Kencing manis, asam urat, ginjal, dll - Pelet penarik cinta yang Tepat Angkatan: XXIII 1. IJAZAH ASLI 2. KTP ASLI CONTACT PERSON: 1. Ibu Mega: 0813.6220.2213 2. Menguasai isi kuesioner yang diberikan 9 Gedung Johor. Ukuran tanah 15 - Kopi Ginseng KAMI MELAYANI PASANG SUSUK DAYA TARIK PENGASIHAN untuk 3. Mencari responden sesuai panel yang x 24 M2. Ukuran rumah 12 x 16 M2. Tunggu Apalagi: ALAMAT PRAKTEK MENETAP DI HOTEL AMPLAS KAMAR 03 Pendaftaran s/d Agustus 2009 3. KARTU KELUARGA ASLI 4. PAS PHOTO WARNA UKURAN 3X4: 2 LEMBAR 2. Ibu Echi: 0813.7515.5055 telah ditentukan 4. Melakukan wawancara sesuai dengan Kamar 4 buah, Garasi 1 buah, SHM, Hubungi: SUSANTI Jl. Sudirman No. 285 Tebing Tinggi JL. PANGLIMA DENAI NO. 1 DEPAN TERMINAL AMPLAS MEDAN BUKA SETIAP HARI JAM 08.00-21.00 WIB MAHAR RP. 500.000 Iklan Anda IMB. Hub.0819 2112101 NO. KEJARI: 448/5/0170... BERGARANSI Uji Tulis: Tgl. 24 Agustus 2009 5. PHOTO COPY IJAZAH, KTP DAN KARTU KELUARGA SEBANYAK 2 LEMBAR MEDAN, AGUSTUS 2009 kuesioner survey 5. Bertanggung jawab penuh terhadap HP. 0852.6273.8629/ Telp. (0621) 21557 NB. Dicari stokist dan sub stokist seluruh Indah NO. DEPKES: B.099/DSI-5/07/2009 HP 0813.6246.3339 . HP 0813.7050.6877 . PIMPINAN kebenaran isi kuesioner DIJUAL 6. TIDAK DIPUNGUT BIAYA PENDAFTARAN Informasi/ Pendaftaran: C. RINCIAN GAJI DRS. IRWANTO TAMPUBOLON 6. Melaporkan hasil wawancara kepada 1. Rumah di Komplek Citra Menteng Field Supervisor Blok A No. 05, LT. 13x11m, LB. Harga Model 1. KAMPUS A 1. WESTERN DIGITAL (M) SDN. BHD a. GAJI POKOK RM 450/ BULAN BAGI YANG TIDAK MAMPU Persyaratan: 1. Surat lamaran 11x11m, 2 Lt, 3 KT, 3 KM, PLN, PDAM, Ter Murah Terbaru DAPAT DIBERI KERINGANAN Jl. H. Adam Malik No. 140-142 b. TUNJANGAN KEHADIRAN RM 50/ BULAN BIAYA, DENGAN MENCICIL 2. Foto copy Ijazah terakhir dan KTP 3. Daftar Riwayat Hidup Keramik + Perabotan, SHM Telp. (061) 661.4941 c. TUNJANGAN SHIFT: RM 107/ BULAN BIAYA PEMBERANGKATAN 4. Pasphoto 2x3: 3 lembar 2. Tanah di Desa Sei Rotan - Deli d. TUNJANGAN MAKAN: 16,50/ BULAN Serdang Km. 13 depan Kampus 2. KAMPUS B e. TUNJANGAN LAINNYA: RM 57 - RM 78/ BULAN Kalau bisa LEGAL 5. Pria/ Wanita, Usia: max. 35 tahun 6. Pendidikan minimal SMA Akper Harapan Mama, LT. 25x272,8m KRISNA WATER f. BONUS: - BONUS PRESTASI DAN 7. Berpenampilan menarik PELUANG BISNIS Jl. H. Sutan Oloan No. 1 Pondok Surya TAHUNAN Kenapa harus ILEGAL 8. Bersedia bekerja dilapangan Serius hub. (061) 7714.3458 - PILIH PTJKI YANG RESMI 9. Memiliki kemampuan interpersonal 0812.6578.546 1. Pemasangan Depot Air Minum D. FASILITAS Telp. 846.4282 & PROFESIONAL dan komunikasi yang baik Dengan Sistem Filtrasi & Ro 08.00-15.30 Wib setiap hari kerja 1. ASRAMA 2. TIKET PULANG/ PERGI DENGAN PESAWAT Posisi ini adalah sebagai karyawan kontrak KOST WANITA MUSLIM Rp. 22 Jt s/d 38Jt 3. ASURANSI KESEHATAN Lamaran dan riwayat hidup dikirim ke: - Jl. Cemara Brayan 26A (sebelah SPBU) 2. Air Pegunungan 6700 s/d 7000 Liter CP: 0852.9725.2579/ 0819.824.289/ 0812.1880.0269 4. ASURANSI JIWA The Nielsen Company Rp. 230.000 / Tangki Jl. Sei Mencirim Ujung No. 49/91 - Untuk Mahasiswi & Pegawai Menyediakan Mesin RO dan Yamaha Medan (20121) - Fasilitas AC SEKOLAH TINGGI AKADEMI TEKNOLOGI Tuliskan kode: INT-MDN di sudut kiri atas amplop lamaran dan pada surat lamaran. Surat lamaran diterima paling lambat 27 Agustus2009 - ±10 menit ke Pusat Pendidikan & Perkantoran Hubungi: CV. HYDRO UTAMA Jl. Kapt. Muslim No. 53-d Medan Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Tgl. 15 Agustus ‘09 Pkl. 22.30 Wib (Live) TEKNOLOGI IMMANUEL INDUSTRI IMMANUAL “PT. THE NIELSEN COMPANY tidak memiliki anak perusahaan dan tidak memiliki afiliasi dengan perusahaan manapun di Indonesia” SMS ke: (061) 7741.1010 Telp. (061) 8457879 / (061) 77839790 HP. 0812 600 5410 Call Center: 0818 090 73481 MEDAN (S1) SK. MENDIKNAS NO. 29/D/0/1998 Pengobatan Alat Vital H. Suhendar LOWONGAN KERJA TERAKREDITASI OLEH BADAN AKREDITASI DI MALAYSIA JL. KARYA AMAL MEDAN JOHOR FD Menerima NASIONAL PERGURUAN TINGGI DIPERLUKAN SEGERA 300 ORANG OPERATOR WANITA UNTUK KILANG: Mahasiswa Baru/ Pindahan NO: 001/BAN-PT/AK-VI/DPL-III/VI/2006 1. SUMITOMO (SMIED) SDN. BHD - PENANG CD T.A. 2009/ 2010 2. FINISAR SDN. BHD - IPOH Besar dan panjang di tempat Klinik H. Suhendar di bawah DENGAN NILAI PRINGKAT “B” 3. ST. MICRO - MUAR, JOHOR Tidak ada hasil, Mahar kembali kontrol dan pengawasan langsung TERAKREDITASI MENERIMA MAHASISWA BARU PERSYARATAN UMUM: KIRIMKAN... Ditangani secara profesional H. SUHENDAR NO: 012/BAN-PT/AK-X/51/VI/2007 1. WANITA, UMUR 18 - 27 THN Alami bukan suntik, menggunakan TA. 2009/2010 2. PENDIDIKAN MIN. SLTA DATA IKLAN ANDA metode terapi dan ramuan tradisional, Diberitahukan kepada masyarakat PROGRAM STUDI: 3. KONTRAK MIN. 2 TAHUN Hunian Asri, Nyaman & Strategis untuk berhati-hati terhadap pengobatan PROGRAM STUDI: 4. IZIN ORANG TUA - Type 60/ 108 dan Tipe 65/ 126 DALAM BENTUK Paling aman tidak ada efek samping H. Suhendar sudah di kenal sebagai pakar sejenis yang mengaku-ngaku kerabat 1.TEKNIK MESIN (S1) 1. TEK. MESIN OTOMOTIF 5. SANGGUP BIAYA PENEMPATAN - DP Dapat dicicil, Bisa KPR 2.TEKNIK ELEKTRO (S1) 2. TEK. ELEKTRONIKA PENDAFTARAN MEMBAWA: 1. COPY KTP 2. COPY IJAZAH 3. COPY KK 2 LBR 2 LBR 2 LBR - SHM, Listrik, PDAM - Bonus 1 buah AC untuk pembelian di Bulan Agustus DHARMA MUDA UTAMA PROPERTI DIGITAL Keterangan lebih kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang (garansi), meningkatkan atau saudara, soal cara boleh sama tapi keahlian yang membedakan Untuk keluhan dan pengaduan silahkan SARANA PRAKTEK TERLENGKAP 3. TEK. INFORMATIKA KOMPUTER 4. PASFOTO 3X4 (WARNA) 2 LBR Contact Person: M. ZULFAN (061) 9137.9033 lengkap silahkan kekerasan, tambah kuat dan tahan lama Mahar Rp. 500 ribu hubungi langsung: DEDI (061) 7675.0611 hubungi: H. SUHENDAR HP. 0812.131.6364 Informasi dan Pendaftaran KEPADA: dalam berhubungan Jl. Tempuling No. 43 B - Serdang SEMUA ALUMNI SUDAH BEKERJA PT. TIMURAYA JAYA LESTARI KAMPUS JL. AH. NASUTION, RUKO TENAGA ASRI NO. 1 SP. POS TANAH TELPON : 061 - 4576602 (masuk Gg. Sado) Medan Telp. (061) 663.4220 PD. BULAN - MEDAN (BLKG BANK MANDIRI) DIJUAL Jl. Gatot Subroto No. 325 Medan KAMPUS: JL. GATOT SUBROTO 325 TELP: (061) 822.7419 Kebuh Sawit 9 Ha dan 4 Ha, 30 menit FAX : 061 - 4561347 Saksikan !!! Telp. 456.9548 - 457.3158 TELP: 456.9548 - 457.3158 - 456.2329 PERTANYAAN DAN PENDAFTARAN SEMENTARA DAPAT dari Rantau Prapat buah besar, terawat Hub. 0813.7006.6619 - 0811.656.728 - * Format: JPG - TIFF (Photoshop) Interaktif bersama Bpk. H. SUHENDAR di TVRI Nasional Medan. Setiap Sabtu MELALUI SMS KE: 0812.6035.7181 - 0813.6100.3033 Fax. 415.4154 FAX: 415.4154 KETIK: NAMA, TMP TGL. LHR, PENDD. ALAMAT 0813.7637.7187 Letak Sipare-pare, Kec. Merbau Malam Minggu Pukul 20.00 WIB
  16. 16 Ekonomi & Bisnis WASPADA Kamis 20 Agustus 2009 Sofyan Tan, praktisi usaha kecil Nasionalisme Ekonomi Pebisnis Ramadhan Mulai Dalam Keseharian MENYAMBUT hari be- sar keagamaan, bertepa- tan dengan HUT kemerde- Siapkan Semua Jurus dapat dilawan, per- tama, dengan gera- kan konsumen un- biaya mudik,” kata dia. kaan Indonesia. Sofyan tuk lebih memilih Es yang dijualnya Rp2.500 Tan, tokoh masyarakat dan produk-produk na- per porsi itu akan mengalami mantan ketua presidium sional atau lokal peningkatan penjualan. Forum Nasional Usaha Ke- dibanding produk- “Mungkin orang tahu dari rasa cil Menengah (Fornas produk asing. “Ini ya,” katanya. Dalam satu hari UKM) berujar 10 tahun penerjemahan dia bisa mengantongi Rp75 lagi ke depan (2020), Indo- yang paling kong- ribu hingga Rp100 ribu. nesia akan memasuki era krit dari nasiona- Tapi hanya bisa menjual perdagangan bebas dunia. lisme ekonomi.” jelang berbuka puasa, tutur- “Era perdagangan be- Sayangnya, me- nya. Sebelum Ramadhan dia bas artinya kurang lebih nurut dia, sembo- bebas berjualan dari pk.11.00. seperti ini. Aliran produksi yan cintailah pro- Tapi penjualannya tidak seme- barang dan jasa akan memasuki setiap duk dalam negeri tampaknya kurang riah saat Ramadhan, jelasnya. negara tanpa hambatan tarif maupun gaung. “Media televisi kita misalnya Harapannya di Ramadhan kali non-tarif. Itu berarti para pelaku bisnis hampir tiap hari menjajakan produk- ini pun omset terus mening- akan adu kekuatan dan kecerdikan dalam produk luar negeri. Hanya ada seorang kat. persaingan bisnis internasional,” kata dia. pengusaha nasional yang kerap berpro- “Kita sudah berharap. Mu- Tentu ini ibarat pedang bermata dua. mosi agar masyarakat memakai produk dah-mudahan cuaca juga Dapat menjadi sumber peluang yang elektronik perusahaannya, yang menggu- mendukung,” ucapnya. Rudy menguntungkan, tapi dapat sekaligus nakan tenaga anak bangsanya sendiri.” menyatakan dari penjualan menjadi ancaman serius bagi perekono- “Karena itu gerakan konsumen cinta selama sebulan akan sangat mian suatu negara, jelasnya. produksi dalam negeri, harus dibangkit- membantunya mudik ke kam- Sofyan (foto) berbicara kepada Waspa- kan kembali. Bersamaan dengan itu, juga pung halaman. da di Medan, Rabu (19/8) mengurai bagi harus ada komitmen produsen untuk Karena berjualan menje- negara-negara maju, tentu era pasar bebas menghasilkan barang-barang yang ber- lang berbuka biasanya faktor berarti peluang besar untuk leluasa me- kualitas,” ungkap Sofyan. cuaca tak terlalu berpengaruh masarkan barang dan jasanya menembus Upaya lain untuk menumbuhkan karena pembeli baru bisa batas-batas negara. nasionalisme ekonomi berkaitan dengan menikmatinya selepas magrib, Pasar menjadi terbuka begitu luas. masalah perizinan usaha, ucapnya. “Ba- ucapnya. Rudy yakin setiap “Namun bagi negara seperti kita, dimana nyak keluhan berkaitan dengan birokrasi Ramadhan membawa rezeki pelaku bisnisnya masih lemah, pasar perizinan yang merupakan bentuk tinda- Waspada/Armin Nasution tersendiri buat masing-masing bebas berarti ancaman serius,” jelasnya. kan a-nasionalis seperti dengan cara SAMBUT RAMADHAN: Pedagang di pusat perbelanjaan dan pasar tradisional menyambut Ramadhan dengan berbagai jenis pebisnis. Secara kasat mata, sebenarnya sudah ada mempersulit proses perizinan atau me- dagangan. Mereka berharap omset meningkat di tahun ini. Begitupula dengan pebis- gejala. lakukan pungutan liar.” nis kue kering. Walau permin- “Buah-buahan impor kini menyerbu Bahkan pemerasan terhadap pengu- JAUH sebelum Ramadhan dagang dan pengusaha kecil han’ menyambut Ramadhan madhan dan lebaran tahun taan meningkat hanya saat supermarket di Medan. Supermarket buah saha yang mengakibatkan ekonomi biaya datang, gairah bisnis para pe- seperti kami mendapatkan tidak bisa dinikmati seutuh- ini. ramadhan dan menjelang le- misalnya lebih banyak menjual yang dari tinggi dan menurunnya daya saing, dagang kecil sudah berkobar. omset lebih lumayan.” nya. Sebab pemadaman yang Produk tekstil impor yang baran, tapi bisnis ini menjan- AS, China, Thailand, Selandia Baru dan katanya. Para penjual bunga di tepi ku- Hanya saja kali ini dia me- berlanjut membuat mereka tak membanjiri pasar dalam nege- jikan keuntungan luar biasa Australia dibanding buah dari Berastagi Sementara perlakuan berbeda diberi- buran lebih dulu menikmati rasa ada gangguan yang tak bisa memaksimalkan bisnis. ri mengakibatkan lemahnya besar. Daryati mengaku bisa atau produk dalam negeri,” tegasnya. kan kepada pengusaha dari luar (investor keuntungan. Tiga pekan sebe- bisa diselesaikan. “Pemada- Secara nasional permin- permintaan masyarakat terha- meraup untung bersih Rp5 Pusat-pusat perkulakan ritel juga luar negeri). lum Ramadhan, bunga yang man listrik masih terus ber- taan pasar domestik terhadap dap produk tekstil lokal. Jelas juta dari bisnis yang baru di- sebagian besar kini berisi barang impor, Menarik investor asing untuk mena- mereka jual habis diborong lanjut. Padahal janjinya sudah tekstil dan produk tekstil (TPT) dari sisi harga, produk tekstil mulainya lima tahun lalu ini. kata dia. “Beras impor dari Thailand misal- namkan modalnya di Sumut, memang pengunjung. tidak. Ini bagaimana? Mana lokal menjelang Ramadhan impor jauh lebih murah. Pada- Menurut ibu rumah tang- nya sudah memiliki konsumen sendiri di merupakan salah satu cara untuk me- Bahkan permintaan lebih pertanggungjawaban perusa- dan lebaran 2009 mengalami hal memasuki bulan puasa ga ini, dengan modal Rp2 juta Medan. Demikian juga barang-barang lain ningkatkan pertumbuhan ekonomi. tinggi saat hari Jumat. Sebab pe- haan listrik negara,” tuturnya. kenaikan 10 persen, meski in- maupun menjelang lebaran saja, dia bisa memperoleh semisal susu, snack, permen bahkan Adalah fakta bahwa pengusaha lokal ziarah banyak yang menyem- Menurut dia, pengusaha dustri tersebut masih harus produk impor biasanya mem- keuntungan bersih terbut. Dia sampai kosmetik.” (dalam negeri), ternyata lebih banyak patkan di hari teresbut. Rama- konveksi membutuhkan listrik bersaing dengan produk impor. banjiri pasar. mengatakan pengalaman ta- Kecenderungan seperti ini, tentu dapat menanamkan investasinya di Sumut, di dhan kian dekat. untuk menyelesaikan jahitan. Bagi asosiasi pertekstilan Begitupun mereka masih hun lalu akan berlanjut hingga dimaknai sebagai ancaman daripada tengah iklim perizinan, juga premanisme Geliat pebisnis pun kian “Tidak mungkin mereka me- tren kenaikan permintaan melihat ada peluang besar di sekarang. berkah, tutur Sofyan. Produsen barang yang tidak menguntungkan mereka, terasa. Ketua Asosiasi Pengu- nyelesaikan jahitan dengan produk tekstil, khususnya un- pasar Ramadhan juga lebaran. Menariknya, dia menye- dan jasa terancam begitu juga dengan tegasnya. saha Kecil Industri (APKI) Me- mesin jahit manual,” jelasnya. tuk jenis kain jadi dan kain Bukan hanya Lubis dan pe- diakan 55 jenis kue yang bisa petani. “Pendeknya, era perdagangan be- “Hal ini menarik untuk dicermati. dan Syafrizal Lubis mengata- Lubis berharap masalah ini printing, sudah terasa sekitar ngusaha konveksi yang ber- diantar. Daryati menyediakan bas dapat menjadi sumber ancaman jika Kebijakan pemerintah selama ini sering- kan pebisnis konveksi sudah jangan berlarut-larut. 2 bulan hingga 3 bulan lalu. siap menyambut Ramadhan. kue moka warna, kue kacang tidak segera dilakukan gerakan nasio- kali terkesan lebih memihak investor bersiap-siap menyambut da- “Tolonglah pengertian pe- Selain harus menghadapi Pebisnis lain pun sudah cincin, kue coklat, kue sepe- nalisme ekonomi untuk menyelamat- asing, lewat berbagai kemudahan birok- tangnya bulan suci umat Islam rusahaan listrik memberikan tekanan terbatasnya energi bersiap-siap. Rudy, penjual es kulas daun, kue sukade keri- kannya.” rasi. Ada kesan pengusaha lokal, termasuk itu. suplai yang bisa dinikmati listrik, pengusaha di dalam ne- dawet di Jl. Iskandar Muda Me- ting, kue biji coklat, kue kacang Sebenarnya soal nasionalisme ekono- UKM, kurang disayang pemerintah. Dia memang tidak menye- pengusaha kecil,” tegasnya. geri harus menghadapi deras- dan, akhir pekan lalu, menya- (BTP), kue dahlia nenas, kue mi sudah lama didengungkan pada masa Padahal mereka dalam berbagai situasi, but berapa omset yang akan Lubis menyatakan pengusaha nya arus masuk barang tekstil takan di bulan Ramadhan om- lidah kucing, kue moka gam- Orde Baru dengan istilah cintailah produk tetap melakukan aktivitas,” kata dia. mereka kaut sepanjang bulan konveksi sudah bersiap sebe- impor dari berbagai negara, setnya bisa meningkat hingga bar, dll. dalam negeri, kata dia. Sofyan menegaskan ini hingga Idul Fitri. “Namun lum Ramadhan. terutama tekstil China, ke pa- dua kali. “Hitung-hitungannya ancaman perdagangan bebas sebenarnya * Armin Nasution sudah menjadi kebiasaan pe- Namun ternyata ‘kemeria- sar domestik menjelang Ra- bisa buat nambah-nambah * Armin Nasution Akankah Inflasi Kian Tinggi Semua Stok Bahan Pokok Disiapkan SEMUA mata seakan tertuju pada hari persen pada beberapa komoditas seperti besar keagamaan. Mulai dari pedagang kecil hingga pejabat pemerintah pusat serius memperhatikan gerak-gerik yang ada di pasar. Sebab moment seperti inilah cabai merah, beras, daging ayam ras dam telur ayam ras. Selanjutnya pada kelompok peruma- han, air, listrik, gas dan bahan bakar Antisipasi Kenaikan yang menjadi indikator menilai angka mengalamai inflasi Juni 2006 sebesar 0,10 DIRUT Perum Bulog Mus- inflasi. persen, disebabkan oleh kenaikan harga tafa Abubakar yakin harga be- Setiap tahun selalu dilewati. Namun pada komoditas elpiji. ras tidak akan naik menjelang ada kalanya inflasi mendadak tinggi di Kelompok kesehatan mengalami hari besar keagamaan. Begitu- periode tersebut. Hari besar keagamaan inflasi sebesar 0,40 persen yang disebab- pula hingga akhir tahun. Pe- tahun ini diprediksi berbagai kalangan kan oleh naiknya harga pada sub kelom- merintah memang sudah me- tidak akan mendorong inflasi tinggi. pok obat-obatan dan perawatan jasmani nyiapkan antisipasi sejak awal. Sehingga pemerintah, Bank Indonesia dan kosmetika. Para pedagang dan distri- dan Badan Pusat Statistik (BPS) yakin Selain itu, harga yang ikut mempe- butor sudah diajak diskusi inflasi takkan lebih dari lima persen. Angka ngaruhi IHK adalah sepedamotor naik untuk menjaga agar masyara- itu berlaku secara nasional. Di Sumut, bia- 5,51 persen, ikan kembung/gembung kat tidak makin kesulitan men- sanya selalu lebih rendah dari hitung- 12,98 persen, rokok kretek filter 3,54 per- jelang Ramadhan dan Idul hitungan nasional. sen, upah pembantu rumah tangga 2,04 Fitri. Bahkan di Medan, para Tahun lalu (Januari-Desember), inflasi persen, ikan dencis 7,40 persen, ikan pedagang besar menjanjikan Sumatera Utara mencapai 10,72 persen, tongkol 10,56 persen, teh manis 40 per- ke Disperindag tidak menaik- meningkat dibanding 2007 sebesar 6,60 sen, bawang putih 50,13 persen, daging kan harga. persen. Pada periode tersebut, inflasi Su- ayam ras 2,34 persen. Menneg PPN/Kepala Bap- mut lebih kecil dibanding secara nasional Laju inflasi Sumut cenderung dipe- penas Paskah Suzetta yakin sebesar 11,06 persen. ngaruhi faktor-faktor struktural maupun Ramadhan dan hari raya Idul Di tahun kalender 2007 inflasi nasional tekanan-tekanan (shock) jangka pendek Fitri diperkirakan berpotensi 6,59 persen. Khusus Desember 2008 saja, yang mempengaruhi ketersediaan paso- mendorong tingkat inflasi. inflasi nasional mengalami deflasi 0,04 kan barang di pasar terutama komoditas Namun, hal itu sudah dapat persen. Selama Desember 2008 empat ko- pertanian tanaman pangan yang belum diatasi dengan cara menjaga ta di Sumut yang dihitung Indeks Harga atau tidak dapat dihasilkan sendiri. distribusi barang, katanya. Konsumen (IHK) mengalami inflasi yakni Kontribusi dari pelaku usaha dalam Menurut dia, ada potensi Medan 0,51 persen, Pematangsiantar 0,73 menjalankan aktivitas niaga yang ber- inflasi. Namun distribusi harus persen, Sibolga 1,35 persen dan Padangsi- disiplin pasar dan tidak distortif cukup dijaga sehingga tidak terjadi dimpuan 0,70 persen. Sumut pada Desem- berperan meredam gejolak harga untuk hambatan dalam distribusi ber 2008 mengalami inflasi 0,57 persen. mewujudkan laju inflasi yang terkendali. ataupun mengantisipasi ke- Waspada/Armin Nasution Terjadinya inflasi Desember 2008 Sementara inflasi bulan ini [Agustus] langkaan bahan pokok kon- HARGA: Menjelang hari besar keagamaan harga berbagai kebutuhan mulai meningkat walau pemerintah sudah berkoordinasi menyebabkan laju inflasi tahun kalender walau mendekati puasa dan lebaran, sumsi seperti beras, terigu, dengan distributor dan produsen barang. Pemerintah mentolerir kenaikan hingga lima persen. di empat kota IHK yakni Medan 10,63 per- tingkat inflasi tidak akan terlalu tinggi. gulat, tegasnya. sen, Pematangsiantar 10,16 persen, Sibolga Pengaruh musiman menjelang puasa Dengan begitu potensi si 4,7-4,8 persen. Itu mene- beras pemerintah saat ini rata-rata normal. sehingga pergerakan harga 12,36 persen dan Padangsidimpuan 12,34 yang biasanya diikuti dengan kenaikan inflasi akibat pelaksanaan iba- nangkan pasar dan panen mencapai 1,6 sampai 1,8 juta Persediaan gula sampai atau kondisi persediaan di persen. harga bahan makanan pada tahun ini dah puasa dan lebaran tidak gabah akan terjadi jurtru pada ton dan hal tersebut merupa- dengan akhir Juli 2009 yang pasar bisa cepat diketahui. Inflasi terjadi dipengaruhi adanya ke- lebih terkendali. Itu terbukti dengan akan mengancam pencapaian saat Ramadhan dan lebaran kan angka besar dalam sejarah sebanyak 57.986 ton dari ke- Untuk daging ayam, pro- naikan harga beberapa komoditas seperti stabilnya harga beberapa bahan pokok target inflasi 2009 sebesar 4,5 sekitar Agustus-September. bulog butuhan per bulan yang hanya dusen juga sudah meningkat- cabai merah naik 15,17 persen, emas per- seperti beras . persen. yang akan membuat harga re- Untuk Sumut, produsen 23.000 ton. Begitupula dengan kan produksi hingga 25 persen hiasan naik 6,20 persen, roti manis naik Pengaruh musiman menjelang bulan Pemerintah memproyek- latif stabil. dan distributor sudah menjan- sapi pada akhir Juli mencapai dari biasanya. Dua bulan men- 42,86 persen, ikan dencis naik 8,42 persen, puasa lebih besar terasa jika dibanding sikan harga beras relatif stabil Bahkan dilihat dari faktor jikan kepada Disperindag tak- 10.650 ekor dengan kebutuhan jelang Ramadhan, pengusaha ikan gembung naik 10,54 persen. tarif efek kenaikan harga bahan bakar minyak menjelang bulan puasa. Keya- eksternal internasional akan kan ada kenaikan harga ba- per bulan sebanyak 6.450 ekor. sudah melakukan penetasan angkutan naik 18,21 persen, gula pasir naik (BBM) bersubsidi yang dilakukan peme- kinan ini dengan melihat pe- kebutuhan beras saat ini ting- rang menjelang hari besar ke- Persediaan beras, daging sehingga produksi yang diha- 0,64 peren, kentang naik 8,33 persen, beras rintah Mei tahun lalu. Faktor musiman ningkatan produksi sebesar kat kepanikan masyarakat agamaan. ayam, telur, terigu dan minyak silkan di daerah ini mencapai naik 1,14 persen dan minyak goreng naik menjelang puasa dan Lebaran akan lebih 4,7-4,8 persen yang sudah di- akan kebutuhan beras sudah Sehingga pedagang tak goreng juga sangat memadai. enam juga ekor per bulan. 1,96 persen. dominan pada Agustus dan September, perhitungkan BPS. Selain itu, berkurang. Dan kebutuhan mempunyai alasan menaik- Untuk menekan spekulasi, Stok itu diharapkan dapat Sedangkan Juli tahun ini, Badan Pusat karena efek kenaikan harga BBM telah panen gabah juga jatuh pada serta kesepakatan regional kan harga jual. Disperindag Disperindag Sumut meminta memenuhi kebutuhan Aceh, Statistik (BPS) Sumut mengungkapkan mereda. Untuk skala nasional, inflasi saat Ramadhan dan lebaran Asia seperti Filipina sudah mu- Sumut menegaskan jaminan konsumen tidak melakukan Sumut dan Riau. Proyeksi ke- tetap mengalami inflasi (kemerosotan nilai Indonesia sepanjang 2009 tak akan mele- antara Agustus-September. lai secara bersama-sama men- tidak ada kenaikan harga itu aksi borong. Walaupun sudah naikan kebutuhan ayam tahun uang karena banyaknya yang beredar) wati level 6 persen. Proyeksi untuk mengha- jaga kestabilan beras. disampaikan dalam rapat berusaha semaksimal mung- ini diperkirakan meningkat sebesar 0,68 persen pada bulan Juli 2006, Harga komoditas yang menurun tidak dapi ramadhan dan lebaran Di dalam negeri, pemerin- koordinasi dan itu menjadi pe- kin harga tidak naik, namun maksimal lima persen karena sedangkan Medan inflasi 0,64 persen. lagi menjadi faktor kuat pendorong inflasi beras relatif stabil, soal beras, tah berupaya intensif serta gangan untuk menindak siapa Disperindag Sumut tetap ya- berkurangnya pasokan ikan Angka tersebut, jauh lebih tinggi dari di 2009. Namun pelemahan nilai tukar dalam 4 bulan terakhir harga- membantu para petani dari saja yang memanfaatkan naik- kin peluang itu masih terbuka. dari Aceh masuk ke Sumut. tingkat laju inflasi secara nasional bulan menjadi faktor kuat pendorong inflasi. nya relatif stabil, fluktuasinya sudut produksi, seperti untuk nya permintaan menjelang Sebab permintaan biasanya Hal yang membuat kha- Juli yang berada diangka 0,45 persen. Bank Indonesia sendiri memproyeksikan antara daerah yang satu de- benih dan pasca panen de- Ramadhan mendorong kenaikan harga. watir masyarakat saat ini ada- Untuk inflasi year on year (Juli 2005 kisaran inflasi sepanjang tahun 2009 ngan yang lainnya kira-kira ngan terpalisasi. Tindakan tegas akan dibe- Instansi ini pun memberi lah menyangkut kenaikan har- sampai Juli 2006) di Medan sebesar 17,78 adalah sebesar 5-7 persen dan Bank Indo- hanya 2 persen. Termasuk upaya pada Bu- rikan Disperindag Sumut me- angka toleransi lima persen ga elpiji 12 kg. Sebab menaik- persen, Pematang Siantar 13,68 persen, nesia mengindikasikan inflasi dapat Perkiraan menjelang pua- log menjaga stabilitas beras, ngingat persediaan sembako untuk kenaikan harga lebih kan elpiji menjelang Rama- Sibolga 16,36 persen, Padangsidimpuan berada pada kisaran bawah dari proyeksi sa, beras relatif stabil karena dengan cara membantu peta- di daerah itu mencukupi, ter- dari itu ereka akan bertindak. dhan dan Idul Fitr i bisa 17,97 persen. tersebut. pertama dalam proyeksi BPS ni dan mengembangkan ter- masuk untuk memenuhi per- Dinas ini pun sudah memper- memicu inflasi. Penyebab inflasi di Medan masih pada memperhitungkan bahwa palisasi agar meringankan mintaan yang diperkirakan siapkan Tim Pengawasan Ba- kelompok bahan makanan sebesar 1,24 * Armin Nasution 2008 ada peningkatan produk- beban petani. Diketahui, stok naik hingga 20 persen dari rang dan Harga Disperindag * Armin Nasution
  17. WASPADA Kamis 20 Agustus 2009 Sumatera Utara 17 Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Kota Zhuhur ‘Ashar Magrib ‘Isya Imsak Shubuh Syuruq Medan 12:33 15:58 18:43 19:57 04:51 05:01 06:21 Langsa 12:36 16:01 18:47 20:01 04:52 05:02 06:22 Sabang 12:46 16:11 19:00 20:14 05:00 05:10 06:31 Tarutung 12:32 15:57 18:39 19:53 04:52 05:02 06:23 B. Aceh 12:46 16:11 18:59 20:14 05:00 05:10 06:31 L.Seumawe 12:39 16:04 18:52 20:06 04:54 05:04 06:25 Pandan 12:33 15:58 18:40 19:53 04:54 05:04 06:24 T.Tinggi 12:31 15:56 18:41 19:54 04:49 04:59 06:20 Binjai 12:34 15:59 18:44 19:58 04:51 05:01 06:22 L. Pakam 12:32 15:57 18:42 19:56 04:50 05:00 06:20 Sibolga 12:32 15:58 18:40 19:53 04:53 05:03 06:24 Panyabungan 12:29 15:54 18:35 19:48 04:52 05:02 06:22 Bireuen 12:41 16:06 18:53 20:08 04:56 05:06 06:26 Sei Rampah12:31 15:57 18:42 19:55 04:49 04:59 06:19 Sidikalang 12:34 15:59 18:43 19:56 04:53 05:03 06:23 Teluk Dalam12:36 16:01 18:42 19:55 04:59 05:09 06:29 B. Pidie 12:40 16:06 18:52 20:06 04:56 05:06 06:27 Meulaboh 12:43 16:08 18:54 20:08 05:00 05:10 06:30 Sigli 12:44 16:02 18:44 19:58 04:57 05:07 06:27 Salak 12:34 15:59 18:43 19:56 04:54 05:04 06:24 G. Sitoli 12:37 16:02 18:44 19:57 04:59 05:09 06:29 P.Sidimpuan12:31 15:56 18:37 19:51 04:52 05:02 06:22 Singkil 12:37 16:02 18:44 19:58 04:57 05:07 06:27 Limapuluh 12:30 15:55 18:39 19:53 04:48 04:58 06:19 K. Jahe 12:34 15:59 18:43 19:57 04:52 04:52 06:23 P. Siantar 12:31 15:57 18:40 19:54 04:50 05:00 06:21 Stabat 12:34 15:59 18:44 19:57 04:51 05:01 06:22 Parapat 12:32 15:57 18:40 19:54 04:51 05:01 06:21 Kisaran 12:29 15:55 18:38 19:52 04:48 04:58 06:18 Balige 12:31 15:57 18:39 19:53 04:51 05:01 06:22 Takengon 12:40 16:05 18:52 20:06 04:56 05:06 06:27 GunungTua 12:29 15:54 18:36 19:49 04:51 05:01 06:21 Kutacane 12:36 16:01 18:46 20:00 04:54 05:04 06:25 R. Prapat 12:28 15:53 18:36 19:49 04:49 04:59 06:19 T.Balai 12:29 15:54 18:38 19:51 04:48 04:58 06:18 Sibuhuan 12:29 15:54 18:35 19:48 04:51 05:01 06:21 Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut Tapaktuan 12:39 16:04 18:48 20:02 04:57 05:07 06:28 Lhoksukon 12:38 16:04 18:51 20:05 04:54 05:04 06:24 Cabuli Anak Di Bawah Umur, Empat Pemilik Toko Alat Sopir Asal Tamiang Dibekuk Polisi Olah Raga Diperiksa BESITANG (Waspada): Berbuat tak senonoh terhadap pacar yang berusia masih di bawah umur, Jo, 28, ayah dua orang anak BINJAI (Waspada): Terkait duga- dijual jauh berbeda,. warga Desa Kaloi, Kec. Pulau Tiga, Kab. Aceh Tamiang, terpaksa an korupsi di KONI Binjai, empat Menurut sumber Waspada di mendekam di sel tahanan Polsek Besitang. pemilik toko tempat pembelian kepolisian, masih ada lagi toko tempat Pria yang telah dua kali menikah itu ditahan atas sangkaan alat-alat olah raga yang digunakan pembelian alat-alat olah raga yang mencabuli sang pacar yang masih duduk di kelas I SMK. Perbuatan untuk pengadaan pihak KONI Binjai, akan dipanggil termasuk pihak KONI. tersangka membuat orangtua korban tak terima lantas mela- Rabu (19/8) diperiksa Polresta Binjai. Namun begitupun dalam waktu porkan pria yang bekerja sebagai sopir itu ke Mapolsek Besitang. Keempat pemilik toko masing dekat ini pihak Polresta Binjai akan Tersangka, Jumat (14/8) lalu datang ke Besitang mengendarai masing A dariToko Sudi yang terletak mengetahui siapa yang menjadi mobil L-3000 menemui sekaligus mengajak gadis yang baru di Jalan Sudirman Binjai, R dari Toko menanjak remaja itu pergi ke objek wisata di kawasan Pulau tersangka dalam kasus korupsi di Riang Sport yang terletak di Jalan KONI sebesar Rp 7 miliar lebih. Tiga, Aceh Tamiang. Antara korban dan tersangka baru sat u Sudirman Kecamatan Binjai Kota, bulan menjalin hubungan asmara . Ditambahkan, kini Polresta S dari Toko Binjai Poto dan Ac dari Binjai telah mempersiapkan surat Menerima ajakan sang kekasih, gadis belia itu langsung Kasio tempat penjualan alat alat kepada Gubernur Sumatera Utara menurut. Jo, yang sebelumnya diduga sudah berniat tidak baik mulai beraksi saat keduanya berada di dalam mobil. elektronik. untuk izin pemeriksaan beberapa Tak hanya sampai di situ, pria yang telah berkeluarga itu Hasil pantauan, keempat pemilik orang anggota DPRD Kota Binjai melucuti satu demi satu pakaian gadis itu. Korban mengaku, toko diperiksa secara bergantian dan dicecar 10 pertanyaan. sebagai saksi dalam kasus dugaan awalnya ia mencoba memberontak, tapi ia tak kuasa korupsi di KONI Binjai. membendung. Perbuatan Jo ternyata berlanjut sampai, Minggu Keempat pemilik toko mengaku harga barang yang dijualnnya de- Kapolresta Binjai AKBP Roberts (16/8) sebelum mengantarkan gadis itu pulang ke Besitang. Selamatigahariremajaitupergimeninggalkanrumah,membat ngan yang ada di kuintasi jauh ber- Kennedy ketika dikonfirmasi seputar orangtuanya cemas dan merasa kehilangan. Begitu melihat beda. Mereka juga mengaku, dalam pemeriksaan beberapa pemilik toko putrinya kembali, orangtua korban dengan nada kesal langsung menjual barang ke KONI, mereka tempat pembelian alat-alat olah raga mencecar pertanyaan. Orangtua korban spontan shock dan hanya disuruh menandatangi saja melalui Kasat Reskrima AKP. HM. lantas membuat pengaduan kepada polisi. dan nilai besarnya satu barang yang Taufiq, SE membenarkan. (a04) Kapolsek Besitang AKP H. M. Kosim Sihombing lewat Kanit Reskrim, Ipda Febi Harianto, dikonfirmasi Waspada di ruang kerjanya, Rabu (19/8) menyatakan, pasca pengaduan orangtua korban, Jo, langsung diserahkan keluarganya. Tersangka, lanjut Waspada/ Natar Manalu DPRD Setujui PAPBD dia, dikenakan UU Perlindungan Anak dengan ancaman hukman di atas 7 tahun. (a02) DRAINASE SUMBAT: Drainase jembatan Lae Renun perbatasan Sidikalang-Sumbul, Kabupaten Dairi kerap sumbat terutama saat guyuran hujan. Hal ini sangat mempengaruhi daya tahan konstruksi dan keselamatan Sergai 2009 Menjadi Rp 608,3 M pengguna jalan. Foto direkam, Rabu (19/8). SEI RAMPAH (Waspada): Enam 625 sehingga terdapat surplus sebesar Warga Demo Ke Gedung DPRD Fraksi DPRD Kabupaten Serdang Bedagai dalam pendapat akhirnya Rp 24.454.181.034,57. Fraksi PAN dengan juru bicaranya Penyidik Kejari Stabat STABAT (Waspada): Puluhan warga Kec. Batangserangan dapat menerima dan menyetujui Drs. Sayuti Nur ketika menyampaikan berunjukrasa di gedung DPRD Langkat, Rabu (19/8). Mereka Rancangan Peraturan Daerah (Ran- pendapat akhirnya menyampaikan menuntut agar anggota dewan membuat rekomendasi ke Bupati perda) Perubahan Anggaran Penda- apresiasi kepada Bupati dan jajaran Langkat agar menutup beberapa lokasi Galian C di Kec. patan dan Belanja Daerah (PAPBD) Pemkab Sergai atas berbagai keberha- Batangserangan Kabupaten Sergai tahun 2009 untuk silan yang dicapai selama ini. Peng- Tidak Konsisten Beberapa menit setelah berorasi, perwakilan pengunjukrasa ditetapkan menjadi Perda. hargaan yang telah diperoleh itu me- diperbolehkan berdialog menyampaikan tuntutan di ruang Pendapat akhir keenam fraksi nurut fraksi ini menunjukkan komit- rapat dihadapan beberapa anggota dewan yang menerima, DPRD Sergai yaitu Fraksi Partai Gol- men yang kuat dari Pemkab Sergai salah satunya H. Surianto dari Fraksi Partai Golkar. kar, Fraksi PAN, Fraksi Bulan Bintang dalam memajukan daerah ini menuju Dalam musyawarah itu DPRD Langkat secepatnya mengaju- Reformasi, Fraksi PPP Fraksi Bersatu , kabupaten yang terbaik. kan surat rekomendasi kepada Bupati Langkat agar mempertim- kelengkapan berkas, perlu keterangan Mantan pejabat Depag Langkat STABAT (Waspada): Penyidik dan Fraksi PDIP Sejahtera dibacakan Fraksi PAN dalam pandangannya bangkan dan menutup beberapa lokasi Galian C yang meresahkan lanjutan hingga menunggu keputusan yang sebelumnya pernah beberapa warga. Kejari Stabat tidak konsisten juru bicara masing-masing fraksi da- akhirnya mengemukakan juga bahwa Kajari Stabat Febrie Adriansyah. kali diperiksa penyidik dalam dugaan lamsidangparipurnadewandipimpin tahun 2010 Kabupaten Sergai akan Mendengar pernyataan itu massa membubarkan diri dari dengan penanganan kasus. Salah Sementara Rabu (19/8) siang Kasi kasus korupsi serupa, JS, disebut-sebut gedung dewan dan menuju Kantor Bupati Langkat. Di sana ketua dewan MY. Basrun didamping melaksanakanPilkadasecaralangsung. satu kenyataan terlihat Pidsus Kejari, Firmansyah enggan juga telah berstatus tersangka. Kasi Wakil Ketua Ibrahim Khalil, S.PdI di Menghadapi Pilkada itu, Fraksi PAN pengunjukrasa bersikukuh ingin bertemu langsung dengan Bupati menjelaskan rinci dasar belum dita- Pidsus Kejari beberapa hari silam tidak karena menilai aspirasi mereka lamban ditangani. Namun karena sebagaimana yang dihimpun gedung dewan di Sei Rampah, Rabu mengajak seluruh elemen masyarakat hannya tersangka. ‘’Kita belum tahan,’’ membantah dikatakan JS telah ber- (19/8). untuk menyikapinya dengan penuh Ngogesa Sitepu sedang berada di luar kota, massa akhirnya Waspada, terkait penahanan ujarnya singkat. Selain itu beredar status tersangka, namun tidak juga mengurungkan niatnya dengan bubar. seseorang yang telah berstatus Hadir dalam sidang pengambilan kedewasaan berpolitik, jangan me- kabar di kalangan wartawan status membenarkan karena dia belum me- Tiga pekan sebelumnya masyarakat juga pernah bergelar tersangka. IL sebagai tersangka hanya formalitas nerima laporan dari penyidik lainnya. keputusan Ranperda PAPBD ituWakil ngorbankan tatanan yang sudah kon- orasi serupa di pintu gerbang masuk usaha Galian C di Kec. dan tidak akan ditahan dengan per- Firmansyah kemarin juga memberi Bupati H. Soekirman, Ketua PN Te- dusif selama ini. Batangserangan. (a38) timbangan status tugasnya di bawah komentar kepada wartawan cetak dan bingtinggi Deli Abdul Hutapea SH, Perbedaan pendapat, dukung naungan Depag. terbit di salah satu media harian, JS Plt. Sekdakab Sergai Drs. H. Haris mendukungperludisikapisecarawajar PLN Binjai Salurkan Bantuan Binaan Sebagai contoh awal Juni 2009 pe- nyidik resmi menetapkan IL sebagai Namun kabar itu belum dapat di- tanggapi Kasi Intel Kejari Gloria Sinuhaji telah berstatus tersangka meskipun tidak ditetapkan secara resmi. Fadillah M.Si, Wakapolres Sergai KompolKasdelSitumorang,Danramil dan hindarkan politik adu domba, menebar fitnah serta pembunuhan BINJAI (Waspada): Manajer PLN Cab.Binjai diwakili Asisten tersangka dugaan korupsi penyim- karena sejumlah wartawan yang ber- Selain itu lanjutan penyidikan kasus Sei Rampah Kapten Inf. J. Girsang karakter dan propaganda negatif yang Manajer SDM & Adm Muslim menyerahkan bantuan tambaan pangan bantuan dana pendidikan upaya memintai keterangannya tidak dugaan penyimpangan dana Bansos mewakili Dandim 0204/DS, para tidak sehat dan dapat merugikan orang modal usaha kepada 10 orang mitra binaan PLN Selasa ( 18/ tahun 2008 di Depag Langkat. Namun berhasil. Ketika ditelefon dia menga- senilai Rp30 miliar juga mengambang. anggotaDPRD,pejabatPemkabSergai. lain, tegas Fraksi PAN. 8) di kantor PLN Binjai. hingga pertengahan Agustus tersangka takan sedang rapat dan ketika berkun- Hingga kini penyidik tidak dapat Perubahan APBD tahun 2009 Pada kesempatan itu seluruh Manajer PLN Binjai Ir. Pintor Rumapea diwakili Asisten SDM/ belum juga ditahan. Seiring dengan jung ke kantornya, honorer di sana menerangkan juga mempublikasikan yang diajukan Bupati Sergai HT. Erry enam fraksi yang ada di DPRD Sergai, ADM Muslim mengemukakan bantuan dana mitra binaan itu berbagai alasan dikemukakan pe- mengatakan Kasi intel sedang sibuk hasil pemeriksaan 23 Camat dalam Nuradi pada tanggal 13 Agustus 2009 banyak tamu. dugaan kasus itu. (a38) seluruhnya memuji tentang keberha- disalurkan melalui program kemitraan bina lingkungan (PKBL) nyidik, di antaranya menunggu lalu dan disetujui untuk ditetapkan silan pembangunan di Disdik Sergai untuk semester I tahun 2009 berjumlah Rp. 72 juta. Bantuan menjadi Perda Kabupaten Sergai modal usaha merupakan kepedulian pemerintah melalui PLN kepada lingkungan masyarakat ekonomi kecil guna mengem- Saksi Konsultan Mengaku Tidak Tahu Fungsi Tugasnya terdiri dari pos pendapatan pada APBD induk sebesar Rp 596.875. di bawah kepemimpinan Bupati HT Erry Nuradi. Selain bidang pendidikan, bangkan usaha. 492.248 berubah menjadi Rp 608.363. bidanglainnyajugaberlangsungsangat STABAT (Waspada): Saksi Amran lumnya puluhan kepala sekolah yang Karena itu saksi Amran meminjam MuslimdidampingiHumasPLNBinjaiSafwanWajdiberharap yang dihadirkan JPU dalam sidang telah dihadirkan mengakui diminta 079.689,36 atau bertambah Rp baik dan memuaskan. perusahaan rekannya untuk mem- bantuan modal usaha kepada mitra penggunaannya harus positif, lanjutan korupsi perkara DAK di PN pihak konsultan untuk membuat lapo- 11.487.587.441,36 sedangkan pos Usai pengambilan keputusan sehingga dapat mengembalikan dengan tempo 24 bulan. Bantuan buat denah perehaban sekolah. Stabat mengaku tidak tahu fungsi ran akhir. Bukan kepala sekolah yang belanja pada APBD induk sebesar Rp DPRD atas Perda PAPBD 2009, Wakil itu akan disalurkan lagi kepada mitra binaan PLN pada semester Dia juga mengakui belum meneri- tugasnya, Rabu (19/8). meminta. 621.645.922.623 berubah menjadi Rp BupatiSergaiH.Soekirmandalamsam- II Desember 2009. Asisten Manajer SDM/ADM Muslim juga ma uang hasil kerjanya dan menilai Dia yang berprofesi sebagai kon- Keterangan saksi Amran menurut 632.817.260.723,93 atau bertambah butannya menyampaikan ucapan berharap mitra kerja PLN mengajak masyarakat hemat listrik proses penyaluran DAK penuh kejang- sultan mengakui tidak ada kontrak majelis bertolakbelakang dengan kete- Rp 11.171.338.100,39. terima kasih eksekutif kepada seluruh dan membayar rekening listrik tepat waktu. (a03) kerja dengan pihak Dinas P Dan P Ha- . rangan puluhan kepala sekolah sebe- galan. Akhirnya sidang agenda men- dengarkan keterangan saksi dari pihak Sementara pada pos pembiayaan anggota Dewan yang secara bersama- nya diamanahkan mensurvei gedung lumnya. Selain itu saksi menuturkan pada PAPBD yang disetujui yaitu sama telah bekerja keras memberikan SD yang akan direhab kemudian di- dalam proses penetapan rekanan un- konsultan dinyatakan majelis hakim ditutup dan dilanjutkan Jumat (21/ penerimaan sebesar Rp 55.683.750. pandangan untuk kemajuan Kabu- minta kepala sekolah membuatkan tuk membidangi perehaban sekolah 659,57danpengeluaranRp31.229.569. 8) masih mendengarkan keterangan paten Sergai. (a07) laporan akhir pertanggungjawaban. dasar, tidak melalui proses tender dan Padahal kata majelis hakim, sebe- hanya ditunjuk pihak Dinas P Dan P . saksi lainnya. (a38) Ayah Cabuli Anak Kandung Nyaris Dihajar Massa TEBINGTINGGI (Waspada): Se- berusaha menenangkan massa dengan selaput dara korban mengalami luka orang ayah tega mencabuli anak kan- segeradiamenghubungipetugasPolres- robek. dungnya sendiri yang masih berusia ta Tebingtinggi. Berselang beberapa Tersangka berisitri empat yang di bawah umur. Peristiwa yang mema- saat petugas datang dan memboyong semuanya sudah almarhum ini dijerat Waspada/ Riswan Rika lukan terungkap saat korban mence- tersangka ke Mapolresta Tebingtinggi melanggar pasal 82 UU RI No. 23 tahun MODAL USAHA: Asisten Manajer SDM/ADM Muslim ritakan apa yang dialaminya kepada guna proses penyelidikan lebih lanjut. 2002 tentang perlindungan anak dan menyerahkan bantuan modal usaha kepada seorang mitra tetangganya, Rabu (19/8) pagi. Dalam pemeriksaan petugas pasal 294 ayat 1 dari KUHPidana de- binaan Ahmad, Selasa (18/8). Spontan tetangga korban berang, tersangka terkesan memberikan selanjutnya bersama warga mendatangi keterangan berbelit-belit. Tersangka ngan ancaman hukuman lima belas tahun penjara. Hasil Lomba Lukis Kemerdekaan kediaman ayah badau itu di Ling. III, Kel. Bandar Sakti, Kec. Bajenis, Kota mengaku belum sempat mencabuli anaknya, namun baru mencoba men- Sementara itu, menurut Dewi, Tebingtinggi.Warga yang tengah dibakar cabuli anaknya sebanyak tiga kali. Walau tetangga korban, ia baru mengetahui BINJAI (Waspada): Memeriahkan HUT ke-64 RI, HISSRI korban dinodai ayah kandungnya sen- Kota Binjai melaksanakan lomba lukis antar pelajar. emosi nyaris menghajar tersangka MY. tersangka belum mengakui perbua- Kepala Lingkungan III, Indra Putra tannya, petugas tetap melakukan pena- diri ketika mereka membujuk korban Ketua HISSRI Binjai Ahmad Darbi Harahap menjelaskan lomba diikuti 71 pelajar SD, SMP SMA, SMK. Pemenang tingkatSD , Saragih mencegah dan mengamankan hanan, karena sesuai hasil otopsi di untuk menceritakan perlakuan yang Waspada/Riswan Rika I. Erza (SD Methodis), II. Hambali ( SD 020267) dan III. Ulfa tersangka dari amukan massa. Sambil Rumah Sakit BhayangkaraTebingtinggi, ia alami dari ayahnya sendiri. (a09) PEMENANG: Para ahli waris Asuransi Sipanda dan pemenang undian Dwi Amalia ( SD 020255). SMP juara I. Mhd. FadlyTanjung (SMPN tabungan Martabe Bank Sumut, Jumat (14/8). II),II. Daniel T ( SMP AhmadYani) dan III. Melyana ( SMP Ahmad Kabag Humas Tanjungbalai Terima Satya Lencana Yani). Tingkat SMA/SMK juara I Dimas Ardianto ( SMK 2) II. Suci Lestari ( SMA Ahmad Yani) dan III. Nana ( SMA 2 ). Pemenang TANJUNGBALAI ( Waspada) : Bank Sumut Binjai Serahkan Asuransi Kepala Bagian Hubungan Masyarakat lomba menerima hadiah pada acara penurunan bendera Senin ( 17/8) di Lapangan Merdeka Binjai. (a03) Setdakot Tanjungbalai, Darul Yana Siregar, menerima penghargaan Satya Sipanda Dan Hadiah Martabe Lencana 10 tahun dari Presiden Susilo BINJAI (Waspada): Pimpinan nang tabungan Martabe priode I / LPJ–APBD Langkat Disahkan Bambang Yudhoyono. Piagam penghargaan itu, diserah- PT Bank Sumut Cabang Binjai Syah- mirdan Siregar, SE menyerahkan 2009 yang penarikannya di Lubuk Pakam, Deliserdang. TV 29 inci dise- STABAT (Waspada): Sidang paripurna DPRD Langkat yang kan olehWalikota Tanjungbalai Sutris- asuransi Sipanda dan hadiah tabu- rahkan kepada Rosmianur Saragih, dipimpin ketuanya H. Syafruddin Basyir di Stabat, Selasa (18/ no Hadi pada upacara penurunan ngan Martabe, Jumat (14/8). Ratna Elwani, Kasim Bolot dan Nur- 8) sore, dapat menerima laporan pertanggung jawaban (LPJ) bendera Merah Putih di Lapangan Penyerahan asuransi oleh Bank mi,SH. Hadiah Lemari es diperoleh Bupati terhadap APBD Langkat Tahun 2008 . Sultan Abdul Jalil Rahmadsyah, Senin Sumut Cab. Binjai kepada tiga ahli Herianto, Risma Munthe, Martin dan Bupati Langkat Ngogesa Sitepu dalam kesempatan itu (17/8). Hadir di sana, Letkol Laut (P) Ad- waris, yaitu Alm Teguh Ginting me- Hj. Martua Br Manik yang semuanya mengemukakan, proses LPJ merupakan amanat konstitusi ini nerima Rp500.000. Alm.Mula Sem- nasabah Bank Sumut Cabang Binjai telah menyita waktu, tenaga dan pikiran untuk menyelesaikan riansyah, Kapolres Tanjungbalai AKBP Mestron Siboro,WakilWalikota Tham- biring dan Balas Ginting masing- Syahmirdan juga menjelaskan berbagai tahapannya. Dengan prinsip akuntabilitas dan transpa- masing Rp250.000. Syahmirdan bank Sumut cabang Binjai kini sudah ransi serta semangat good governance akhirnya pembahasan rin Munte, Sekdako Darwin Zulad dan seluruh pimpinan SKPD dan staf serta Waspada/Rahmad F Siregar didampingi Wakil Pincab Hotman membuka kantor payment point di LPJ ini dapat diselesaikan dengan sebaik-baiknya. Berbagai kritik SATYA LENCANA: Kabag Humas Setdakot Tanjungbalai, Dra Darul Yana PNS di lingkungan PemkoTanjungbalai Marpaung, Pimpinan seksi pelaya- kantor KPP Pratama Binjai, sehingga dan saran akan dijadikan masukan yang berharga yang akan Siregar, menerima penghargaan Satya Lencana 10 tahun dari Presiden SBY. segera ditindaklanjuti guna memperbaiki kinerja aparat Pemkab bersama unsur muspida. nan Nasabah Nurlayla Hasibuan masyarakat sudah dapat menyetor Penghargaan itu diserahkan melalui Walikota Tanjungbalai Sutrisno Hadi, dan Pimpinan Operasional Tri Jaya pajak di Bank Sumut cabang Binjai. Langkat, ujar bupati. Selain penyerahan Satya Lencana, pada upacara penurunan Bendera Merah Putih di Lapangan Sultan Abdul menjelaskan Asuransi Sipanda di- Ketua DPRD Binjai H.Haris Sebelumnya 6 Fraksi di DPRD Langkat menyampaikan dalam peringatan HUT ke 64 RI, Pemko Jalil Rahmadsyah, Senin (17/8). pandangannya menyoroti berbagai hal terutama terkait kinerja Tanjungbalai juga menggelar berbagai berlakukan sejak Januari 2004, sudah Harto mengakui keikutsertaan bank SKPD yang dinilai masih belum optimal, serta masih besarnya kegiatan, di antaranya ramah tamah suci di Taman Makam Pahlawan. Taman Makam Pahlawan, upacara 135 ahli waris menerima asuransi Sumut kepada pemerintah cukup jumlah anggaran APBD yang belum dapat terealisasi dalam dengan veteran dan janda veteran di Kemudian, melepas atau menga- peringatan detik-detik proklamasi, dengan nilai Rp. 617.750.000. baik. Dengan pelayanan yang terus pembangunan. Kritikan juga tidak terlepas rendahnya PAD yang pendopo rumah dinas Walikota Tan- rak Bendera Pusaka dari eks kantor defile dan karnaval serta resepsi HUT Pada penyerahan asuransi Si- ditingkatkan, sebab nasabah Bank akibatnya belum dapat secara maksimal dalam menopang jungbalai, pengukuhan Paskibra, pawai Walikota menuju Lapangan Sultan ke-64 RI di pendopo Rumah Dinas panda, Bank Sumut cabang Binjai Sumut otomatis turut membangun pembangunan daerah ini. (a01) obor, apel kehormatan dan renungan Abdul Jalil Rahmadsyah, ziarah di Walikota Tanjungbalai. (a37) juga menyerahkan hadiah peme- Kota Binjai. (a03)
  18. 18 Sumatera Utara WASPADA Kamis 20 Agustus 2009 Inalum Serahkan Pinjaman Modal Bergulir Pada UKM Pangdam I/BB Pantau Keamanan TANJUNGGADING (Waspada):PT Inalum Kualatanjung Batubara menyerahkan bantuan pinjaman modal bergulir kepada Asahan Dan T. Balai Usaha Kecil Mikro (UKM) di gedung MPH Tanjunggading KISARAN (Waspada) : Pangdam I/BB dari hal-hal yang tidak kita inginkan,” ujar Kecamatan Seisuka, Selasa (18/8). Mayjen Burhanudin Amin adakan kunjungan Busatami. Direktur Umum dan SDM PT Inalum, H. Nasril Kamaruddin, kerja di Makodim 0208/AS dengan tujuan me- Sementar Bupati Asahan Risuddin melalui dalam sambutannya mengatakan, kegiatan ini merupakan mantau tingkat keamanan di wilayah itu, terkait Kabag Humas Rahmad Hidayat Siregar yang program Inalum guna pemberdayaan usaha kecil yang berbasis tertangkapnya imigran gelap yang masuk di ikut mendampingi Pangdam I/BB mengharap- masyarakat. wilayah Asahan dan sekitarnya melalui jalur kan dengan adanya kunjungan ini, dapat me- Bantuan diberikan kepada 38 UKM berasal dari seluruh pantai dan dermaga-dermaga kecil yang ada ningkat keamanan di titik-titik pantai dan kecamatan yang ada di Batubara. Jumlah keseluruhan pinjaman di wilayah Asahan dan Kota Tanjungbalai. dermaga yang dianggap rawan masuknya imi- modal Rp 173,5 juta. Jumlah ini meningkat dari tahun sebelumnya “ Kami hanya jalan-jalan sekaligus me- gran gelap dan penyelundupan. yang berjumlah Rp 66 juta. Menurut Nasril, peningkatan jumlah mantau tingkat kemanan yang ada di wilayah “Wilayah Asahan banyak titik rawan masuk- pinjaman modal ini mengingat tingkat pengembaliannya cukup Asahan dan sekitarnya,” jelas Pangdam I/BB nya imigran gelap, oleh sebab itu, warga setem- tinggi, mencapai 90 persen. melalui Asintel Kasdam I/BB Letkol Inf. Gustav pat dan muspida daerah berkordinasi dengan Program pemberdayaan UKM yang terdiri dari pelatihan, kepada Waspada, Rabu, (19/8). pihak terkait dalam menjaga kemanan pantai pembinaan, pendampingan dan bantuan modal bergulir dari Oleh sebab itu, kunjungan ini untuk me- dan dermaga,” kata Dayat, sambil mengatakan, Inalum ini dimaksudkan untuk mendorong peningkatan efektifitas mantau titik rawan pantai yang ada di wilayah Pemkab Asahan menyabut baik kunjungan ekonomi riil masyarakat dan pemuda di daerah sekitar perusahaan ini, ujar Nasril. Asahan dan Kota Tanjungbalai. “ Kita akan Pangdam I/BB. Hadir dalam acara penyerahan itu Bupati Batubara, Kadis tingkatkan kewaspadaan terhadap stuasi yang Pantauan Waspada, selain Assintel Kasdam Perindagkop dan UKM Aguslan S, camat, kepala desa dan pengurus berkembang saat ini, sehingga imigran gelap I/BB Letkol Inf. Gustav, Pangdam I /BB didam- KNPI terkait. (a25/a31) yang datang atau hal-hal yang tidak kita inginkan pingiWaaspers Letkol Inf. Roosdi S, dan Danden dapat diketahui dan diamankan secepatnya,” Intel Kodam I/BB Mayor CZI. A Rizal Ramdani, jelas Gustav. dan kedatangan mereka disambut Dandim Rp 240 Juta Dana CSR PT Senada dengan hal itu, Ketua DPRD Kabu- 0208/AS Letkol Inf. Herry Cristianto, beserta paten Asahan Bustami HS, mengucapkan Bupati Asahan Risuddin, Ketua DPRD Bustami Socfindo Direalisasikan MENYAMBUT: Pangdam I /BB Mayjen Burhanudin Amin beserta rombongan disambut Ketua Waspada/Sapriadi ribuan terima kasih atas kunjungn Pangdam HS,Waka Polres Kompol Donald Happy Ginting DPRD Asahan Bustami HS dan Sekdakab Batubara Sofian di Makodim 0208/AS, kunjungan beserta rombongan, karena menurutnya, de- Sekdakab Batubara Sofiyan, MM. LIMAPULUH (Waspada): PT Socfindo Kebun Tanahgambus, Kecamatan Limapuluh, Batubara selama 2009 ini telah merea- ini bertujuan untuk meninjau titik rawan di jalur pantai dan dermaga yang ada diwilayah ngan adanya kunjungan itu, keamana di wilayah Kunjungan Pangdam I/BB beserta rombo- lisasikan Rp 240 juta lebih dana corporate social responsibil- Asahan dan Kota Tanjungbalai. Foto direkam, Rabu (19/8). Asahan dan sekitarnya dapat terjaga. ngan dimulai dengan meninjau pesisir pantai ity (CSR). “Wilayah Asahan dan sekitarnya banyak Silau Laut di Kec. Silau Laut kemudian berlanjut Pengurus Kebun Tanahgambus H Danang Bayu S melalui ditemui pantai-pantai dan banyak dermaga di Pelabuhan Panton Bagan, Kab. Asahan, serta Korban Demam Berdarah staf H Samali di sela-sela kegiatan HUT RI, Senin (17/8) kepada tikus, dengan demikian, harus diharapkan ada- Pelabuhan Teluk Nibung, Kota Tanjungbalai. Waspada mengatakan, dana tanggung jawab sosial perusahaan nya tingkat pengamanan di wilayah tersebut (csap) ini direalisasikan melalui bantuan pembangunan pada desa- desa di sekitar perusahaan PMA ini. Unjuk Rasa Kepsek Diprotes Di T. Balai Terus Bertambah Di antaranya, prasarana pendidikan, jalan, rumah ibadah serta melalui penjualan minyak goreng murah. Perusahaan milik pengusaha Belgia ini langsung mengerjakan pembangunan bantuan LIMAPULUH (Waspada): Unjuk rasa kepala tuk tidak ikut-ikutan berunjuk rasa sebab ber- itu. ‘’Kita tidak menyerahkan bantuan uang, tapi langsung dalam sekolah mengatasnamakan PGRI ke DPRD dampak terhadap kinerja yang diemban seharus- bentuk bangunan. Apakah jalan, sekolah atau perbaikan rumah Batubara mendapat protes dari pengurus dan nya menjadi tauladan bagi anak didik disekolah. ibadah,’’ ujar Samali. menilai aksi ilegal karena tanpa persetujuan “Setahu kita jabatan kepsek hanya tugas TANJUNGBALAI (Waspada): tepat sekira pukul 14:00, korban wasnya pasien dengue encepha- pengurus. tambahan sebagaimana pedoman dalam Kep- Samali mengatakan, dana CSR dari Socfindo ini dari tahun meninggal dihadapan spesialis lopathy atau demam berdarah ke tahun terus meningkat jumlahnya.’’ Ke depan kita juga berharap Korban demam berdarah “Kami menilai unjuk rasa kepsek mempro- mendiknas”,ujarnya sembari menambahkan anak dr. Purnama Fitri, keluarga itu serta masuknya 3 pasien baru. tes pemutasian mengatasnamakan Korps PGRI bagi rekan anggota dewan untuk tidak terjebak dana CSR ini akan terus meningkat, ‘’ ujarnya. (a25/a31) dengue di Kota Tanjungbalai dan paramedis. Sementara, Bidang Kese- ilegal karena tanpa persetujuan pengurus seba- atau ikut-ikutan bermain demi menjaga kekon- kembali mengambil korban. Meningkat hatan Masyarakat Dinkes Tan- gaimana disampaikan ke dewan,” sebut Ketua dusifan pada kabupaten baru dimekarkan Mengurus IPHI Merupakan Ibadah Selain meninggal, sedikitnya 3 pasien demam berdarah baru jung Balai, menggelar fogging atau pengasapan di sejumlah Fraksi PDIP DPRD Batubara, Ir. Zahir kepada tersebut. Waspada, Rabu (19/8). Suatu kewajaran bagi wakil rakyat itu mene- RANTAUPRAPAT (Waspada): HT.Milwan, Ketua IPHI Kabu- Rahmat, 1 bulan, warga Ke- dirawat intensif di RSUD Tan- wilayah yang dianggap rawan Penilaian itu sehubungan adanya pernya- rima setiap aspirasi yang disampaikan, namun paten L.Batu menjelaskan, mengurus IPHI dapat dijadikan jalan lurahan Pulo Simardan Gg jungbalai. Ketiga pasien itu, penyebaran nyamuk demam taan tertulis dari pengurus PGRI Kab. Batubara hendaknya dilakukan secara bersama-sama baginya untuk melaksanakan ibadah. Rambutan, Kecamatan Datuk Nova Emelia Lubis, 26, warga berdarah. Salah satu lokasi yang masing-masing,Syawaluddin, Zainal Alwi (Wakil supaya dapat diakomodir. HT.Milwan menyatakan hal ini dalam pengajian bulanan Bandar Timur, meninggal akibat Jalan Teuku Umar, Kec Tanjung- difogging yakni sekolah di Jalan Ketua) dan Sekretaris, Zulkifli MT yang disam- Komisi Mana angota pengurus IPHI L.Batu yang berlangsung di kediaman dengue encephalopathy atau balai Selatan, Rizki, 14, warga Imam Bonjol, Kel Tanjungbalai paikan melalui delegasi ke Komisi A DPRD Ketua Komisi A DPRD Batubara, Sahari HT.Milwan di Rantauprapat, pekan lalu. Jelasnya Milwan bersama demam berdarah, setelah dira- Jalan DI Panjaitan, Kel Pasar Selatan. Batubara, Selasa (18/8). Zakaria, SH menyatakan, persoalan Kepsek keluarganya ingin membantu kaum duafa yang ada di L.Batu. wat beberapa jam di ruang anak Baru, Kec Sei Tualang Raso, dan Hasil penelusuran Waspa- “Mereka secara tegas menilai aksi kepsek kini ditangani Komisi C, sebab Komisi A selaku Harta ataupun rezeki yang ia peroleh dapat juga dinikmati kaum RSUD Tanjungbalai, Rabu (19/ Medani Marpaung, 28, warga da, dengan masuknya 3 pasien yang membawa atau mengatasnamakan Korps membidangi Kepegawaian dan Aparatur Dae- duafa dan anak yatim. 8). Jalan Tugu, Kelurahan TB Kota baru ditambah 1 meninggal, rah pada hari H demo secara kebetulan sedang PGRI adalah ilegal,” katanya lagi mengutip isi melakukan kunjungan kerja menemui Konjend Pada akhir sambutannya Milwan bersama keluarga menyata- Informasi dihimpun Was- II, Kecamatan Tanjungbalai maka terhitung sejak Januari dari pernyataan pengurus organisasi dimaksud. pada, korban dibawa keluarga- Selatan. sampai Agustus 2009, jumlah Malaysia di Medan membantu kasus Husein kan mohon maaf atas kesalahan selama ini sehingga kita sudah Anggota Komisi A ini mengaku siapa pun Sitorus seorang warga Batubara yang divonis sama-sama bersih melaksanakan ibadah puasa di bulan Ramadhan nya ke rumah sakit dalam kon- Direktur RSUDTanjungbalai pasien demam berdarah yang mempunyai hak untuk menyampaikan penda- disi sangat kritis dan pendarahan Diah Retno melalui Humas dirawat di RSUD Tanjungbalai hukuman gantung di Malaysia. 1430H. pat/aspirasi baik melalui organisasi atau lem- “Ini sebagai langkah darurat mereka laku- Drs.H.Ramlan Ritonga Wakil Ketua IPHI L.Batu menyatakan di hidung. Setelah dirawat sela- Cosmas Siagian dikonfirmasi sebanyak 271 orang, 4 di antara- baga maupun perorangan, namun hendaknya ma kurang lebih 6 jam, akhirnya kan, namun dikembalikan lagi kepada pimpinan berkat kesungguhan dengan penuh keikhlasan HT.Milwan bersama Waspada, membenarkan te- nya meninggal dunia. (a37) melalui mekanisme musyawarah bila melalui dewan untuk selanjutnya memilih komisi mana Hj.Adelina Milwan sehingga setiap bulannya dapat terlaksananya organisasi/lembaga sehingga tidak berimplikasi yang sebenarnya berwenang menangani per- pengajian dalam bentuk ceramah. (c07) Kondisi Bocah Gizi Buruk Asal seperti ini. Kepala sekolah maupun guru pintanya un- soalan kepsek,” kata anggota dewan berasal dari PDK itu. (a11) Amar Hamdani Hasibuan Asahan Mulai Membaik Guru SD Gelapkan Uang Arisan Disidang Pimpin IPHI Rantau Utara TANJUNGBALAI (Waspa- da) : Kondisi bocah gizi buruk Selain itu, katanya, pasien juga diberikan asupan makanan min lainnya. Sebelumnya, Reza Aster, LABUHANBATU (Waspada): Seorang guru Pasar Lama, Gg Cahaya, Kelurahan Padang RANTAUPRAPAT (Waspada): Ketua DPD Ikatan Persaudaraan asal Kabupaten Asahan yang bergizi seperti susu dan Maka- bocah berusia 1,6 tahun, dibawa SD yang selama ini mengajar di SD V Rantau- Bulan, Kecamatan Rantau Utara, Labuhanbatu, Haji Indonesia (IPHI) Kabupaten L.Batu HT.Milwan didampingi dirawat di RSUD Tanjungbalai, nan Pengganti ASI berupa bis- orang tuanya ke Instalasi Gawat prapat Kec. Rantau Utara Kab. Labuhanbatu diancam pidana dalam pasal 372 KUHP atau , Sekretaris HM. Sofyan MA, melantik H.Amar Hamdani Hasibuan, mulai membaik. kuit susu ditambah lagi dengan Darurat RSUD Tanjungbalai, tersandung kasus penggelapan uang jula-jula kedua pada pasal 378 KUHP dengan ancaman , menjadi ketua IPHI Kecamatan Rantau Utara 2009-2014 di Masjid Bocah itu, Reza Aster, usia mineral mix. Jumat (14/8). Hasil pemerik- disidang di PN Rantauprapat, Selasa (18/8). pidana 5 tahun penjara. Uswatun Hasanah Padang Matinggi, Rantau Prapat, sabtu (15/ 1,6 tahun, anak dari pasangan “ Dibandingkan dengan saan, ternyata bocah itu mengi- Guru SD yang duduk di kursi pesakitan itu Seusai JPU membacakan dakwaan, Pena- 8). Rinaldi, 34, dan Milawati, 24, kondisinya ketika pertama kali dap gizi buruk dengan kom- didakwa melakukan penggelapan uang sehat Hukum terdakwa memohon kepada maje- Di antara ratusan jamaah muslimin dan muslimat yang hadir warga Desa Sijawi-jawi, Keca- masuk kemari, ya sudah sangat plikasi diare. Selain itu, berat puluhan juta yang diperoleh dari ibu rumah lis hakim agar mengalihkan penahanan terdakwa terlihat ketua Tim Penggerak PKK L.Batu Hj.Adelina Milwan, matan Sei Kepayang. jauh berbeda, saat ini aja berat badannya juga hanya mencapai tangga dan pedagang peserta arisan yang dari rumah tahanan menjadi tahanan kota. Sekdakab L.Batu H. Haspan Ritonga, Direktur RSU Rantau Prapat “ Setelah 6 hari dirawat di badannya dari 5,3 kg naik men- 5,3 kg, wajah cekung dan pucat diketuai terdakwa MR Br M alias Boneng. Roh Mariah Hutagalung mewakili para kor- Dr.H.Rusman Lubis, SpB, H.Azis Ritonga yang kesemuanya pe- sini, kondisinya mulai mem- jadi 6,4 kg,” jelas Siagian. Lebih serta rambut kemerah- Jaksa Penuntut Umum (JPU) Sri Lastuti, ban mengharapkan majelis hakim tidak mene- ngurus IPHI L.Batu serta Camat Rantau Utara Drs. April Hasibuan baik,” kata Direktur RSUD Tan- lanjut dikatakan Siagian, pena- merahan. SH. M.Hum di hadapan majelis hakim diketuai rima permohonan terdakwa dan PH-nya, berbaur dengan tokoh masyarakat dan agama L.Batu dan Rantau jungbalai Diah Retno melalui nganan terhadap bocah itu Pengakuan orang tuanya, Baslin Sinaga, SH dan terdakwa MR Br M, karena korban perkara ini sangat banyak dan Utara. Humas Cosmas Siagian kepada memang diprioritaskan pada pada usia 6 bulan Reza mulai didampingi penasihat hukumnya James Siagian, terdakwa selalu bersikap arogan terhadap para Sementara susunan pengurus IPHI Kecamatan Rantua Utara Waspada, Rabu (19/8). perbaikan gizi terlebih dahulu. diare disertai demam. Dan, pun- SH, menyebutkan, terdakwa mendatangi korban korban serta bersembunyi setelah perkara ini. yang baru dilantik itu berdasarkan Surat Keputusan No:05/KEP/ Menurut Siagian, sejak dira- Dan, kata Siagian, untuk mem- caknya, pertengahan Agustus Roh Maria Br Hutagalung dan temannya agar Ketua majelis hakim Baslin Sinaga yang PD/IPHI-LB/VIII/2009 tgl 15 Agustus 2009 yang ditandatangani wat inap di ruang anak, Reza percepat pemulihan bocah itu, lalu kondisinya semakin parah, mau ikut arisan yang diketuainya. dikonfirmasi wartawan, mengatakan, tidak Ketua IPHI HT.Milwan dan Sekretaris HM.Sofyan, MA sebagai diperiksa secara rutin oleh spe- pihak rumah sakit secara ru- sehingga akhirnya dibawa ke Terdakwa menjamin tidak akan terjadi keru- semua permohonan terdakwa harus dikabulkan. berikut: Penasehat camat R.Utara dibantu Ka.KUA Kec.R.Utara sialis anak dr. Purnama Fitri. tin memberi MP-ASI dan vita- RSUD Tanjungbalai. (a37) gian, sehingga korban dan lainnya setuju ikut Terdakwa ditahan sejak 3 Juni 2009. Dia ditang- serta H.Azis Ritonga dan H.Makmur Hasibuan, Ketua H.Amar jadi anggota. Arisan ini ada 5 bentuk, antara kap dari persembunyiannya di Medan setelah Hamdani Hasibuan , wakilnya H.Samsul Bahri, Spd, sekretaris dan wakilnya H.Parlindungan ,Hj. Aisyah Gita utami Lubis, Mengedar 260 Amplop Ganja lain, arisan Rp5 juta dengan anggota 13 orang dengan batas 10 bulan, arisan Rp1 juta dengan diduga ’kabur’ dari RS Herna setelah dititip penyidik. Terdakwa diduga berpura-pura sakit, bendahara dan wakilnya : Hj. Diana Hotmauli Sinaga dan Hj. Elvi Hasibuan serta dibantu ketua dan anggota beberapa seksi yang beranggotakan 20 orang. (c07) Pengantin Baru Diamankan anggota 21 orang, arisan Rp500.000 dengan peserta 30 orang, arisan Rp500.000 dengan dan mengirim surat keterangan sakit yang ditan- datangani dr. H. Chairil Anwar, SSp.PD sampai 5 kali berturut-turut. LABUHANRUKU (Waspa- harga Rp 5.000 per amp, dengan temanya, sudah lama menjadi peserta 30 orang dan arisan Rp100.000 dengan anggota peserta 30 orang. Kemudian, mengirim surat dokter dari da) : Polres Asahan melalui Pol- upah Rp 1.000 per amp,” jelas bahan incaran kami, dan hingga Satpol PP L. Batu Jaring 45 PSK sek Labhuhanruku mengaman- tersangka dengan Waspada. saat ini kami masih melakukan Para korban mengambil 2 nomor dan 3 nomor, dan setiap bulan membayar uang arisan sebuah klinik kejiwaan di Medan yang menya- takan dirinya sakit jiwa. Namun, setelah klinik kan pengantin baru pria yang Tersangka mengakui, baru pengembangan kasus untuk dicek polisi, ternyata sudah lama tutup. Polisi RANTAUPRAPAT (Waspada): Tim gabungan penertiban Pekerja tertangkap tangan mengedar- empat hari menikah, karena ke terdakwa sejak Januari 2008 sesuai bentuk menangkap bandar ganja sebe- arisan yang diikuti. Karena peserta lain, kata lalu memburu terdakwa dan menemukannya Seks Komersial (PSK) dan minuman keras (miras) yang terdiri kan 260 amp ganja siap pakai tidak ada pekerjaan, ia terpaksa narnya,” jelas Mijer. di rumah saudaranya di Perumnas Mandala, dari unsur Satuan Polisi Pamong Praja Kabupaten Labuhanbatu, di Balai Desa Lama, Desa Ujung- menjualkan barang haram itu terdakwa, ada yang menawar nilai angsuran, kemudian dibawa ke klinik jiwa. Namun, setiba Kapolsek Labuhanruku juga maka uang korban yang masuk Rp31.350.000. unsur Pemkab L.Batu lainnya, TNI/Polri, menjaring 45 orang kubu Kec. Tanjungtiram, Kab kepada pelanggan.” Saya baru di klinik, terdakwa menjerit histeris dan pingsan PSK, waria dan lelaki hidung belang dari berbagai penginapan menjelaskan, hari ke-13 Operasi Akan tetapi, tiba giliran korban menarik Batubara, Rabu (19/8) sekira satu bulan menjual barang Pekat Toba II, anggotanya telah dalam mobil polisi sehingga dibawa ke RS Herna. dan kafe di daerah itu, Selasa-Rabu (18-19/8). pukul 10:00. haram ini, dan setiap harinya uangnya, terdakwa mengatakan tidak sanggup Namun, terdakwa kabur dari RS itu. Ke 45 orang tersebut, terdiri dari 29 PSK, 1 waria dan 15 diduga mengamankan 5 kasus judi lagi dan hanya bisa membayar sebagian dengan Tim penyidik kembali melacak keberadaan Tersangka, SJ,24, warga diperkerikan laku terjual seba- lelaki hidung belang dijaring dari kafe Desa N8 Aek Nabara, Gapuk Dusun VI, Desa Ujungkubu, nyak 50 amp,” jelas tersangka. dengan 10 tersangka, dan 5 cara menyicil. Korban keberatan dengan sikap terdakwa dan menemukannya di tempat per- dan kafe Adian Batang (Kecamatan Bilah Hulu), Penginapan Kec. Tanjungtiram, Kab Batu- Kapolres Asahan AKBP kasus Narkoba dengan 5 orang terdakwa yang selalu buang badan dan bersikap sembunyian di Mandala.Terdakwa diperiksakan Murni, Hotel Indah, Penginapan Gunung Sahari dan dari Desa bara yang sedang bertransaksi Rudy Sumardiyanto melalui tersangka dengan barang bukti arogan, sedangkan korban seharusnya mem- ke RS Bhayangkara Medan. Setelah terdakwa Janji, Kec. Bilah Barat. dengan barang butkti 260 amp Kapolsek Labuhanruku AKP 265 amp ganja siap pakai dan beri Rp50 juta. Para korban pun melaporkan diketahui ’pura-pura’ sakit jiwa, langsung dibo- Ke 45 orang dibawa ke kantor Badan Kesbang, Linmas dan ganja siap pakai yang dimasuk- Mijer dikonfirmasi Waspada 2 paket hemat shabu-shabu. terdakwa ke Polres Labuhanbatu. yong ke Polres Labuhanbatu di Rantauprapat Politik L.Batu untuk mendapat pembinaan dan pemeriksaan kan dalam toples, serta satu mengatakan, penangkapan ter- “ Polsek Labuhanruku akan Perbuatan terdakwa MR Br M warga Jalan dan ditahan. (a26) klinis untuk mengetahui apakah mereka mengidap penyakit buah alat sedop yang terbuat sangka merupakan kerja sama terus meningkatkan kemanan menular seksual atau terjangkit HIV/AIDS. Kepala Satpol PP L.Batu, Said Ali, MSi di sela-sela penertiban dari botol plastik. “ Barang ha- ram ini bukan milik saya, saya masyarakat dengan memberi informasi dengan petugas. dan ketertiban masyarakat, terkait untuk menyambut Bulan Askep Dan Mantan Kades Diciduk Sedang Berjudi PSK dan miras tersebut saat ditanya Waspada mengatakan, hanya menjualkanya dengan “ Dia dan beserta teman- Ramadhan,” ujar Mijer. (csap) penertiban yang dilakukan tim gabungan ini bukan sebagai target, LABURA (Waspada) : Polsek Na.IX.X melaku- DMS,37, karyawan dan MD,37, karyawan. kan penangkapan secara terpisah dua kelompok Petugas kemudian menyita barang bukti berupa melainkan sebagai sasaran agar tercipta ketertiban dan keamanan dalam menjalankan ibadah puasa Ramadhan 1430 Hijriah. (a27) Pimpinan SKPD Yang Merasa bermain judi dari dua lokasi yang melibatkan Askep (karyawan) kebun PT. Binanga Karya dua set kartu joker dan uang tunai Rp56 ribu. Sementara kelompok mantan kades Batu Tunggal berjumlah tujuh orang diciduk, Senin KNPI Tanjungbalai Gelar Berat Diminta Mundur (PT. BK) dan mantan Kepala Desa Batu Tunggal. Demikian Kapolres Labuhanbatu AKP Drs. Toga H. Panjaitan, SH melalui Kapolsek Na.IX.X (10/8) sekira pukul 23:00 saat bermain judi Jeblok yaitu JM,44, mantan kades Desa Batu Tunggal, Gema Ramadhan 1430 H LUBUK PAKAM (Waspada): Selasa (18/8). Deliserdang. AKP H.TH. Arifin Rangkuti kepada Waspada, PD ,39, bertani, PM,32, bertani, SH,20, bertani, DF,21, wiraswasta, FM ,38, bertani, dan SR,23, Wakil Bupati Deliserdang H MenurutWabup, dalam ku- Sebagai nara sumber dari Selasa (18/8) melalui pesan SMS. Menurut Ka- TANJUNGBALAI (Waspada) : Dewan Pengurus Daerah KNPI bertani. Ketujuh pemain beralamat Dusun Aek Zainuddin Mars, menekankan run 5 tahun ke depan kita harus unsur perguruan tinggi di an- polsek, kelompok bermain judi yang melibat- Pasar, Desa Batu Tunggal, Kec. Na.IX.X Labura, Kota Tanjungbalai, akan menggelar berbagai kegiatan dalam rangka seluruh SKPD dan pimpinan mampu memberikan peruba- taranya Hamdani Harahap, kan karyawan kebun ditangkap, Senin (17/8) papar Kapolsek menyambut bulan suci Ramadhan 1430 Hijriah. unit kerja di jajaran Pemkab han ke arah kebaikan. Karena- Saruhum serta Rina Lingga. sekira pukul 02.00 pagi di Perumahan PT. Binanga Modus permainan judi jeblok yaitu setiap “ Kegiatan ini diberi nama Gema Ramadhan,” kata Ketua DPD Deliserdang berkerja maksimal nya melalui Musren-bang Usai mengekspos RPJMD Karya Desa Kampung Pajak Kec. Na.IX.X. putaran pemenang menyediakan uang taruhan KNPI Tanjungbalai Adi Herman di dampingi Sekretaris Mukmin sesuai Tupoksi masing-masing. RPJMD diharapkan dapat Kab. Deliserdang 2009-2014, “Kelompok ini berjumlah lima orang se- Rp20 ribu dengan Bandar saling bergantian. Mulyadi, Zainuddin, Khairun Nasution dan panitia pelaksana Jika ada pimpinan SKPD menghasilkan hal-hal maksimal sejumlah peserta di antaranya muanya adalah karyawan kebun PT. BK,” papar Petugas kemudian menyita barang bukti berupa Mahyaruddin Salim, Ibrahim dan Aswad Simatupang dalam temu maupun unit kerja merasa berat bagi terwujudnya masa depan Ketua DPRD, Kadis PU Jalan/ Kapolsek. Adapun kelima orang itu yaitu RPS,35, uang tunai Rp55 ribu, satu meja triplek berben- pers di kantornya Rabu (19/8). melaksanakan tugas, lebih baik Deliserdang sesuai visi-misi Jembatan Sumut, Kadis PU Bina Askep PT. BK, LA,65, karyawan, SP karyawan, ,41, tuk lingkaran dan satu set kartu domino. (a26) Adi melanjutkan, Gema Ramadhan diawali dengan pawai taaruf mengundurkan diri saja dari menjadikan Deliserdang yang Marga Deliserdang Faisal serta mengelilingi Kota Tanjungbalai. Selanjutnya, kata Adi, dirangkai denganSafariRamadhandenganmengunjungi12masjiddanmushala. “barisan”. Deliserdang yang me- miliki potensi besar dan me- maju dengan masyarakat-nya yang relegius,bersatu dalam ke- Kepala PDAM Tirta Deli Fauzan menyampaikan berbagai masu- Truk Angkut Kayu Ditangkap Polres L. Batu “ Selain itu, kita juga melaksanakan studi intensif keIslaman pemuda miliki APBD mencapai sekira bhinekaan melalui pemerataan kan untuk penyempurnaan dan buka puasa bersama yang dirangkai dengan memberikan Rp 1,3 triliun merupakan kedua pembangunan, pemanfaatan RJPMD Deliserdang. RANTAUPRAPAT (Waspada) : Sebuah truk kayu KBT,30, warga Bandar Lama, Kec.Kualuh santunan kepada puluhan fakir miskin,” tambah Adi. terbesar di Sumut setelah Pem- sumber daya yang adil dan pene- Kepala Bappeda Deliser- colt diesel biru berlogo/Cap ‘PC’ Polres Labu- Selatan Kabupaten Labura digelandang ke Ma- Pada kesempatan itu, selaku Ketua DPD KNPI Tanjungbalai, ko Medan jangan jadikan pohon gakan hukum yang ditopang tata dang H. Irman Dj Oemar men- hanbatu bermuatan kayu tanpa dokumen polres Labuhanbatu. Adi Herman mengimbau agar PT PLN tidak memadamkan listrik “bonsai” yang terlihat cantik dan pemerintahan yang baik. jelaskan rancangan RJPMD ditangkap polisi saat melintas di Jalinsum Pekan Penangkapan dilakukan sesuai dengan info selama Ramadhan. Menurut Adi, apabila pemadaman dilakukan, harganya mahal, tegas Wabup Musrenbang dihadiri unsur belum final. Setelah menerima Damuli Kec. Kualuh Selatan, Selasa (18/8). dari masyarakat, ada truk mengangkut kayu maka kenyamanan umat Islam beribadah selama bulan suci itu H. Zainuddin pada pembukaan Muspida, Ketua DPRD H.Wagi- berbagai masukan dari peserta Kapolres Labuhanbatu AKBP .Toga H.Pan- melintas di Jalinsum. Setelah diamankan petugas bakal terganggu.“ Kita juga meminta PDAMTirta Kualo meningkatkan Musrenbang RPJMD (Rencana rin Arman, Kadis PU Jalan/Jem- dan dirumuskan, pihaknya akan jaitan melalui Kasat Reskrim AKP Deddy Su- ternyata memang benar dan kayu tidak mempu- distribusi air bersih, karena selama Ramadhan, kebutuhan air bersih Pembangunan Jangka Mene- batan Sumut H. Umar Z Hasi- kembali melakukan pertemuan priadi, SIK.SH didampingi Kanit Tipiter Iptu nyai dokumen SKSHH (Surat Keterangan meningkat,” tambahnya. ngah Daerah) Kabupaten Deli- buan, Kadis Pendidikan Sumut pembahasan RJPMD dengan Hery, SH kepada Waspada, melalui pesan SMS Sahnya Hasil Hutan). Sekretaris DPD KNPI Muslim Mulyadi meminta aparat kepolisian serdang tahun 2009-2014, di H Bahrumsyah, seluruh pim- memperhatikan masukan dari membenarkan penangkapan truk itu. Kayu itu, papar Kasat, sebanyak 2,87 meter dan pihak terkait agar pro aktif menertibkan lokasi hiburan guna Aula Cendana kantor Bupati pinan SKPD, camat dan pimpi- berbagai elemen masyarakat, Menurut Kasat, truk plat BK 8126 YI beserta kubik. Untuk sementara truk dan kedua ter- menjaga kesucian Ramadan dari nuansa maksiat. (a37) Deliserdang di Lubuk Pakam, nan unit kerja sejajaran Pemkab katanya. (a05) sopir ZN, 40, warga Damuli Pekan dan pemilik sangka ditahan di Mapolres, paparnya. (a26)
  19. WASPADA Kamis 20 Agustus 2009 Sumatera Utara 19 Peringatan HUT Ke-64 RI Di Serbelawan Meriah Peringatan HUT RI Ke-64 Di Simalungun Khidmat SERBALAWAN, (Waspada): Warga huta dan nagori bersama siswa dan unsur Muspika Dolokbatunanggar menghadiri upacara peringatan HUT Ke-64 RI di lapangan sepak bola Jalan Perintis Kemerdekaan, Kel. Serbalawan, Kab. Simalungun, Senin (17/8). Mantan Ketua PPK SIMALUNGUN (Waspada): Upacara Hari Ulang Tahun Ke- 64 Proklamasi Kemerdekaan juga dihadiri unsur Muspida Plus, Wakil Bupati Simalungun, Sekretaris Daerah, para pejabat ter teladan, paramedis/bidan desa teladan, petugas PKM tela- dan, tenaga gizi teladan. Inspektur upacara peringatan itu Camat Dolokbatunanggar IrwanDamaniksertakomandanupacaraFuadDamanikdanpembaca teks proklamasi anggota DPR Simalungun. Sedangkan pengibaran Sangsaka Merah Putih oleh Paskibra dari SMAN Dolokbatunanggar. Siantar Utara Diadukan Republik Indonesia di Kab. Sima- lungun di Lapangan Panei To- ngah, Kec. Panei, Senin (17/8) berlangsung khidmat. jajaran TNI, Polri dan Pemkab Simalungun, Muspika serta para pangulu se Kec. Pane, dan disak- sikan ribuan warga. Seusai upacara bupati dan rombongan mengunjungi Lapas Kelas IIA Pematangsiantar sekaitan penyerahan remisi Sementara, doa disampaikan Ka. KUA Dolokbatunanggar Azhari P. SIANTAR ( Waspada): kutta Sembiring, Kelurahan pernah bertemu dengan FTP Sebagai Inspektur Upacara Pada peringatan HUT RI kepada warga binaan Lapas. Simatupang. Seusai upacara dihibur oleh tarian daerah Simalungun Diduga melakukan penipuan Nagapita, Kecamatan Siantar (Irup) Bupati Simalungun HT ke-64 itu Bupati Simalungun Sesuai dengan SK Menteri hingga korban dirugikan men- oleh siswa sekolah lanjutan setempat. dan penggelapan, mantan Ketua Martoba, Pematangsiantar. Zulkarnain Damanik, sedang- dan Muspida,Wakil Bupati, Sek- Hukum dan HAM 396 warga capai Rp 35 juta dan mengadu- da dan Ketua TP PKK menye- binaan Lapas Kelas II A Pema- Sementara, di PTPN-4 Dolok Ilir, HUT RI diperingati meriah Panitia Pemilihan Kecamatan Uang yang dititipkan itu diguna- kan FTP ke Polresta pada Selasa kan komandan upacara Kapten oleh karyawan, di halaman Kantor Besar. Manajer PTPN 4 Kebun CZI P. Naibaho (Danramil 14 rahkan piagam penghargaan tangsiantar mendapat remisi, (PPK) Siantar Utara, Kota kan FTP sebagai modal usaha- (18/8). dan 23 di antaranya remisi bebas Dolok Ilir, H. Effendi Nasution bertindak sebagai inspektur upacara Raya). dan tropi kepada para petani Pematangsiantar, FTP 33, warga , nya. Kapolresta AKBP Andreas teladan, penyuluh teladan, dok- antara. (a15) dan komandan upacara Perwira Pengamanan (Papam) Kapten Jalan Nagur, Gang Masjid, Kelu- Saat korban menitipkan Sedangkan pengibaran Sa- Giman. Sedangkan teks proklamasi dibacakan salah seorang anggota Kusmaedi saat dikonfirmasi rahan Martoba, Kecamatan uang itu turut disaksikan Rizal ngsaka Merah Putih oleh Pas- melalui Pabungpen AKP Mus- Security Kebun, serta pengibaran bendera Merah Putih oleh anggota/ petugas keamanan. (c03) Siantar Utara, Pematangsiantar dan Budiaman Saragih, 38, wira- lim dan Kasat Reskrim AKP AY. kibraka siswa SMA Negeri Panei PNS Yang Bolos Akan Dirazia diadukan ke Polresta. swasta, warga Jalan Pattimura Tongah. Sedangkan peringatan Harahap di Mapolresta, Rabu detik-detik proklamasi ditandai TARUTUNG (Waspada): Dalam waktu dekat razia terhadap Korban Anton Syahid Na- Dalam, Kelurahan Tomuan, Ke- (19/8) membenarkan. Perayaan HUT RI Di Sidikalang Sederhana sution, 39, wiraswasta, warga camatan Siantar Timur, Pema- FTP yang dihubungi melalui bunyi sirena yang dilanjutkan pembacaan teks proklamasi Pegawai Negeri Sipil (PNS) yang melanggar PP 30 tentang disiplin . di jajaran Pemkab Taput akan segera dilaksanakan. Jalan Silimakuta, Kelurahan Si- tangsiantar dan uang itu akan SIDIKALANG (Waspada): Peringatan HUT ke-64 RI diperingati marito, Kecamatan Siantar dikembalikan FTP kepada kor- telefon seluler membantah oleh Ketua DPRD Simalungun Hal itu diuatarakan Kepala Satpol PP Taput BI Aritonang sederhana di Stadion Sibura-bura Sidikalang, Senin (17/8). Dibanding Barat Pematangsiantar dalam ban pada 15 Agustus 2009 sesuai semua pengaduan korban dan Syahmidun Saragih. Sedangkan kepada Waspada, Rabu (19/8) usai mengikuti acara paripurna tahun-tahun sebelumnya, jumlah peserta upacara menurun drastis. pengaduannya menyebutkan kwitansi yang dibuat. menyatakan tidak ada kaitannya doa oleh Kakandepag Simalu- LKPJ Bupati Taput tahun 2008 di Tarutung. Menurutnya, tentang Tempat duduk di tribun kosong. Begitu pun, agenda berlangsung FTP diduga melakukan peni- Sesuai kesepakatan, korban dengan pemilu legislatif tahun ngun Muslim didampingi roha- adanya PNS yang melanggar PP 30 juga telah diulas dalam tanggapan . lancar, hanya saja suara peserta kerap terdengar khususnya menjelang puan dan penggelapan di Jalan meminta kembali uangnya yang 2009 saat FTP masih aktif seba- niawan Kristen Protestan dan umum perorangan DPRD Taput pada paripurna tentang LKPJ pelantunanlaguwajibsajianmahasiswaAkperPemkabDairi.Bertindak Nagur, Gang Masjid, Kelurahan dititipkan kepada FTP Namun, . gai Ketua PPK Siantar Utara, Katholik. Bupati tahun 2008. selaku komandan upacara Iptu Pol Banuaran Manurung, sedangkan Martoba, Pematangsiantar saat akan menjumpai FTP ke dimana saat itu korban me- Peserta upacara terdiri dari Kepada Waspada, Binhot membenarkan ada PNS yang bolos teks proklamasi dibacakan Ketua DPRD Leonard S Samosir. pada Minggu (16/8) pukul 16:00. rupakan Caleg salah satu barisan TNI, Polri, PNS, OKP , kerja dan bahkan tidak pernah masuk kantor sama sekali dari rumahnya, FTP tidak pernah Upacara juga diikuti para anggota LVRI (LegiunVeteran Republik Pramuka, pelajar SMA, SMP SD , tanggal 1 sampai dengan 31 setiap bulan (makan gaji buta). (c12) Indonesia ) dengan memberi penghormatan pada duplikat Sangsaka Menurut korban, pada ada di rumahnya dan menurut Parpol. (a14) Merah Putih yang dikibarkan Paskibra. Rabu (1/4) pukul 17:00 dia me- informasi, FTP berada di rumah Parapejuangjugamendapatkesempatanmenerimasalamhangat nitipkan uang Rp 35 juta kepada mertuanya di Serbelawan, dari Bupati Dairi KRA Johnny Sitohang yang bertindak sebagai FTP di dalam rumah saksi Rizal, Simalungun. inspektur upacara. (a28) 33, wiraswasta, warga Jalan Ra- Hingga saat ini, korban tidak
  20. 20 Sumatera Utara WASPADA Kamis 20 Agustus 2009 Sepeda Motor Hilang Di Door Smeer Bebas Dari LP, Tertangkap Larikan Sepeda Motor P SIANTAR (Waspada): Satu unit sepeda motor milik korban . Desman Morris H Sirait, 35, wiraswasta, warga Jalan Pamatang, P SIANTAR (Waspada): Baru . Sesudahmengisibahanbakar melaju ke arah Jalan Medan. Kelurahan Simalungun, Kecamatan Siantar Selatan, Kota Pema- bebas dari Lembaga Pemasyara- sebanyak dua liter, ISS mengajak Saat terjadi kejar-kejaran, di katan (LP)Tenjung Gusta, Medan Dea Afandi berputar-putar. ISS Jalan Medan, kilometer 7, tepat- tangsiantar hilang dicuri maling yang belum diketahui identitasnya sesudah mendapat remisi HUT kemudian meminta Dea Afandi nya di depan pabrik tepung ta- dari satu door smeer (pencucian kendaraan). ke 64 RI pencurian kendaraan menghentikan sepeda motornya pioka di Kel. Tambun Nabolon, Berbagai keterangan dihimpun dan laporan korban di Polres bermotor (curanmor), ISS, 23, di sekitar Stadion Sangnawaluh, Kec. Siantar Martoba, tiba-tiba Simalungun, Selasa (18/8) menyebutkan, sepeda motor milik korban warga Nagori Rambung Merah, Pematangsiantar. ISS terjatuh. merk Honda Revo BK 2395 W diduga dicuri maling yang belum Kec. Siantar, Kab. Simalungun Di lokasi itu, ISS meminjam Melihat itu, kedua teman diketahui identitasnya di lokasi door smeer Sejahtera di Jalan H. kembali tertangkap, kerana mela- sepeda motor Dea Afandi dengan Risky Ananda langsung mem- Ulakma Sinaga, Nagori Rambung Merah, Kecamatan Siantar, rikan sepeda motor Honda Revo alasan hendak menjemput pe- beritahukan kepada warga, ISS Kabupaten Simalungun pada Selasa (18/8) pukul 22:30. milikRiskyAnanda,15,Selasa(18/ rempuan yang ditawarkan itu di yang terjatuh itu sudah mencuri Kapolres Simalungun AKBP Rudi Hartono saat dikonfirmasi 7) pukul 11:00. JalanMedansambilmemintaDea sepeda motor yang dikendarai- melalui Pahumas Kompol Ramli Sirait dan Kasat Reskrim AKP Tito Peristiwaituterjadiketikakor- Afandi menunggunya. Namun, nya. Namun, warga malah mem- ban bersama tiga temannya ingin Dea Afandi yang sudah curiga bawaISSkeRSUMinaPadidiJalan Travolta di Mapolres, Rabu (19/8) membenarkan laporan kehilangan menikmati suasana HUT ke-64 tidak mau dan menolak dengan Medan Kilometer 8-9, Kel. Sinak- sepeda motor itu. “Tersangka pelaku pencurian sepeda motor itu RI ingin berekreasi ke Karang alasan akan segera menjemput sak,Kec.TapianDolok,Kab.Sima- diduga menggunakan kunci palsu saat mencuri sepeda motor itu.” Anyer di Kec. Gunung Maligas, adiknya. Dea Afandi selanjutnya lungun untuk mendapatkan per- Kasus sama turut terjadi di wilayah hukum Polresta Pematang- Kab. Simalungun. membawa ISS kembali ke per- tolongan. siantar sesuai pengaduan korbanWahyudin, 23, wiraswasta, warga Saat melintas di tengah per- simpangan Jalan Karang Sari. Kedua teman Risky Ananda PasarIV NagoriKarangAnyar,KecamatanGunungMaligas,Kabupaten , simpangan Karang Sari, tiba-tiba Penolakan Dea Afandi tidak tidak putus asa dan ketika melihat Simalungun. mereka dihadang dan dipanggil membuatISSkehilanganakaldan dua personil Unit Laka Sat Lantas Wahyudin menyebutkan sepeda motornya Yamaha BK 3789 Waspada/Helmy Has ISS. Selanjutnya, ISS mengaku mengalihkan sasarannya kepada Polresta, Pematangsiantar Aiptu WS warna merah diduga hilang dicuri maling yang belum diketahui mengenal abang dari Yudistira Risky Ananda dengan mengajak Sutono dan Aiptu JM. Purba yang TAMASYA LAUT: Perayaan HUT Kemerdeka an RI ke-64 membawa keberuntungan ojek sampan bernama Rivai. ISS kemudian Risky menukarkan HP Risky yang mengendarai mobil patroli, ke- identitasnya saat diparkir di halaman rumah seorang tukang bengkel, tambang yang mangkal di dermaga Pelabuhan Tanjungtiram, Batubara. Ratusan pengunjung menawarkan kepada mereka modelKTouchD12denganNokia duanya langsung memberitahu- Thamrin, 45, warga Jalan Bongbongan Raya, Kelurahan Tambun luar kota seperti warga perkebunan sekitar Kisaran, Perdagangan Simalungun hari itu tumplek agar suasana rekreasinya mereka N73, milik seorang perempuan kan ISS sudah mencuri sepeda Nabolon, Kecamatan Siantar Martoba, Kota Pematangsiantar pada menikmati Pantai Bunga Laut di Tanjungtiram kemudian ‘tamasya laut’ trayek pelabuhan semakin asyik bila ditemani yang ada di Jalan Medan. motor teman mereka. Minggu (16/8) pukul 21:30. ke Pantai Belacan Baganluar. Tamasya laut murah meriah, menurut Jakfar, salah seorang perempuan. Dengan polos dan tidak ada Mendengar laporan kedua Kapolresta AKBP Andreas Kusmaedi saat dikonfirmasi melalui ojek sampan tambang hanya dengan ongkos PP Rp10.000 per orang. Kalau carteran menunggu teman Risky Ananda, Aiptu Suto- Meski korban dan para rasacurigamembuatRiskyAnan- sampai pulang Rp20.000 per orang.”Lumayan hari ini dapat gaji Rp75 ribu sampai Rp100 no langsung menjemput ISS dari Pabungpen AKP Muslim dan Kasat Reskrim AKP AY. Harahap di ribu” kata Jakfar yang mengaku mantan nelayan jaring itu.Terlihat kesibukan pengunjung teman-nya sama sekali tidak da menyetujui ajakan ISS dan Mapolresta, Rabu (19/8) membenarkan. (a14) mengenal ISS, namun menuruti langsung membonceng ISS de- ruangan IGD RSU Mina Padi dan naik sampan tambang di dermaga Pelabuhan Tanjungtiram. Foto direkam, Senin (17/8). membawanyaMapolrestaPema- saja ajakan ISS. Selanjutnya, ISS ngan sepeda motornya yang baru mengajak menemaninya Dea satu bulan dibeli orangtuanya. tangsiantar. Sedang, Aiptu JM. Kuli Bangunan Curi Getah Ditangkap Afandi menjemput perempuan Selanjutnya, ISS membawa Risky Purba membawa sepeda mo- P SIANTAR (Waspada): Seorang kuli bangunan, SD, 43, warga . Huta I, Nagori Pematang Asilum, Kecamatan Gunung Malela, Kabupaten Simalungun diduga mencuri getah perkebunan hingga Napi Teroris Pindahan Lapas yang tak disebutkan namanya itu ke Jalan Medan, sedang korban bersama kedua temannya yang lain tetap menunggu di persim- ke Jalan Stadion. Tiba di Jalan Sta- dion, ISS meminta meminta HP milik Risky Ananda dan me- minjam sepeda motornya untuk tor Risky Ananda ke Mapolresta. Saat dieriksa, ISS mengaku baru tiba, Selasa (18/8) sekitar pukul 06:00 di Pematangsiantar ditangkap dan dijebloskan ke dalam tahanan. SD diduga melakukan pencurian getah milik PTPN III Kebun Bangun di areal Afdeling II Tahun Tanam 1994, Kebun Bangun, Kecamatan Siantar, Simalungun pada Selasa (18/8) pukul 22:45. T. Gusta Diisolasi Di Lapas P. Siantar pangan jalan Karang Sari itu. Mendengar ajakan itu, Dea Afandi mengatakan, bahan bakar sepedamotornyatidakada.Men- menukarkan HP itu dengan HP N73 milik perempuan yang ada di Jalan Medan itu. Tanpa curiga, Risky Ananda sesudah bebas dari LP Tanjung Gusta, Medan, karena mendapat remisi peringatan HUT Kemer- dekaan ke-64 RI selama 2 bulan. P. SIANTAR ( Waspada): intensif lagi penjagaan terhadap itukeLapasPematangsiantarsejak Kapolresta AKBP Andreas Dalam beraksi, SD menggunakan ember cat dan goni plastik dengar itu, ISS mengatakan akan memberikan HP dan sepeda mo- Kusmaedi saat dikonfirmasi Narapidana (Napi) teroris pinda- Napi itu. 31 Juli 2009, Nasution menyebut- mengutip getah dari pohonnya. Saat mengutip getah itu, pengamanan mengisi bahan bakar sepeda tornya kepada ISS. Namun, sesu- melalui Pabungpen AKP Mus- han dari Lembaga Pemasyaraka- “Dia (Indra Warman-red) kan guna mencegah bergabung- kebun memergoki dan melakukan penangkapan. Saat ditangkap, motor itu hingga Dea Afandi ber- dah ISS pergi, kedua teman Risky lim dan Kasat Reskrim AKP AY. tan(Lapas)TanjungGusta,Medan macam teroris Noordin M Top, nya kembali komplotannya yang DS sudah mengumpulkan sebanyak 10 Kg getah. Pengamanan perke- sedia membonceng ISS dengan Ananda yang sudah curiga Harahap di Mapolresta mem- diisolasi di ruangan dan lokasi bisa mempengaruhi hingga tidak sama-samadihukum,apalagisaat benarkan.(a14) bunan selanjutnya melaporkan dan menyerahkan DS ke pihak sepeda motornya. langsung mengejar ISS yang khususdiLapasPematangsiantar. diberikan bergaul dengan Napi diTanjungGusta,Medan,mereka kepolisian beserta barang bukti yang disita berupa getah 10 Kg, “Kami sedang mempelajari dan tahanan di Lapas termasuk sudah mulai menciptakan keri- ember cat dan goni plastik. Kapolres Simalungun AKBP Rudi Hartono saat dikonfirmasi karakternya saat ini dan tidak memperbolehkannya bergaul petugas lapas. Dunia ini hanya seperti seujung kuku baginya. butan. “Bisa terbakar nanti Lapas Tanjung Gusta itu hingga mereka Bupati Simalungun Serahkan Bingkisan melalui Pahumas Kompol Ramli Sirait dan Kasat Reskrim AKP Tito denganNapidantahananlainnya Penjagaan yang kami lakukan dipecahdenganmemisahkannya SIMALUNGUN (Waspada): Travolta membenarkan. (a14) guna mencegah hal-hal tidak saatinisesuaipetunjukyangkami ke beberapa Lapas.” Bangsa yang besar adalah bangsa diinginkan,” sebut Kepala Lapas terima, sudah pas, karena Napi Mengenai tingkah laku Napi yang menghargai jasa para Pematangsiantar M. Nasution, initermasukbiangnya,dalangnya itu sesudah di Lapas Pematang- pahlawannya. Peringatan HUT 107 Mahasiswa STAIS Al-Ikhlas Dairi Diwisuda BcIp, SH , Rabu (19/8). atau sejenisnya,” papar Nasution. siantar, Nasution menyebutkan Proklamasi yang setiap tahun NasutionmenyebutkanNapi Selain itu, menurut Nasution, terlihat alim dan rajin shalat serta digelar bukan hanya sekedar SIDIKALANG (Waspada): Sebanyak 107 Mahasiswa Sekolah itu bernama IndraWarman, kela- pihaknya saat ini masih tahap belajar mengaji. “Kelihatannya acara seremonial dan rutinitas Tinggi Agama Islam (STAIS) Al Ikhlas Dairi, strata 1 (S1) angkatan hiran Medan, 27 April 1970 dan pengenalan terhadap Napi itu alim, tapi dari hasil pembicaraan saja, tetapi lebih jauh lagi peri- XV, diwisuda, Rabu (19/8) di gedung olah raga (GOR) Sidikalang. memiliki sembilan nama alias hinggatamuyangbisamenjenguk kami menunjukkan dia merasa ngatan HUT Proklamasi harus Acara wisuda diawali dengan pembacaan ayat suci Al qQur yakni Toni Togar alias Regar alias hanya keluarganya dan bila ada hanya dia yang benar.” diambilmaknaatauhikmahyang an oleh salah seorang dari wisudawati. Tomi alias Hasan alias Abdul tamu lain di luar keluarganya, NasutionmenyebutkanNapi terkandung di dalamnya. Acara dihadiri Ketua STAIS, Drs. Saidup Kudadiri, dewan dosen, yangmemilikialamatdibeberapa “ Kita harus berterimah kasih Rosyid alias Fery Kurniawan alias diperintahkan harus melalui izin tempat ini seperti di Medan dan KetuaYayasan Al Ikhlas Sidikalang,H.D.Sagala, Bupati Dairi diwakili Muhammad Aryo alias Tatang Kepala Lapas. “Sesudah Napi itu Sawah Lebar, Bengkulu dihukum kepada para pejuang kemerde- Asisten II, Sebastianus Tinambunan,SH, Ketua MUI Naek Angkat dan alias Jono. berada di sini, istrinya bersama akibat empat tahun dan 15 tahun kaan yang telah berhasil dalam Waspada/Hasuna Damanik dan lainnya. Menurut Nasution, pihaknya ayah dan mertuanya sudah da- penjara, karena terbukti hendak mempertahankan tanah air dari terpaksa harus ekstra hati-hati tang menjenguk. Baru penga- belenggupenjajahan.Perjuangan BINGKISAN: Bupati Simalungun HT Zulkarnain Damanik Ketua STAIS, Saidup Kudadiri dalam kata sambutannya mengata- melakukan makar dan perampo- sedang menyerahkan bingkisan kepada salah seorang pejuang kan, era reformasi sekarang ini menuntut kehadiran perguruan terhadap Napi itu, apalagi pihak caranya Machmud Irsyad Lubis, kan Bank Lippo di Medan yang mereka harus kita dukung dan kepolisian dari Medan beberapa SH di luar keluarganya yang mengisi kemerdekaan ini dengan kemerdekaan, di rumah dinas bupati, Selasa (18/9). tinggiyangberwawasanilmupengetahuandanteknologidanmewarisi mengakibatkan jatuhnya korban moral bangsanya. Berkaitan dengan itu,sebagai upaya memenuhi kali mengingatkan sesudah Napi menjenguk. Itu pun sebenarnya sesuai Undang-undang (UU) pembangunan untuk kemajuan kibar hingga saat ini berkat memiliki jiwa perjuangan yang ituberadadiLapasPematangsian- harus melalui izin saya agar bisa Darurat nomor 12 tahun 1951, bangsa dan negara yang sama- perjuangan pahlawan. “ Bahkan dimilikiparapejuangsaatmerebut tuntutan dimaksud, STAIS harus mampu mendorong proses pening- tar, agar pihak Lapas Pematang- menjenguk.” UUnomor8tahun1951danPasal sama kita cintai,” tandas Zulkar- saat itu mereka (para pahlawan) kemerdekaan untuk mengisi katan kualitas untuk menciptakan sumber daya manusia muslim tidak memikir untuk menjadi kemerdekaan ini dengan baik, siantar ekstra hati-hati dan lebih Tentang pemindahan Napi 365 KUH Pidana. (a14) nainDamanik,saatmenyerahkan yang handal dan bermoral sekaligus berpengetahuan. apa-apa, hanya memikirkan ke- demimasadepanyanglebihbaik. bingkisan kepada 200 lebih pe- Ketua Yayasan Al-Ikhlas Sidikalang, HD.Sagala mengharapkan agar mahasiswa yang diwisuda dapat meningkatkan ilmunya dan menerapkannya dengan baik di lingkungan keluarga dan lingkungan DPRD Setujui LKPJ Bupati Taput 2008 juang kemerdekaan dari berbagai organisasi di rumah dinas bupati merdekaan dan lepas dari pen- “ Mari kita lestarikan semangat jajah demi masa depan bangsa perjuangan itu untuk bangsa dan jalan Perintis Kemerdekaan ini,” tambahnya. negara yang lebih baik di masa lainnya. (a28) TARUTUNG (Waspada): Sebelum penandatanganan juga meminta Kantor Catatan Pematangsiantar serangkaian Pada kesempatan itu, atas depan,” harap bupati. ParipurnaDPRDTaput,Rabu(19/ keputusan bersama itu, Fraksi Sipil Taput meningkatkan pela- dengan peringatan HUT RI ke- nama Pemkab dan masyarakat Dalamacaraitu,BupatiSima- 8) dipimpin Ketua FL Fernando PartaiGolkardisampaikanReguel yanannya, khususnya KTP akte , Dinkes Samosir Lakukan Simanjuntak menerima dan Simanjuntak meminta Bupati lahir, akte kawin yang merupakan 64, Selasa (18/9). Dikatakan, penghormatan Kab. Simalungun, Bupati Zul- lungundidampingiKetuaTPPKK karnain Damanik, menyampai- SimalungunNyJulianaZulkarnain menyetujui LKPJ (Laporan Ke- Taput agar terus berupaya me- kebutuhan masyarakat. Kemu- Pengawasan Obat terangan Pertanggungjawaban) ningkatkan gaji Kepala Desa dan dian perkembangan sosial ma- kepadaparapejuangpatutdiberi- kan,karenamemangparapejuang kan rasa terima kasih kepada para Damanik dan Muspida membe- pejuang dan akan terus berupaya rikan bingkisan kepada para pe- pelaksanaan APBD tahun ang- perangkatnya serta mengisi syarakat perlu mendapat per- kemerdekaan ini sebelumnya memberikan kepedulian kepada juang kemerdekaan dari berbagai SAMOSIR (Waspada): Dinkes Samosir melalui bidang farmasi garan 2008. jabatan eselonisasi yang belum hatian serius semua lapisan khu- tidakmengenallelahdalammem- para pejuang agar mereka juga organisasi seperti angkatan’45, lakukan penyuratan bagi toko obat, apotik terhadap distribusi obat- Rancangan keputusan terisi pada SKPD. susnya banyaknya pelajar yang pertahankandanmerebutkemer- dapat menikmati kemerdekaan LVRI, Pepabri,Warakawuri,Viveri, obat yang dilarang beredar. DPRD dan Bupati untuk perse- “Supaya Pemkab Taput bolos sekolah dan meja biliar. Ini dekaan dari tangan penjajah. ini dengan baik. Kepada para Periv, HPCT dan Wirawati Catur Sebanyak 60 jenis obat yang masuk kategori obat terlarang di tujuan bersama atas Ranperda benar-benar melaksanakan pe- generasi muda diharapkan agar Panca. (a15) penyakit sosial yang cepat me- Bendera Merah Putih dapat ber- antaranya obat tradisional pelangsing yang mengandung bahan Taput tentang pertanggungja- ngawasan dilapangan khususnya nular, ujar Reguel. kimia sebanyak 6 jenis, obat suplemen makanan sebanyak 9 jenis, obat tradisonal lainnya yang mengandung bahan kimia 45 jenis. waban pelaksanaan APBD 2008 tertuang menjadi Perda NO 2/ pembangunan fisik tahun 2009. Apalagi Kota Tarutung sebagai Ketua DPRD Taput, FL Fernando Simanjuntak meminta Razia Gabungan Di T.Tinggi, Ratusan Botol Miras Disita Kabid Farmasi Dinkes Samosir J. Sitanggang SSi Apt kepada KB/DPRD-TU/2009 dan NO : ibukota Kabupaten masih terda- Waspada, Kamis (19/8) mengatakan, jumlah toko obat di Samosir Bupati menindaklanjuti reko- TEBINGTINGGI (Waspada): razia selanjutnya disita dan di seluruh kawasan Kota Tebing- 08/SKB/TU/2009,yang ditanda- pat beberapa rumah yang belum mendasi maupun catatan-cata- Ratusan botol minuman keras sebanyak 13 dan Apotik 4. “Toko obat tidak boleh menjual obat tangani Bupati dan Ketua DPRD mempunyai septic tank. Hen- diangkut ke dalam truk untuk tinggiyangdidugamenjaditempat dengan logo merah dan menerima resep tetapi apotik diizinkan,” tan strategis yang tertuang dalam (miras) terjaring dari sejumlah diamankan di Kantor Satpol PP penjualanmiras. Halitudilakukan Taput daknya masyarakat diimbau keputusan legislatif demi pening- warung dan kafe oleh petugas ujar Sitanggang. Padaintinya,limafraksiDPRD sadar sehat,” ujar Reguel seraya Jalan Prof. HM Yamin, SH Kam- menyambut bulan Ramadhan. Bagi toko obat dan apotik dilarang keras mengobati pasien dan katanpelaksanaanpemerintahan, tim gabungan Satuan Polisi pung Keling. Menurut rencana- “Razia akan terus dilakukan Taput dalam pendapat akhir frak- menyebut, ke depan Pemkab pembangunan dan kemasya- Pamong Praja, Polresta Tebing- mendiagnosa selain paramedis yang memiliki izin praktek. Registrasi botol miras dari berbagai jenis untuk menjaga ketenangan sela- sinya menyatakan menyetujui Taput memberi perhatian masa- tinggi, Brimobdasu Detasemen bagi toko obat dan apotik menjadi sumber Pendapatan Asli Daerah rakatansebagaiwujudkepedulian akan dimusnahkan dalam waktu ma bulan Ramadhan,” ujarnya. Ranperda tersebut untuk ditetap- lah hutan terkait dengan IPKTM BTebingtinggidanDenpom,Rabu dekat. Sebelumnyabanyaklaporanwar- (PAD) dari sektor kesehatan, sebut Sitanggang. dalam mengakomodir kepenti- kan menjadi Perda Kabupaten (Izin Pemanfaatan Kayu Tana- (19/8) siang. Kasat Pol PP Djayardi Rinal, , ga yang menyebutkan kafe BidangFarmasiDinkesSamosirsetiapbulantetapmendistribusikan Taput dengan catatan dapat me- man Milik Masyarakat) lebih se- ngan segenap masyarakatTaput. (a13/c12) Ratusan botol miras hasil BE mengatakan, razia dilakukan menyediakan miras. (a09) obat-obatan tergantung permintaan Puskesmas berdasarkan usulan nindaklanjuti pendapat maupun lektifdanberwawasanlingkungan. dari Polindes dan Pustu, tambah Sitanggang.(c10) saran yang disampaikan. Selain itu, Fraksi Partai Golkar
  21. WASPADA Kamis 20 Agustus 2009 Sumatera Utara 21 Penanggulangan Malaria Di Madina Ditingkatkan Dua Pekerja Tewas Terjatuh Ke Sumur PANYABUNGAN(Waspada): tornya, baru-baru ini. danaandanadvokasikepadama- SIBUHUAN (Waspada): Dua saluran air yang rusak. Ipda Kusnadi mengangkat kedua di ruang Unit Gawat Darurat nyoto Harahap melalui Kapolsek Tiga kecamatan di Kab. Man- Menurut Arifin Fauzi, pihak- syarakatluasuntuksemakinsadar pekerja koperasi di Sibuhuan me- Mendengar sahabatnya mayat dan langsung dibawa ke (UGD)mengatakan,keduamayat Barumun AKP H. Herwansyah dailing Natal yakni Panyabungan, nya telah melakukan berbagai dan waspada terhadap malaria. ninggal akibat terjatuh ke sumur jatuh, Hendra Gunawan, 26, RSU Sibuhuan untuk visum. meninggalakibatkehabisanoksigen Putra didampingi Kanit Reskrim Siabu dan Panyabungan Barat upaya dalam pengendalian ma- Arifin Fauzi mengharapkan, berkedalaman 15 meter. Kedua- karyawan Koperasi Kocamar Kepala RSUD Sibuhuan dr. saat berada di dalam sumur. Ipda Kusnadi, membenarkan. tergolong kategori endemis tinggi laria sesuai dengan instruksi agar seluruh elemen masyarakat nya meninggal akibat kehabisan yang berkantor di sekitar lokasi Salikin Kudadiri yang dijumpai Kapolres Tapsel AKBP Pra- . (crif) penyakit malaria, sementara 21 presiden pada peringatan hari harus meningkatkan kepedulian oksigen dalam sumur yang ber- itu juga, segera datang untuk kecamatan lainnya tergolong daerahendemissedangdanrendah. malaria sedunia yang pertama tanggal 25 April 2008 lalu. dan berperan aktif dalam pena- nggulangan malaria sehingga lokasi di belakang gedung Dwi membantu. Namun warga 146 Napi Di LP Kelas II B Sipaga-paga Dapat Remisi Tunggal, Desa Padang Luar, Pekanbaru itu dia juga tergelincir Demikian Kepala Kantor Presiden mengharapkan eliminasi malaria di Madina pada Sibuhuan. dan terjatuh ke dalam sumur PANYABUNGAN(Waspada): tahun 2009. kasus laka lantas dan narkoba,” Pusat Penanggulangan Malaria setiap daerah dapat meningkat- tahun 2020 nanti dapat tercapai. Informasi yang dihimpun, tersebut. Seorang warga yang 146 dari 199 orang narapidana Kalapas Sipaga-paga Panya- katanya. Madina Arifin Fauzi Lubis di kan- kan pendidikan, sosialisasi, pen- (cpin) Selasa(18/8)menyebutkan,sekira berada di lokasi melaporkan ke (napi) yang sedang menjalani bungan B. Basuki, Bc, IP SH kepa- , Basuki menjelaskan, napi pukul 18:30 Eben Ezer Simbolon, Polsek Barumun. hukuman di Lembaga Pemasya- da wartawan di ruang kerjanya, yang berhak memperoleh remisi Puncak Sorik Marapi Potensial 22, warga Rantauprapat yang bekerja di Koperasi DewiTunggal Dengan menggunakan tali dan pengait warga besarta ang- rakatan (LP) Kelas II B Sipaga- paga, Kec. Panyabungan, Kab. Selasa(18/8).“Dari146orangnapi yang menerima remisi, 4 orang adalahnapiyangdalammenjalani masa hukuman tahanan berkela- Untuk Tanaman Holtikultura tergelincir dan terjatuh ke dalam sumur ketika memperbaiki pipa gota Polsek Barumun dipimpin Kanit Reskrim Polsek Barumun Mandailing Natal mendapatkan remisi peringatan HUT ke-64 RI di antaranya mendapatkan re- misi beban langsung yakni dalam kuan baik, dan selalu mengikuti pembinaan. (cpin) PANYABUNGAN (Waspa- nian. Hal ini terbukti apabila kita juga sangat potensial untuk dija- da): Kecamatan Puncak Sorik menelusuri kecamatan ini akan dikan daerah pengembangan Marapi di lereng Gunung Sorik kita jumpai lahan pertanian tanaman holtikultura. Sebenar- Marapi kaya akan sumber daya yang menghijau dan sebagian- nya lahan yang ada di seluruh alam (SDA). Panoramanya yang nya berbukit-bukit. desa yang ada potensinya untuk indah dan udaranya yang sejuk Camat Kec. Puncak Sorik itu semuanya cukup bagus. menambah satu lagi kebanggaan MarapiYahya Hutabarat, SE ke- Akan tetapi yang pernah dicoba masyarakat Mandailing Natal. pada wartawan baru-baru ini dengan lahan yang cukup luas Daerah yang memiliki 11 mengatakan, daerah ini me- adalah di desa Hutabaringin, desa dan dihuni 8.981 jiwa ini mang sangat potensial bagi per- menurut informasi dari masya- merupakan satu daerah yang tanian terutama sawah. rakat setempat hasilnya cukup subur untuk tanaman perta- Dikatakannya, daerah ini bagus. (cpin) Pemkab Madina Proyeksikan RP-APBD TA 2009 Rp 551 M PANYABUNGAN (Waspa- ngan RP-APBD Pemkab Ma- Meski mengalami pengurangan da) : Pemerintah Kabupaten dina itu diajukan Wakil Bupati pendapatan dari pos-pos bagi Mandailing Natal mempro- Drs.H.Hasim Nasution pada ra- hasil dan dana penyesuaian, yeksikan Rancangan Peruba- pat paripurna dewan dipimpin pertambahan pendapatan han APBD TA 2009 menjadi Rp Pl Ketua DPRD Kabupaten Man- justru terjadi dari sektor PAD 551 miliar. dailing Natal AS Imran Khaitamy (pendapatan asli daerah). Proyeksi dana ini di-ajukan Daulay,SH di gedung dewan di Hadir dalam sidang pari- ke DPRD Madina untuk perkantoran Payaloting Panya- purna Kapolres Madina AKBP dibahas dalam rapat panitia bungan,Selasa ( 18/8). Drs.Engkos Kosasih,para kepala anggaran ( Panggar ),Selasa (18/ Dalam pengantar nota ke- SKPD se jajaran Pemkab Ma- 8). uangan itu disebutkan RP-APBD dina serta undangan terkait Draf pengantar nota keua- 2009 sebesar Rp 551 miliar. lainnya. (a24) ICMI Diminta Berperan Aktif PANYABUNGAN (Waspa- Sejatera Panyabungan, Selasa daerah itu untuk menunjukkan da) : Ikatan Cendekiawan Mus- (18/8). kepedulian terhadap kemas- lim Indonesia Kabupaten Man- Menurutnya,ICMI merupa- lahatan umat. dailing Natal diminta dapat ber- kan wadah cendikiawan muslim “ Pembentukan ICMI di Ma- peran aktif dalam menyum- yang selalu mendukungh pem- dina merupakan upaya peng- bangkan pemikirannya untuk bangunan diprogramkan peme- abdian dalam meningkatkan kepentingan dan kemajuan rintah. Sejak dulu, secara nasio- taraf hidup umat melalui pe- pembangunan daerah itu khu- nal ICMI merupakan mitra manfaatan ilmu pengetahuan susnya dalam membangun pemerintah baik dari tingkat dan teknologi untuk memaju- umat yang kuat. pusat maupun ke tingkat kabu- kan dunia pertanian Madina Pengharapan tersebut di- paten / kota sehingga perlu ada sampaikan Ketua ICMI Sumut sebuah kerjasama sebagai mitra menjadi lumbung beras di Su- Prof. Dr. M. Arif Nasution saat untuk mengangkat potensi Ma- mut, kemudian dapat memba- melantik Majelis Pimpinan Dae- dina yang luar biasa itu. ngun perkebunan maupun pa- rah Ikatan Cendikiawan Muslim Sementara Ketua ICMI Ma- brik, perikanan serta UKM demi Se-Indonesia (ICMI) Kabu- dina H.Zulfarmin Lubis,Ak da- kesejahteraan masyarakat paten Mandailing Natal priode lam sambutannya mengajak berbasis ekonomi kerakyatan,” 2009-2014 di Aula Hotel Madina wa-dah cendikiawan muslim katanya. (a24) MUI Dan Muspida Palas Pantau Hasil Operasi Pekat SIBUHUAN (Waspada): mil 08 Barumun, Polisi Pamong penginapan di sekitar ibukota Ketua Majelis Ulama Indonesia Praja (Satpol PP) Padang Lawas Padanglawas pukul 00:00 hingga (MUI) Padang Lawas HM. Arjur berhasil mengamankan enam 04.00. Akbar Nasution bersama Mus- pasangan selingkuh dan seorang Turut meninjau operasi itu pida Padanglawas memantau penjual minuman keras serta Bupati dan Wakil Bupati H. Ali hasil penangkapan operasi pe- 41 botol miras. Sutan Harahap (TSO), Ketua nyakit masyarakat (pekat) yang Kapolsek Barumun AKP H. sementara DPRD Palas H. diamankan di Polsek Barumun, Herwansyah Putra menjelas- Ridho Harahap, Ketua Tim Pe- Sibuhuan, Selasa (18/8). kan, tim gabungan mulai mela- nggerak PKK Padang Lawas Operasi yang dilaksanakan kukan penyisiran ke sejumlah serta para Kadis, Kakan dan satuan Polsek Barumun, Kora- kafe hiburan malam dan lokasi Camat. (crif) Sambut Ramadhan, Atom Enterprise Adakan Khitanan Massal P.BRANDAN (Waspada): Dikatakan, even organizer tali asih sebesar berikut paket Atom Enterprise P. Brandan ini akan memprogramkan pem- sembako. Langkat mengadakan khitanan binaan pemuda sekitar Kota Al Ustadz Abd Wahab da- massal dan memberi bingkisan Pangkalanbrandan agar kreatif lam tausyiahnya mengatakan, Ramadhan kepada warga Pang- dan mencegah meluasnya nar- anak merupakan amalan dan kalanbrandan di Lapangan kotika di kalangan pemuda. Kampung Baru, Sabtu (15/8). Ketua Panitia Pelaksana amanah dari Allah. Penasehat Atom Enterprise Dharma Madia Harahap men- Hadir dalam acara, Camat (AE ) Dicky Siregar mengatakan, jelaskan, khitanan massal tahap Babalan, Lurah Brandan Timur kegiatan ini untuk menyambut awal ini bagi 50 anak dari keluarga Baru M Nafis, Ormas, Pemuda, HUT ke-64 RI dan bulan suci tidak mampu, dan memberikan KNPI Babalan Aliyuddin, para Ramadhan. 50 pasang busana muslim serta Kepling dan lainnya. (c02) Perekap Togel Diringkus P SIANTAR (Waspada): Tiga . Simalungun, AKBP Rudi Hartono hitam, satu unit sepeda motor pria diduga perekap atau pe- saat dikonfirmasi melalui merk Beijing BK 4982 FI, satu ngumpul pesanan angka-angka Pahumas Kompol Ramli Sirait sepeda motor Honda Vario BK judi toto gelap (Togel) diringkus dan Kasat Reskrim AKP Tito Tra- 3186 WI dan uang Rp 176 ribu. Sat Reskrim Polres Simalungun. volta Hutauruk, SH, SIK di Ketiganya sudah ditetapkan Ketiganya adalah DS, 36, Mapolres, Jumat (14/8). sebagai tersangka dan ditahan bertani, warga Nagori Panom- KasatReskrimmenyebutkan, serta dikenakan Pasal 303 KUH bean, Kec. Panombean Pane, Si- dua di antaranya (DS dan Re) PidanayoUndang-undangRIno- malungun, Re, 40, mocok- mantananggotaTNImengumpul mor 7 tahun 1997 tentang pener- mocokwargaJalanKenangaPintu angka-angka tebakan judi Togel tiban perjudian, kata Kasat Air, Kel. Simarito, Kec. Siantar berkeliling dengan mengendarai Reskrim. barat, dan BJP 34, bertani, warga , sepeda motor. Di tempat terpisah, Sat Res- Nagori Bunu Raya, Kec. Panom- Barang bukti dan alat yang kimPolresSimalungunmeringkus tersangka penulis angka tebakan bean Pane, Simalungun. disita tujuh rekap angka-angka judi Togel yakni AP 53, berjualan, , “Ketiganya diringkus ketika Togel, dua dompet, 65 lembar warga Jalan Melanthon Siregar, sedang mengumpulkan/mere- kertas kosong, lima lembar kertas Kel. Pematang Marihat, Kec. kap pesanan angka-angka Togel berisi angka tebakan Togel, dua Siantar Marihat, Kota Pematang- dari para peminatnya di Jalan buku erek-erek, sembilan blok siantar dan tersangka perekap Besar Parlanggean, Kec. Panom- notes kosong, dua notes berisi judiTogel, SS, 47, warga Jalan Na- bean Pane, Simalungun, Kamis angka tebakanTogel, satu pulpen, rumonda, Kel. Karo, Kec. Siantar (13/8)pukul14:00,”sebutKapolres tiga HP Merk Nokia, satu tas Selatan, Pematangsiantar. (a14) Malam Resepsi HUT RI Di Langgapayung KOTAPINANG (Waspada): lain malam itu kepada peserta ribuan orang terdiri siswa siswi Malam resepsi HUT Kemerdeka- yang berprestasi dari masing- SLTA/ sederajat, SLTP/sederajat, an RI ke 64 berlangsung Senin masing cabang olah raga. SD, anggota Militer, PNS, serta (17/8) pukul 20:00 di Lapangan Sementara upacara peringa- dari berbagai OKP serta grup , Kantor Camat Langgapayung, tan HUT ke-64 RI Senin pukul marching band, dan tampak Kec.SeiKanan,KabLabuhanbatu 10:00 berlangsung khidmat di masyarakat juga banyak datang Selatan. Lapangan MHB Jalan Bukit Kota- ketempat uapacara untuk me- Tampak hadir Camat Sei pinang Labuhanbatu Selatan. nyaksikan langsung upacara. Kanan Zulkarnain Siregar S.Sos, Bertindak sebagai Inspektur Usai upacara, peserta upa- Kapolsek AKP Sugeng, Danramil Upacara Ir. Hj.R.Sabrina M.Si Bu- cara mengadakan pawai dengan Kapten R.Rajagukguk serta Ketua pati Labusel, dihadiri Sekdakab iringan marching band melintasi Panitia Lurah Langgapayung Drs.H.Rajab Pasaribu, MM, para Jalan Bukit, Jalan Jenderal Sudir- Arsan Nasution. Kepala SKPD, Kapolsekta AKP man di inti kota, marching band Sejumlah kegiatan pertandi- Eduar SH, serta camat Kotapi- disaksikan unsur Muspida La- ngan olah raga di tingkat kecama- nang SMB Harahap. busel di Jalan Jenderal Sudirman tan, diberikan piala dan hadiah Sedangkan peserta upacara Kotapinang. (c05)
  22. Aceh 22 B. Aceh, Sigli, Bireuen, Lhokseumawe WASPADA Kamis 20 Agustus 2009 Daging Meugang Tabrak Pusaka, Innova Remuk Rp100.000/Kg Di Aceh BIREUEN (Waspada): Toyota Kijang Innova BK 1368 GY nyaris CV. Pusaka BL 7370 PB yang sekira tiga hari belakangan mogok dan BANDA ACEH (Waspada): Harga daging “meugang” remuk akibat menabrak bus CV Pu- diparkir di berem jalan. menyambut bulan suci Ramadhan mulai mahal. Harga- saka yang mogok di jalan lintas Me- Sucipto, rekan korban yang nya mengalami kenaikan 20 persen dibandingkan hari dan-Banda Aceh di kawasan Desa mengaku berdomisili di Kota Lhok- biasanya. Kemarin harga daging ‘meugang’ itu tembus Meusee Kecamatan Kuta Blang seumawe di ruang Instlasi Gawat Rp100 ribu per kilogram. Kabupaten Bireuen, Rabu (19/8) Darurat (IGD) Puskesmas Kuta Sejumlah pedagang daging di Beurawe dan Ulee sekira pukul 05:45 Wib. Blang mengatakan, mobil kijang Kareng, menyebutkan, harga jual daging mulai naik Amatan Waspada di lokasi keja- naas itu bergerak dari Kota Medan dari yang biasa dijual Rp80 ribu per kilogram, kini men- dian, sopir Innova, Dewa, 28, pen- menuju Banda Aceh untuk kepen- jadi Rp100 ribu per kilogram. “Biasanya kalau sudah duduk Surabaya itu hanya meng- tingan bisnis. “Saya mengetahui meugang, selalu naik,” sebut Syarkawi. alami lecet ringan dan tidak harus kejadiaan ini setelah ditelepon dari Kata dia, untuk daging nomor dua juga naik. Kalau mendapat perawatan medis. Se- M. Yani,” ucapnya. sebelumnya Rp75 ribu per kilogram, menjadi Rp95 mentara rekannya, M. Yani pendu- Sementara itu, sopir Kijang Inno- ribu/Kg, begitu pula hati dan limpa dari Rp80 per kilo- duk Komplek Perumahan Mandala, va itu, Dewa yang ditemui Waspada gram ribu, bergerak menjadi Rp100 ribu per kilogram, Medan yang mengalami luka lecet di Kantin Puskesmas Kuta Blang ti- tulang Rp60 ribu per kilogram sebelumnya Rp40 ribu dan mamar segera dibopong warga dak bersedia memberikan keterang- per kilogram. ke Puskesmas Kuta Blang. an kronologis kecelakaan itu. “Maaf Menurut pria yang sudah belasan tahun menjual Informasi yang dihimpun di mas, saya gak bisa memberikan kete- daging di Ulee Kareng ini, puncak hari meugang dua Tempat Kejadian Perkara (TKP), rangan,” ucap Dewa sesaat setelah hari menjelang puasa, yakni Kamis (20/8). “Sejak hari mobil Kijang Innova itu meluncur menelpon sesorang melalui telepon ini sudah ada yang berjualan, Kamis mungkin lebih dari arah Medan dan menabrak Bus selularnya.(cb03) banyak lagi,” kata dia. Syarkawi tak menampik soal kenaikan harga. Pasal- nya, itu sudah menjadi tradisi setiap hari meugang harga Tembak Di Tempat daging di Aceh mengalami kenaikan karena pada saat itu permintaan tinggi. “Biasanya harga ternak sapi, ker- bau melambung menjelang meugang, jadi harga da- Penjahat Bersenjata gingnya juga terpaksa naik,” sebutnya. (b05) SIGLI (Waspada): Kapolres Pi- dapi aparat hukum. Polisi berkewa- die AKBP Moffan, MK, minta aparat . jiban menindak tegas para pelaku Kebutuhan Tenaga Medis penegak hukum di jajarannya un- tuk menembak di tempat pelaku agar ketenangan tercipta kembali di masyarakat. Rutan Bireuen Mendesak Waspada/Amiruddin kejahatan bersenjata api yang akhir- akhir ini meresahkan masyarakat. Namun demikian, Kapolres Pidie menyatakan, dalam melaku- Toyota Kijang Inova BK 1368 GY nyaris remuk setelah menabrak Bus CV Pusaka mogok di jalan lintas Medan - Banda “Kita instruksikan kepada ang- kan tindakannya, aparat kepolisian BIREUEN (Waspada): Penempatan tenaga medis Aceh di kawasan Desa Meusee Kecamatan Kuta Blang Kabupaten Bireuen, Rabu (19/8). di rumah tahanan Bireuen saat ini sudah mendesak. gota, kalau menemukan pelaku ke- sebagai penegak hukum memiliki Pasalnya, jumlah tahanan dan napi Rutan Bireuen ber- jahatan bersenjata api, seperti pe- aturan-aturan sesuai prosedur status kelas II B dengan kapasitas menampung 65 peng- rampokan dengan senjata api, kita yang berlaku di Negara Kesatuan huni sedang melebihi kapasitas mencapai 180 orang. Sedangkan jumlah personel (petugas) rutan minim tak mungkin mengawal tahanan dan napi yang mengalami sakit dibawa berobat ke rumah sakit. Mem- bawa tahanan dan napi yang sakit ke rumah sakit beresi- Bandar Ganja Aceh perintahkan tembak di tempat,” ka- tanya kepada sejumlah wartawan di ruang kerjanya, Selasa (18/8). Kapolres Pidie menyatakan hal itu guna menyikapi maraknya aksi Republik Indonesia (NKRI).” Kita ada aturan dalam bertindak, yaitu polisi membidik sasaran tepat melumpuhkan bandit-bandit yang mengganggu ketenangan masya- Ditangkap Di Jakarta ko tinggi bagi petugas rutan hanya memiliki tenaga perampokan bersenjata api, khu- rakat,” tegas Moffan. satu regu (5 orang) tak mungkin membawa tahanan/ sunya menjelang Megang puasa, Ia mengungkapkan, dalam napi ke rumah sakit. Resiko yang dihadapi petugas rutan seperti terjadi beberapa waktu lalu upaya pihaknya meminimalisir yang minim dikhawatirkan para tahanan/napi akan yang menimpa seorang pengusaha tindakan criminal ditengah-tengah kabur menjadi bumerang bagi petugas rutan sendiri. di Desa Paru, Kec. Bandar Baru, masyarakat menjelang Ramadhan Kepala Rutan Bireuen Ruseno, SH yang dikonfirmasi Kab. Pidie Jaya. dan Idul Futri, jajaran Polres Pidie di kantornya Rabu (19/8) menyatakan, kebutuhan agar JAKARTA (Waspada) : Seorang pria diketauhi sebagai bandar ganja yang nemukan barang haram tersebut. Menurut Moffan, aksi kom- telah mulai meningkatkan patroli- ditempatkan tenaga medis berikut sarana medis, obat- memasok untuk daerah Jawa Barat Tersangka pun menyangkal jika dia plotan perampokan bersenjata, patroli, terutama di pusat-pusat asal Aceh diduga bandar ganja, AZ yang akhir-akhir ini melakukan aksi keramaian pada Bulan Ramadhan obatan di Rutan Bireuen sudah diusulkan ke Pemkab dan Jakarta. telah menerima kiriman ganja setempat, bahkan pihaknya sudah menyiapkan fasilitas ditangkap aparat Kepolisian Polsek Selama sepekan, polisi mengin- seperti yang dituduh-kan polisi. kriminalnya itu diduga pemain dengan menggunakan sepeda tempat yang memadai di rutan. Metro Limo, Polres Metro Depok, tai AZ, akhirnya berhasil dibekuk dan Petugas yang tidtak percaya be- lama yang sudah pernah mengha- dayung.(b20) Memperingati HUT RI ke-64 sebanyak 87 orang Jawa Barat, ketauhan menyimpan mendapatkan barang bukti yang di- gitu saja, menyisir bagian luar ru- napi mendapat remisi (pngurangan tahanan). Remisi itu diserahkan Bupati Bireuen Drs Nurdin Abdul Rah- daun ganja kering seberat 165 kilogram di rumahnya di Jalan H. simpannya dengan cara mengubur- nya guna mengelabui petugas. mah, tepatnya di kebun pisang yang