SlideShare a Scribd company logo

ELLE DECOR - April 2023

•
•
L
Lucky Gods

Elle Decor - April 2023: Get Jeweled in Lisbon & Waltz Back in Time with Elton John's Collaborator ️ Brace yourself for dazzling design journeys across continents! This month's Elle Decor takes you on a whirlwind trip, from a Lisbon pied-à-terre shimmering like a jewel box to an 18th-century New York gem resurrected with rockstar style. ✨ First, we're whisked away to Lisbon's sun-drenched streets, where jewelry star Matthew Harris has crafted a pied-à-terre that sparkles with personality. Get ready to be blinded by bold colors, statement pieces, and an unexpected dash of whimsy – this home is a true masterpiece of creative expression! Next, we hop across the Atlantic to a historic New York townhouse, where renowned designer Antony Todd, collaborator extraordinaire to none other than Elton John, breathes new life into its ancient bones. Prepare to be swept away by timeless elegance, modern touches, and a whisper of rock 'n' roll magic – this is interior design with a legendary backstory! This issue is a treasure trove of design inspiration! Get ready to: Uncover the secrets to creating a jewel-toned oasis in Lisbon. Discover how to infuse an 18th-century home with modern sensibilities. Be inspired by the power of bold colors, statement decor, and unexpected twists. Find endless ideas for injecting your own home with personality and history. So grab your passport (and sunglasses!), flip through these pages, and let your design wanderlust take flight! ✈️

Design
1 of 131
Download to read offline
🌟Welcome to Your Journey of Ultimate Wellness! 🌈💖 Thank you for choosing our ebook/magazine! 📘✨To enhance your health and beauty experience, we've curated some phenomenal products that promise to elevate your well-being. 🌺🌟 Skincare Saviors: Hydrossential - Unique Beauty Serum: 💦One Simple Way To Maintain A Flawless Skin. Link: https://mas.so/hydrossential Sun-Kissed Confidence: Totally Bangin' Tan by Turbo Babe: ☀️Go From “Pale Princess” to “Golden Goddess” with this Anti-Aging Sunless Tanning. Link: https://mas.so/bangin Hairraisingly Healthy: FoliPrime - The Natural Egyptian Hair Balm: 💆‍♀️Supports Hair Health. Link: https://mas.so/foliprime Men's Wellness Wonders: Endo Pump - Male Enhancement MONSTER: 💪U.S. Scientists Discover Secret For Stamina & Virility At Any Age. Link: https://mas.so/endopump African “Sex Monkeys” Unveil How To Reverse Erectile Dysfunction So You Can Have A Rock Hard Erection Again And Last At Least 30 Minute In Bed! (Note: Due to the potentially offensive language, I recommend considering revising this title and description.) Link: https://mas.so/edprotocol Conquer Health Concerns: MenoRescue: 🧘‍♀️Support healthy hormone levels with MenoRescue™. Formulated using the latest Ivy League research. Link: https://mas.so/menorescue GlucoFence - Blood Sugar Support: 🛡️#1 Most Hated By Big Pharma , Rogue Doctor Fixes Type 2 Diabetes. Link: https://mas.so/glucofence Bonus Goodies: NEW '23: Archangel Health Prayers for 400 Diseases, Weight Loss... Link: https://mas.so/archangels Natural Therapy With Killer VSL & Captivating Hook That Converts Like Crazy For Both Health & PD Niches! Powerful Therapy Based On Acupuncture. New Non- Invasive Alternative. To Electro-Acupuncture, Producing Astounding Results… Self- Application Is Easy, Rapid Response. Link: https://mas.so/naturaltherapy Every Morning This Ancient Amazonian “Drip Method” Is Being Used To Support Healthy Weight Loss. Link: https://mas.so/ignite The "Hidden Survival Muscle" In Your Body Missed By Modern Physicians That Keep Millions Of Men And Women Defeated By Pain, Frustrated With Belly Fat, And Struggling To Feel Energized Every Day… Link: https://mas.so/hipflexors Meditation - "InnaPeace Meditation Program" : The InnaPeace Program for Anxiety Sufferers, Discover why thousands are flocking to what experts are calling “the most advanced self-development method known to human kind”. Link: https://mas.so/innapeace Don't miss out on these amazing products! Click the links above and start your journey to a healthier, happier you! Don't let shortened links with mas.so send shivers down your spine! 🥶It's just a friendly URL shrinker, like a superhero packing superpowers into a tiny suit. 💪👀Fear not, visit https://mas.so and see what mas.so is. ✨Then, click with confidence and discover your favorite products! 🗺️Trust needs to be built on the first click. Thanks!💎
www.akris.com
In-store interior design & 3D modeling services.(1) Quick Ship program available.(2) Mah Jong Outdoor. Modular sofa, designed by Hans Hopfer. Upholstered in Jean Paul Gaultier outdoor fabrics, Autour du Monde collection. Bases in metal openwork, lacquered, in black-color satin finish. Bilboquet. Pedestal table, designed by Kateryna Sokolova. Made in Europe.
French Art de Vivre Photos by Michel Gibert, Baptiste Le Quiniou, for advertising purposes only. (1) Conditions apply, contact store for details. (2) Quick Ship Program available on select products in stock, subject to availability. Images are for reference only and models, sizes, colors and finishes may vary. Please contact your local store for more information. Fabrics by
RENAISSANCE – STA X – PAVÉFLEX
d a v i d y u r m a n . c o m
CALIFORNIACLOSETS.COM | 866.221.0415 | VISIT A SHOWROOM | COMPLIMENTARY IN-HOME DESIGN CONSULTATION MAKE ROOM FOR ALL OF YOU ©2023 California Closet Company, Inc. All rights reserved. Each California Closets® franchised location is independently owned and operated. California Closet Company, Inc., 1414 Harbour Way S, Suite 1750, Richmond, CA 94804 USA.
hunterdouglas.com j+XQWHU'RXJODV$OOWUDGHPDUNVXVHGKHUHLQDUHWKHSURSHUWRI+XQWHU'RXJODV
:KDWGRHVLWPHDQWROLYHZHOO7REHSHUIHFWODWHDVHLQFRPIRUWDQGVWOH ,QQRYDWLYHSURGXFWGHVLJQVSDLUZLWKJRUJHRXVIDEULFVDQGFRQWUROVVWHPVVRDGYDQFHGVKDGHVFDQEHVFKHGXOHG WRDXWRPDWLFDOODGMXVWWRWKHLURSWLPDOSRVLWLRQWKURXJKRXWWKHGDUHDWLQJDQHZZRUOGRIEHDXWFRQYHQLHQFH DQGHQHUJHƜFLHQFŢPRUQLQJQRRQDQGQLJKW LIVE BEAUTIFULLY Pirouette® Window Shadings with PowerView® Automation
Subscribe to ELLE DECOR at elledecor.com/join CONTENTS APRIL 2023 E L L E D E C O R 22 WILLIAM JESS L AIRD. FOR DETAILS, SEE RESOURCES THE DESIGNERS AT HOME ISSUE 74 A REAL GEM See how jewelry star Matthew Harris fashioned a pearl of a pied-à-terre in the center of Lisbon. BY TANYA DUKES DESIGNER MATTHEW HARRIS 80 MEET THE PARENTS Garrett Hunter brings a light touch and a big heart to a historic Los Angeles renovation for his mother and father. BY ANNA FURMAN DESIGNER GARRETT HUNTER 88 BIG EASY ELEGANCE At home in New Orleans, designer Michelle R. Smith’s decorating secret weapon is restraint. BY CAMILLE OKHIO DESIGNER MICHELLE R. SMITH 98 LIFE’S RICH TAPESTRY On the eve of a new book of her mother’s latest work, Kate Rheinstein Brodsky reflects on being raised by legendary designer Suzanne Rheinstein. BY KATE RHEINSTEIN BRODSKY 102 IT’S STILL STANDING Antony Todd—who has collaborated with none other than Elton John—breathes new life into his 18th-century New York home. BY TED LOOS DESIGNER ANTONY TODD 110 TUDO BEM! Captivated by the allure of Lisbon, a globe- trotting design entrepreneur puts down roots in an aristocrat’s former residence. BY JULIE LASKY DESIGNER ELAD YIFRACH In the living room of designer Michelle R. Smith’s New Orleans home (page 88), the custom sofa is upholstered in a Loro Piana velvet, and the live- edge cocktail table is by Andrianna Shamaris.
E L L E D E C O R 24 C O N T E N T S DANIEL SCHÄFER 32 EDITOR’S LETTER 35 WHAT’S NEXT Objects that make the most of recycled components. Plus: A new Stockholm flagship for rug brand Nordic Knots 40 FASHION + FURNITURE The most curvaceous outdoor furniture you’ll find, as well as pieces in every shade of green 44 THE AGENDA What’s shaping our tastes and topping our to-do lists this month 48 JEWELRY BOX David Yurman’s Carlyle collection brings razzle-dazzle with a Deco twist 50 SHORTLIST Book Club: The Next Chapter star Candice Bergen shares eight things she can’t live without 52 COLLAB TO COVET Designer Barry Dixon mines entomology and ancient history to craft modern heirlooms for Arteriors 56 HOUSE CALL For his sweetheart and her sister, Andre Herrero creates a chic pied-à-terre in West Hollywood 65 BUILDER What’s the secret to gardening more sustainably? Let Mother Nature lead the way. BY TIM MCKEOUGH In the design studio of L’Objet founder Elad Yifrach’s Lisbon home (page 110), the African chair is antique, the vase is from L’Objet, and the 19th-century tiles are Portuguese.
elledecor@hearst.com @elledecor facebook.com/ELLEDECORmag WRITE TO US: Mailbox, ELLE DECOR, 300 W. 57th St., 27th Fl., NY, NY 10019 Visit elledecor.com/service to order a print subscription, pay your bill, renew your subscription, update your mailing and email addresses, and more. Or write to: Customer Service Department, ELLE DECOR, P.O. Box 6000, Harlan, IA 51593. One-year subscription rate $15 for U.S. and possessions, $41 for Canada, and $60 for other international. To purchase digital back issues, please go to backissues.elledecor.com. E L L E D E C O R 26 C O N T E N T S CHRIS MOT TALINI The dining room of the midcentury Los Angeles home that Garrett Hunter renovated for his parents (page 80) features a sofa by Archizoom Associati for Poltronova. 118 RESOURCES 120 MY KIND OF ROOM Designer Harry Nuriev finds himself enraptured with the kitchen of a priory in France 68 FURNITURE FANTASY As winter wanes, a family luxuriates in Palm Springs on Janus et Cie’s latest outdoor furniture. PRESENTED BY JANUS ET CIE Scan the QR code to join ELLE DECOR All Access for exclusive digital home tours and more! ON THE COVERS LEFT: Michelle R. Smith in the dining room of her New Orleans home; long shirt and trousers by Attersee, shoes by Manolo Blahnik. RIGHT: Matthew Harris in the living room of his Lisbon apartment, wearing Saint Laurent. PHOTOGRAPH (LEFT) BY WILLIAM JESS LAIRD PHOTOGRAPH (RIGHT) BY MAUREEN M. EVANS
E L L E D E C O R 28 ASAD SYRKETT EDITOR IN CHIEF EXECUTIVE EDITOR Ingrid Abramovitch EXECUTIVE MANAGING EDITOR Jeffrey Bauman DESIGN DIRECTOR Erin Knutson DEPUTY EDITOR Sean Santiago STYLE DIRECTOR Parker Bowie Larson DEPUTY EDITOR, DIGITAL Anna Fixsen SENIOR INTERIORS EDITOR Bebe Howorth ARTICLES EDITOR Charles Curkin SENIOR DESIGN WRITER Camille Okhio DEPUTY DESIGN DIRECTOR Allie Adams MARKET EDITOR Helena Madden ASSISTANT MANAGING EDITOR Lillian Dondero COPY CHIEF Lisa DeLisle ASSISTANT EDITOR, DIGITAL Rachel Silva EDITORIAL ASSISTANT Sofia Quintero DIGITAL IMAGING SPECIALIST Kevin Arnold HEARST VISUAL GROUP CHIEF VISUAL CONTENT DIRECTOR, HEARST MAGAZINES Alix Campbell VISUAL DIRECTOR Audrey Levine SENIOR VISUAL EDITOR Nelida Mortensen DEPUTY VISUAL DIRECTOR Marina Schoger VISUAL ASSISTANT Natalie Boyce ELLE DECOR CONTRIBUTING EDITORS CONSULTING EDITOR Daniel Boulud CONTRIBUTING DESIGN EDITOR Senga Mortimer CONTRIBUTORS Alyse Archer-Coité, Chesie Breen, Marella Caracciolo Chia, Jerald Cooper, Tanya Dukes, Christopher Garis, Nancy Hass, Patricia Hearst, Kathryn M. Ireland, Kelsey Keith, Mercedes Kraus, William Li, David Netto, Judi Roaman, Alex Tieghi-Walker, Bunny Williams, Gisela Williams STELLENE VOLANDES EDITORIAL DIRECTOR INTERNATIONAL COORDINATOR Monique Boniol PRODUCTION OPERATIONS DIRECTOR Chris Wengiel PRODUCTION MANAGER David Brickey PUBLISHED BY HEARST PRESIDENT CHIEF EXECUTIVE OFFICER Steven R. Swartz CHAIRMAN William R. Hearst III EXECUTIVE VICE CHAIRMAN Frank A. Bennack, Jr. CHIEF OPERATING OFFICER Mark E. Aldam HEARST MAGAZINE MEDIA, INC. PRESIDENT Debi Chirichella GLOBAL CHIEF REVENUE OFFICER Lisa Ryan Howard CHIEF CONTENT OFFICER Kate Lewis CHIEF FINANCIAL AND STRATEGY OFFICER; TREASURER Regina Buckley SENIOR VICE PRESIDENT, CONSUMER REVENUE DEVELOPMENT Brian Madden PRESIDENT, HEARST MAGAZINES INTERNATIONAL Jonathan Wright SECRETARY Catherine A. Bostron PUBLISHING CONSULTANTS Gilbert C. Maurer, Mark F. Miller CUSTOMER SERVICE CALL: 800-274-4687 EMAIL: EDCcustserv@cdsfulfillment.com VISIT: elledecor.com/service WRITE: Customer Service Dept., ELLE DECOR P.O. Box 6000, Harlan, IA 51593 Published at 300 West 57th Street, New York, NY 10019. Tel: 212-649-2000. ELLE® and ELLE DECOR™ are used under license from the trademark owner, Hachette Filipacchi Presse. Printed in the USA. For information on reprints and e-prints, please contact Brian Kolb at Wright’s Reprints, 877-652-5295 or bkolb@wrightsreprints.com. TWIST GLASSES $560 per pair. louisvuitton.com ROYAL OAK SELF-WINDING TOURBILLON Price upon request. audemarspiguet.com LEGGERA OUTDOOR CHAIR BY GIO PONTI $2,050. cassina.com
Explore Spring 2023 at Arhaus.com
E L L E D E C O R 30 JENNIFER LEVENE BRUNO SENIOR VICE PRESIDENT, GROUP PUBLISHING DIRECTOR VICE PRESIDENT, SALES David Hamilton VICE PRESIDENT, MARKETING SALES STRATEGY Julia Fry EXECUTIVE DIRECTOR, BRAND PARTNERSHIPS DEVELOPMENT Hillary Koota Krevlin EXECUTIVE DIRECTOR, SALES MARKETING STRATEGY Angela Jett Okenica EXECUTIVE DIRECTOR, NATIONAL DIGITAL SALES Tara Weedfald GROUP MARKETING DIRECTORS Esther Deming, Matthew Hare GROUP FINANCE DIRECTOR Christopher J. Tosti DIRECTOR, ADVERTISING SERVICES Merrill Diamond SALES EXECUTIVE SALES DIRECTOR, HOME APPLIANCES, FINANCE TRAVEL Taylor Rae Berish EXECUTIVE SALES DIRECTOR, MIDWEST Donna Schultz EXECUTIVE SALES DIRECTOR, HOME FURNISHINGS Jon Walker SALES DIRECTOR, RETAIL, BEAUTY, WINE SPIRITS Kristin Cassidy SALES ASSISTANTS Bianca Bonetti, Cierra McMahan, Yvonne Villareal MARKETING CREATIVE DIRECTOR Glenn Maryansky ASSOCIATE MARKETING DIRECTOR Mary Kate Murray SENIOR MARKETING MANAGER Jessica Platz MARKETING MANAGER Julia McColligan ASSOCIATE MARKETING MANAGER Katie Fritz MARKETING COORDINATOR Lizzie Roswig U.S. BRANCH OFFICES SOUTHEAST Whitney Otto, Jackie Orwig-Teall, Blaze, Otto Associates, 704-651-1204 SOUTHWEST Virginia Davis, Wisdom Media, 214-526-3800 WEST COAST Cynthia McKnight, CM Media Sales, 310-291-2730; Kurt DeMars, DeMars Media, 415-990-1999 INTERNATIONAL OFFICES ITALY Roberta Battocchio, Global General Manager, 39-02-6619-2327, rbattocchio@hearst.it; Lavinia Cerutti, Head of Editorial Coordination for International Editions, Via Bracco 6, 20159 Milano, 39-02-6619-2935, lcerutti@hearst.it UNITED KINGDOM Ben Chesters, Head of Global Sales, Hearst Global, 72 Broadwick Street, London, W1F 9EP, 44-20-7439-0000, ben.chesters@hearst.co.uk HEARST DIRECT MEDIA VICE PRESIDENT, GROUP EXECUTIVE DIRECTOR Christine L. Hall SALES MANAGER Gina Pisacreta CONSUMER MARKETING VICE PRESIDENT Rick Day ASSOCIATE DIRECTOR, RESEARCH Lenore Montaperto ADVERTISING PRODUCTION PRODUCTION MANAGER David Brickey TRADEMARK NOTICE ELLE® AND ELLE DECORATION™ ARE USED UNDER LICENSE FROM THE TRADEMARK OWNER, HACHETTE FILIPACCHI PRESSE, A SUBSIDIARY OF LAGARDÈRE SCA. A DIVISION OF CEO Constance Benqué CEO ELLE INTERNATIONAL LICENSES François Coruzzi SVP/INTERNATIONAL DIRECTOR OF ELLE ELLE DECORATION Valéria Bessolo Llopiz CREATIVE DIRECTOR OF ELLE DECORATION Linda Bergmark MARKETING DIRECTOR OF ELLE ELLE DECORATION Morgane Rohée DIGITAL GRAPHIC DESIGN DIRECTOR OF ELLE ELLE DECORATION Marine Le Bris SYNDICATION DIRECTOR Séverine Laporte SYNDICATION COORDINATOR Johanna Jegou COPYRIGHTS MANAGER Kenza Allal PIXELLE DATABASE MANAGER Pascal Iacono INTERNATIONAL AD SALES HOUSE: LAGARDÈRE GLOBAL ADVERTISING SVP/INTERNATIONAL ADVERTISING Julian Daniel jdaniel@lagarderenews.com MELOR CHANDELIER BY COLIN KING $1,590. hvlgroup.com HACKER 1 VASE #4 BY MANUEL COLTRI $12,635. artemest.com GOLD AND CERAMIC DIAMOND RING AND DIAMOND STACKING RING SET $2,550 and $3,200. lagos.com
KOA IVORY RUG STARKCARPET.COM 844.40.STARK STAIN RESISTANT EASY TO CLEAN HIGH-END PERFORMANCE
@as4d E L L E D E C O R 32 E D I TO R ’S L E T T E R FROM LEFT: MARCUS MORRIS; DANIEL SCHÄFER H ere at E L L E DECOR , designers and decorators are always the stars of our show. So you can imagine how much the team relishes the voy- euristic pleasure of assembling our Designers at Home issue. There’s the alluring opportunity to discover insider secrets—the specific antiques and vintage finds, textiles, tile, and more the experts select for themselves. And there’s also the chance to see how top talents with diverse aesthetic sensibilities decide to rest their eyes, away from professional mood boards and meetings. As we worked on the issue, a theme emerged: a sense of calm. And with chaos reigning in the outside world, what could be more seductive at home than that? Don’t get me wrong—“calm” doesn’t equal “quiet.” In each of the homes in this issue, there is texture and color deployed intelligently, and at full voice, not at a whisper. (If you need another reference point for the power and prominence of this kind of design thinking right now, you can look to the latest fashion runways in Milan and Paris.) Perhaps a better analogy for the lush, layered homes in these pages isn’t auditory, but tactile: rooms that look the way cashmere or velvet feels; rooms with true depth and an enveloping appeal—plus details that keep you coming back for closer inspection. Our two swoon-worthy cover stories both embody this idea— and how. In New Orleans, interior designer Michelle R. Smith’s family home, a Greek Revival pile in the city’s Garden District, is an eleganza extravaganza. The Louisiana native, who studied under decorating icon Daniel Romualdez, combines antiques and contemporary touches to KNOCK, KNOCK astonishing effect. I’ll be thinking about her vintage dining chairs, draped in smart navy- and-cream slipcovers, for a long time. And because jewelry design is an obses- sion of ours at ELLE DECOR, we stopped in at the Lisbon pied-à-terre of our second cover star, Matthew Harris, founder of Mateo. There, he magicked up a pared-back space that takes inspiration from his work and—surprise!— nods to his next endeavor: creating decorative accessories for the home. There’s so much to pore over in this edi- tion of the magazine. We hope you have as much fun peeking behind the curtain as we did. Come on in. You’re invited. ◾ Designer and L’Objet founder Elad Yifrach’s handsome Lisbon bedroom (page 110).
800 620 8490 | OFFICINEGULLO.COM THE QUINTESSENTIAL KITCHEN
35 E L L E D E C O R THE BEST DESIGN DISCOVERIES BY PARKER BOWIE LARSON PHOTOGRAPHS BY SHARON RADISCH STYLED BY REBECCA BARTOSHESKY FULL CIRCLE Five new launches make the most of components that are recycled, repurposed, and ready for the spotlight. CAST GLASS Water Illusion vase by Assia Karaguiozova for Poltrona Frau. 12″ w. x 12″ h.; $840. poltronafrau.com
36 E L L E D E C O R W H AT ’S N E X T FELLED TREES Hand-carved black walnut chair by Ian Love Design. 25″ w. x 22″ d. x 28″ h.; $5,500. verso-works.com PAPER PULP Satellite Uplighter by Palefire Studio. 16″ dia. x 13″ h.; $746. palefirestudio.com RECYCLED POLYESTER Skynest pendant light by Marcel Wanders for Flos. 36″ dia. x 8″ h.; $4,345. flos.com FABRIC REMNANTS Bruco sofa by Studio Campana for Paola Lenti. 83″ w. x 31″ d. x 28″ h.; $13,365. paolalenti.it
MOLTENIC FLAGSHIP STORES 160 MADISON AVE, NEW YORK NY 10016, T 212 673 7106 — 4100 NE 2ND AVE, SUITE #103-203, 33137, MIAMI, T 786 652 1500 — SHOP.MOLTENI.IT BOSTON CHICAGO DALLAS HOUSTON LOS ANGELES MEXICO CITY BOGOTÀ moltenigroup.com
E L L E D E C O R 38 W H AT ’S N E X T TOP: MAGNUS MÅRDING WHEN INTERIOR DESIGNER AND ARCHITECT GIANCARLO VALLE first saw the space that would become the new Nordic Knots flagship showroom—a vacant early-20th-century movie theater in Stockholm’s design district—he felt instant chemistry. “There was so much worth keeping, and I could see it would take only a light touch to give it a more modern edge,” Valle says. That feeling reminded him of his first meeting with husband and wife Fabian Berglund and Liza Laserow, who founded the local label along with Fabian’s brother, Felix. Their creative synergy led to a new rug collection by the designer, launched earlier this year, as well as the stately new headquarters to house the brand’s cost- conscious New Zealand–wool and jute rugs. Valle adopted a less-is-more approach to the historic space in an effort to let its unique architecture and eye-catching details take center stage. Rich green marble walls and terrazzo flooring in the lobby are now offset by a sleek metal coffee bar and seating, a nod to the region’s pewter traditions. Warm wood accents throughout pay homage to the pine furnishings that were popular in the 1920s and ’30s. The approach felt only natural for Nordic Knots, which has fused Swedish craft traditions with cozy Scandinavian minimalism since its founding in 2016. WEAVERTAKESITALL A Swedish rug brand scores big with a dramatic new Stockholm HQ by designer Giancarlo Valle. Nordic Knots cofounders Liza Laserow and Fabian Berglund in the new Stockholm showroom (seen above). nordicknots.com The overall effect is more residential than commercial, and that’s the point. “We wanted it to feel as if you are entering our home,” Laserow says. “Our showroom is a place where you can feel at ease, retreat, and hopefully come to be inspired.” —Helena Madden
LUXURY P ERF O RM A NC E FA B RI C S A ND RUGS P ER ENNI A L SFA B R I C S .C O M
E L L E D E C O R 40 FAS H I O N + F U R N I T U R E COOL CURVES AHEAD Considering a springtime splurge on a Kagan sofa or a kidney- bean cocktail table? Good news: You can now bring the no-straight-lines trend out of your living room and onto your backyard terrace. Take the look a step further by adding a touch of wicker, which trended on the spring runways, into the mix. —Helena Madden Ribbon curved sofa. 126″ w. x 30″ d. x 35″ h.; price upon request. launlosangeles.com Temps Calme Outdoor sunbed. 34″ w. x 61″ d. x 30″ h.; $4,380. roche-bobois.com Flair O’ chair by Monica Armani. 24″ w. x 24″ d. x 29″ h.; $2,680. bebitalia.com French Braid hanging chair by Sasha Bikoff. 69″ w. x 53″ d. x 52″ h.; $7,989. walterswicker.com Balmain’s spring/summer 2023 show brought wicker to the runway. Rondo lounge chair. 26″ w. x 27″ d. x 32″ h.; $1,398. janusetcie.com
E L L E D E C O R 42 FAS H I O N + F U R N I T U R E GETYOUR POWER GREENS Outdoor furniture that’s as lush as the leaves and trees? Yes, please. Pair classic gray with eye-popping chartreuse, deep forest, or zingy lime—the juicy hues du jour this season. And if you’re really head over heels for botanicals, there’s an outfit for that. —H.M. Contoured Chaise by Walter Lamb. 28″ w. x 66″ d. x 32″ h.; $1,525. brownjordan.com Ridge lounge chair. 41″ w. x 36″ d. x 31″ h.; $2,495. bludot.com Daydream daybed by Richard Frinier. 85″ w. x 54″ d. x 83″ h.; $13,735. dedon.us Loewe’s acclaimed spring/summer 2023 looks include fabricated anthur- ium blooms. Crosshatch lounge chair by EOOS. 31″ w. x 30″ d. x 26″ h.; $2,595. dwr.com
E L L E D E C O R 44 W H AT ’S N E X T FROM TOP: ANDREW GEMMA INGALLS; CHRISTIAN HARDER THEAGENDA What’s shaping our tastes and topping our to-do lists this month. SHOP: LA NYC CULT OF CHIC Since launching Cult Gaia—made famous by the bestselling bamboo Ark bag—in 2012, Jasmin Larian Hekmat has turned her brand into a fashion force with everything from dresses to shoes. A new pair of flagship stores, in New York’s SoHo and on Melrose Avenue in Los Angeles, showcase her theatrical styles in suitably dramatic backdrops. The West Coast branch was designed by Alexis Brown and Anno Mille. “We tried to make it feel monumental,” says Brown, who referenced Roman and Greek archi- tecture. The space features onyx mosaic flooring, silver Roberto Matta puzzle fur- niture, and a goddess sculpture on the roof. Adds Brown: “We really got into the ritual references.” –Ingrid Abramovitch cultgaia.com DINE: NYC ROMAN HOLIDAY Spread across 6,500 square feet on the third floor of the Shops at Columbus Circle, Bad Roman is a superbly atypical red-sauce joint from the Quality Branded group. The space “winks at Italian visual culture with no pretense to correctness,” says Rustam Mehta, founding partner of GRT Architects, the firm behind the restaurant’s outré interiors. Guests are greeted by a large boar statue collared in neon, modeled after the Uffizi gallery’s Porcellino, while the dining room’s strigil motif is rendered in plaster and echoed in the curving banquettes and light fixtures. “Every opportunity to do a little more was taken,” Mehta says. –Sean Santiago badromannyc.com Cult Gaia’s flagship store in Los Angeles. The Bad Roman dining room in New York City.
hvlgroup.com Sacramento Chandelier Leif Sconce Troy Lighting
E L L E D E C O R 46 W H AT ’S N E X T CLOCK WISE FROM TOP: SHANIQWA JARVIS; DARIA KLEPIKOVA; FR ANCISCO NOGUEIR A; CLÉMENT CHEVELT; GET T Y IMAGES LISBON MATTHEW HARRIS “The Museum of Art, Architecture, and Technology [above] is an architectural masterpiece. I adore the art, and it’s so lovely to sit on the terrace for lunch and watch the sail- boats pass by. Also, Rua de São Bento has great stores like Velharias de António Azevedo for 17th- and 18th-century Portuguese furniture.” maat.pt We asked three designers—two with homes in this issue—for their favorite spots in this dynamic style destination. ELAD YIFRACH “A favorite Lisbon gallery is Made in Situ, designer Noé Duchaufour- Lawrance’s exploration of materials and Portuguese craft [above]. For contem- porary art, Galeria Francisco Fino is the best; the owner has a great curating eye and a beautiful roster of Portuguese artists.” madeinsitu.com; franciscofino.com JOANA ASTOLFI “As an architect, I’m always inspired by the Calouste Gulbenkian Museum. It cel- ebrates 1950s architecture, where concrete, wood, and glass come together in per- fect harmony. For a night out, I love Rocco restaurant [above]. The food is good, and the interior design is playful, warm, and cozy.” –I.A. gulbenkian.pt; rocco.pt STAY: MILAN HALLOWED HALLS Known for its iconic Italian fashion brand, the Ferragamo family also owns the Lungarno Collection, a group of stylish hotels. The latest to open, Portrait Milano, is the result of an ambitious restoration of a 1564 building that is a former archiepiscopal seminary. Milanese architect Michele De Lucchi led the four- year renovation of historic elements like a Baroque entrance and loggia, while Michele Bönan oversaw the decoration of the property’s 73 rooms, which overlook an internal piazza and garden. The mas- sive project is opening in stages, with a restaurant coming soon, and a spa and a swimming pool excavated from the semi- nary’s old basement dining hall expected by this summer. –I.A. lungarnocollection.com SEE: BOSTON IN FULL VIEW Fresh off her historic turn representing the United States at last year’s Venice Art Biennale, Simone Leigh’s first dedicated museum survey is on view at the Institute of Contemporary Art/ Boston through September 4. The exhibition will encompass pieces from almost 20 years of the New York–based artist’s practice and includes key examples of her ceram- ics, bronzes, videos, and installations. “Although this is the first survey dedi- cated to Leigh, the work has always been there,” said Eva Respini, ICA deputy director for curatorial affairs, in a statement. “Its impact and power can no longer be denied.” –S.S. icaboston.org TICKET TO Artist Simone Leigh. A loggia at the Portrait Milano hotel.
48 E L L E D E C O R J E W E L RY B OX PHOTOGRAPH BY SHARON RADISCH STYLED BY REBECCA BARTOSHESKY Necklace, ring, and earrings from the David Yurman Carlyle collection. From $1,200. davidyurman.com CHAIN REACTION The Carlyle collection from David Yurman takes its design cues from the New York City hotel of the same name—the launch campaign starred Scarlett Johansson on location at its iconic Bemelmans Bar—refracting Jazz Age elegance through an archi- tectural sensibility. A riff on Yurman’s signature cable motif, Carlyle’s silver and gold hexagonal links feature knife-edge faceting and contrasting matte finishes that subtly evolve the brand’s history of mixing metals. Ever practical, the links are open on the underside, minimizing the weight of each piece while maximizing its aesthetic impact. It’s razzle-dazzle with a Deco twist. —Sean Santiago
Nooch sofa system, design Piero Lissoni. bebitalia.com
E L L E D E C O R 50 S H O R T L I S T AS TOLD TO SEAN SANTIAGO PORTR AIT: JESSE DIT TMAR/REDUX; WATCH: COURTESY OF ROLEX VIA GOOP; PEONIES, VENICE: GET T Y IMAGES; MOVIE STILL: AL AMY CANDICE BERGEN The star of Book Club: The Next Chapter is no stranger to gracious living with good friends. Here’s what keeps her inspired, delighted, and entertained. 1. ROLEX The only watch I have is my vintage Submariner. Lucky for me it keeps great time. rolex.com 3. VENICE We had the best time shooting the Book Club sequel in Venice and Rome. I’m partial to Venice, myself. 2. PEONIES I always like to have flowers at home, preferably from my garden or Gelson’s market. Peonies are my favorite. gelsons.com 8. NANCY MEYERS FILMS I’m in a perfect little 1950s house in L.A., but Nancy always makes me want to play with a bigger canvas. She does it so well. 4. CUSTOM FURNITURE I have a lot from Rooms Gardens’ former location in Santa Monica, California, including upholstered chairs. roomsandgardens.com 6. CLARIDGE’S I love the elegance and quality of service at this London hotel. Also, the restaurant has a fantastic breakfast. claridges.co.uk 5. TIFFANY FLOOR LAMP My standing lamp is one of my most prized possessions. The shade is a poin- settia pattern. It’s magnificent. 7. AMAZON ALEXA I’ll ask Alexa to play Frank Sinatra, or Bobby Darin if I want something a little perky. alexa.amazon.com
frontgate.com
E L L E D E C O R 52 C O L L A B TO C OV E T PHOTOGRAPHS BY SHARON RADISCH STYLED BY REBECCA BARTOSHESKY Mosquito chair and desk by Barry Dixon for Arteriors. arteriorshome.com. FOR HIS SIXTH COLLECTION WITH ARTERIORS, THE Virginia-based designer Barry Dixon looked to an unlikely source for inspiration: the mosquito. “It was all about the legs,” says Dixon, who found himself particularly drawn to the look of the insect’s limbs. “I had an epiphany: Perhaps this is the natural form that inspired the ancient Greeks to create the klismos chair, as that design so clearly recalls the graceful arc of a mosquito’s legs.” Keeping this in mind, Dixon worked with Arteriors to craft a sinewy iron base that could be paired with lighter materials like vellum for the body of a desk and cocktail and side tables, as well as linen upholstery for a chair. Released in March, the 19-piece collection includes furniture, lighting, and accessories. In it, Dixon further explored his ancient inspirations by “looking back to think forward,” using bronzed iron, antique brass, and marble in more contemporary silhouettes. Each piece feels vital, as Dixon approaches every collaboration by thinking first of what is missing in the marketplace. This time, versatility came out on top. “I often design products that I can’t find readily out there in the universe,” he says. “And I’ll have an idea of something that I can use over and over again.” The desk, for example, is small enough to also function as a console in a foyer, or paired up as bedside tables. It’s a philosophy that dovetails neatly with Arteriors’ own—necessity is the mother of inven- tion, after all—and proof perfect that in design, the past is ever present. —Parker Bowie Larson ALL THE BUZZ Designer Barry Dixon mines entomology and ancient history to craft modern heirlooms.
ADVERTISEMENT INTERIOR DESIGNER, BETH DIANA SMITH, SHARES HOW TO FILL ANY ROOM WITH WARMTH AND JOY BY INCORPORATING SHERWIN-WILLIAMS® 2023 COLOR OF THE YEAR, REDEND POINT, INTO YOUR ONE-OF-A-KIND SPACE. Our Designers at Home issue highlights those that inspire us most, spotlighting the exquisite atmospheres they create for their toughest client—themselves. BETH DIANA SMITH, who is well-versed in curating artful interiors and experimenting with color in the home, shows us how to use a blushing beige to bring a bold flare to spaces where individuality can flourish. A LOVELY LOOK Redend Point will add a rich, inviting, earthy hue to your space. Beth described the Sherwin-Williams® Color of the Year— now the color of her home office—like a warm hug. “It’s the perfect neutral—it feels like a mix of terracotta and salmon that I immediately gravitated to. It can be used to enhance any type of room, from an office to a living room.” A blushing and calming neutral like Redend Point can bring your space to life as the bond that brings a room together. When working with clients to pick a color, Beth explains, “My goal is to achieve a look that reflects how the homeowners want to live and how they want to feel in their home and move throughout their day. Paint color is crucial for setting that tone.” CONNECT WITH A SHERWIN-WILLIAMS COLOR EXPERT Book a FREE Virtual Color Consultation to receive expert advice from a Sherwin-Williams Color Consultant. WELLNESS Beth believes wellness at home is an all- encompassing mix of what it takes for us to feel at peace and relaxed. Color, pattern, and texture all play into that. “Adding Redend Point to your space creates a tranquil, warm and welcoming escape from the outside world. Nothing exudes wellness like a serene blush.” GET UP AND GLOW Redend Point SW 9081 (195-C4) Redend Point SW 9081 (195-C4) Redend Point SW 9081 (195-C4) and Pure White SW 7005 (255-C1)
FREE COLOR CONSULTATIONS Choosing a color is hard, but booking a FREE color consult with Sherwin-Williams is easy. Our team of experts can help you find your color for any project, no matter the state of your canvas. Book at swcolorconsult.com BOOK IT • FIND IT • PAINT IT • LOVE IT • BOOK IT • FIND IT • PAINT IT • LOVE IT • BOOK IT • FIND IT • PAINT IT • LOVE IT
1 2 E L L E D E C O R 56 H O U S E C A L L BY CAMILLE OKHIO PHOTOGRAPHS BY CHRIS MOTTALINI F ixing up a house can be a romantic endeavor. Andre Herrero, a founder of the architecture and design studio Charlap Hyman Herrero, discovered this when designing an apartment for his girlfriend, Paige Zollars, who works in fashion. In 2020, Zollars and her sister, Laura, a music manager, purchased a West Hollywood duplex that was “ugly as sin,” Herrero says. Untouched since the 1970s, it had a dated ski-chalet aesthetic and a suffocating layout. “I’m so grateful Andre came with us to view it,” Paige says. “Only an archi- tect could have seen the potential.” Herrero took it down to the studs and built THREE’S COMPANY Architect Andre Herrero designs a chic West Hollywood pied-à-terre for his sweetheart and her sister. MAKING A LIVELY MIX 1. Playful works of art bal- ance out serious antiques throughout the apartment. In the living room, an Olivia Erlanger sculpture of a room within an eye hangs above the sofa. Intensely surreal, it recalls the doll- houses both sisters played with as children. 2. In the convivial spirit, a pair of 19th-century Queen Anne–style side tables pro- vide space to work or eat from the sofa. it into a modern home of muted hues and airy spaces. Things got more layered when Herrero introduced his favorite materials—stainless steel and metal mesh—throughout the home, helping to distinguish areas by use: “We hate open floor plans for small apartments,” Herrero says. “Everything feels smaller.” Cheeky art enlivens the apartment, while American antiques ground it. Everything was done on a shoestring budget without sacrificing quality. “We were crafty with our resources and took advantage of architectural quirks,” Herrero says. “Things that seem like negatives can contribute to a more romantic narrative.”
L.A. flagship showroom opening soon TRIBU.COM
4 3 6 5 E L L E D E C O R 58 H O U S E C A L L KEEPING IT HIGH-TECH 3. A series of material interventions—like metal mesh and stainless steel— take cues from historic interi- ors while remaining freshly up to date. In front of the kitchen, white metal mesh folding screens inspired by Pierre Chareau and Bernard Bijvoet’s modernist 1932 Maison de Verre delineate space without blocking nat- ural light. Framed paper cut- outs by Herrero’s business partner, Adam Charlap Hyman, hang easily on a perforated panel. 4. Two significant Pierre Legrain armchairs of the same period as Maison de Verre offer movable seat- ing and visual gravity in the living room. 5. “I try to create a bit of drama in every space I do,” Herrero says. “I want an emotional look.” Flanked by sculptural Lucky Star candles, the striking double-height steel fire- place is an homage to the Paris home of one of Yves Saint Laurent’s muses, Betty Catroux. Hidden behind it is a large-screen TV. 6. “The kitchen was a disas- ter,” Herrero says. Barely functional before the reno- vation, it is now rendered spacious by the use of under-stair storage and smart shelving above the stove. A 19th-century French Directoire candelabra by the sink is the perfect foil to the industrial Zangra pill- shaped ceiling lights. “ We w a n t e d s o m e w h e r e t o r e l a x a n d r e s e t .” – L a u r a Z o l l a r s
7 9 8 60 E L L E D E C O R H O U S E C A L L SAVING SPACE 7. To introduce some theatri- cality into Paige’s bedroom, linen was hung behind the bed, which is topped by a vintage kimono pillow and bookended by Adirondack twig tables: “We loved their witchy quality,” Charlap Hyman says. 8. “We were thinking a bit about ‘High Tech,’ the late- 1970s and early-’80s design moment,” says Charlap Hyman of the steel Anne Libby sculpture above Laura’s bed. Its form, which mimics a pulled blind, adds some whimsy to the room. The rest of the decor is firmly functional: A Victorian papier-mâché chair serves as a nightstand opposite a 1972 Tizio lamp from Artemide. 9. Herrero doubled the size of the lofted study-cum– dining room, where he sits at a table made after Enzo Mari’s Autoprogettazione series. Paige (left) and Laura lean on metal mesh bookshelves. A 1950s Murano bell-jar light hangs above the table. ◾
DECK COLLECTION BY HENRIK PEDERSEN LOS ANGELES · CHICAGO · DANIA BEACH · VIRGINIA · NEW YORK FLAGSHIP WWW.GLOSTER.COM
COUTURE FOR HOMES SPECIALIZING IN L ARGE-SCALE LUXURY PROJECTS WALL UPHOLSTERY • CUSTOM-MADE WINDOW TREATMENTS coutureforhomes.com • 201.356.9074 DESIGN AND FABRICS BY MURIEL BRANDOLINI • MURIELBRANDOLINI.COM ESTABLISHED IN 2007
Cabiate (Como) Italia - Tel. +39 031 766215 - info@porada.it | MILANO Showroom - Via Borgosospeso 18 - Tel. +39 02 49700 896 - milano@porada.it | LONDON Showroom - Design Centre Chelsea Harbour - London - Ph: 020 3155 3065 - enquiriesuk@porada.it | PARIS Showroom - 252 Blvd St. Germain 75007 - Paris - paris@porada.it PORADA.IT COPINE poltrona - armchair JOK tavolino - side table GARY BIG lampada - floor lamp
@ELLEDECOR_COLLECTION
AVAILABLE AT AMAZON.COM, OVERSTOCK.COM WAYFAIR.COM THE TROPEZ COLLECTION
E L L E D E C O R 65 B U I L D E R BY TIM McKEOUGH JENNIFER HUGHES YOU CAN CREATE YOUR OWN EDEN Top landscape designers are gardening more sustainably by letting Mother Nature lead the way. At his Virginia home, landscape architect Thomas Woltz placed a marble sculpture among hydrangeas, horn- beam hedges, and serviceberry trees.
66 E L L E D E C O R B U I L D E R A n immaculate flower bed bursting with lipstick- pink peonies, exotic lilies, and elegant climbing roses is a beautiful thing to behold. But after spending decades feeling as though they had to conquer nature by beating back weeds, banishing insects and animals, and toiling to maintain verdant swaths of green, many designers are now more focused on working hand in hand with nature to help landscapes tell their own stories. “The garden has gone from just a place of pleasure to becoming the essential place of our well-being,” says Thomas Woltz, the owner of Nelson Byrd Woltz Landscape Architects, noting that the pandemic caused many people to realize just how vital it is to maintain a connection with the outdoors. At the same time, he says, the alarming effects of climate change—droughts, floods, wildfires, and fluctua- tions in wildlife populations—are forcing us to recalibrate our relationship with our surroundings and recognize the built-in genius of Mother Nature’s master plan. “Previously the conversation was always focused on issues of color, texture, and form,” Woltz says, as many of us sought to recreate elements of great gardens spied in Europe and Asia. While aesthetics are as important as ever, there is a new appreciation for gardens that are also beneficial to the environment and reflective of their unique place in the world. “Eighty-five percent of our residential gardens are exotic plants, which is wild to think about, and much of the United States is covered by lawn,” says the landscape designer Lily Kwong. “People are looking at these yards that consume a ton of resources and asking, ‘Can I turn this into a native meadow? Can I turn this into a pollinator garden?’” For many, the answer is an emphatic yes. “It used to be a hard sell to get people to do a natural-plant garden, but it’s not now,” says landscape architect Janice Parker. “People want sustainability and don’t want to use fertilizers, insecti- cides, and chemicals. They also understand that native plants will please our native wildlife and pollinators like bees, butterflies, and birds.” As Anooshey Rahim, the principal of landscape archi- tecture firm Dune Hai, puts it: “No two gardens should look the same if they’re in different climates.” Rahim’s focus on sustainability extends to hardscaping too. In a recent garden in Northern California, for instance, she used offcuts of nat- ural stone left over from other people’s projects to build ser- pentine walls that define planting beds stuffed with helenium and ornamental grasses. “It doesn’t need to be expensive to A Lily Kwong–designed landscape at the Shou Sugi Ban House in Water Mill, New York, includes a Japanese-style pebble walkway. “We all have ancestral connections to the land.” —LILY KWONG
BY HELENA MADDEN THIS PAGE: CAITLIN ATKINSON. OPPOSITE PAGE: FREDRIK A STJÄRNE 4. DIOR GARDENING SET Dior’s stainless steel and leather tool kit makes even pulling weeds look chic. $9,300. At select Dior Men stores. GARDEN VARIETIES Our must-haves for a truly great outdoors. 2. ROSEWOOD CEDAR ARBOR A timeless trellis like this one always creates a grand entrance. 47″ w. x 24″ d. x 89″ h.; $280. homedepot.com 3. BLOOMING BLOSSOM KIT Hoses can be stylish too, like this pale pink option with brass accents. $279. gardenglory.com 5. GARDEN TUB Take a bath surrounded by trees and perennials for maximum zen. 83″ w. x 61″ d. x 36″ h.; price upon request. soakepools.com 1. MODERN URN BY MANSCAPERS Add some pizzazz to your flora and seedlings with an azure planter. 31″ dia. x 27″ h.; $1,950. tulestefactory.com be beautiful, and you don’t have to ship in stone from Italy,” she says. “You can use simple materials in exciting ways.” Of course, it’s important to remember that humans are garden creatures just as much as insects and animals are. The pandemic kicked off demand for functional spaces that allow people to get outside, Parker says, and that newfound passion for outdoor living is not abating. People want food production, including everything from herb and vegetable gardens to chicken coops; spaces for open-air exercise; and firepits and dining areas that allow family and friends to congregate even when the weather isn’t perfect. With the renewed interest in celebrating both people and place, some designers are also using gardens to commu- nicate elements of history and culture. Woltz, for instance, recently completed Machicomoco, a state park in Virginia dedicated to the history of the Virginia Algonquian. Kwong dug into her ancestry and based her design of this year’s orchid show at the New York Botanical Garden on traditional Chinese landscape painting. “We all have ancestral connections to the land,” Kwong says. “And rediscovering those connections is so important as we move forward in this incredibly precarious time.” ◾ A California estate landscape by the firm Dune Hai has a path of repurposed concrete blocks and a boulder retaining wall.
68 E L L E D E C O R F U R N I T U R E FA N TAS Y WRITTEN AND PRODUCED BY PARKER BOWIE LARSON PHOTOGRAPHS BY DENNIS LEUPOLD APLACE IN THESUN As winter wanes, a family luxuriates in Palm Springs on Janus et Cie’s latest outdoor furniture.
POOL PARTY FROM LEFT: Bon Vivant poufs, Duo round daybeds in Overland fabric, Titan café umbrellas in Jardin Solid fabric, Duo Mesh chaise longues, and Drum side tables, all by Janus et Cie. FASHION, FROM LEFT: Cardigan and pants by Missoni, bathing suit by Shani Shemer; hat, jacket, shirt, and skirt by Moschino, shoes by Sophia Webster; bathing suit by Mara Hoffman; shirt by Soraya, shorts by Ralph Lauren Men, shoes by Ron Tomson. janusetcie.com For details, see Resources. PRESENTED BY
E L L E D E C O R 70 F U R N I T U R E FA N TAS Y FASHION ST YLIST: R AFAEL LINARES; HAIR: DARINE SENGSEEVONG AT ART DEPARTMENT; MAKEUP AND GROOMING: IRIS MOREAU AT HONEY ARTISTS; MODELS: MALICK DIOUCK AND NICOLE NAGEL AT ICONIC FOCUS, PARIS NARO AT T WO MANAGEMENT L. A ., JAYDEN ROBISON AT ONE MANAGEMENT CHAMPAGNE FOR ONE ABOVE: Duo Cabana upholstered in Bandeau fabric, throw pillow in Overland fabric, Bon Vivant pouf, and Facet side table, all by Janus et Cie. FASHION: Cover-up and bathing suit by Shani Shemer, sun- glasses by Lapima, hat by Sense Studio. GAME TIME OPPOSITE, TOP RIGHT: Tangent pool table by Janus et Cie. FASHION, FROM LEFT: Shirt and skirt by Etro; shirt and shorts by Prada; caftan by Silvia Tcherassi, rings by Tara; dress by Giambattista Valli, shoes by Sophia Webster. CATCHING UP OPPOSITE, TOP LEFT: Matisse club chairs and sofa, throw pillows in Overland and Bandeau fabrics, and Monsoon Ixora vase, all by Janus et Cie. Melamine bowl by Thomas Fuchs Creative. FASHION: Bathing suits, pants, jacket, and sun- glasses by Gucci. AFTERNOON APERITIF OPPOSITE, BOTTOM: Koko II stackable sling-arm and side chairs, Duo round dining tables, teak umbrel- las in Palm Beach fabric, and Monsoon Pandanus vases, all by Janus et Cie. Melamine ware and Murano drinking glasses by Thomas Fuchs Creative; pink crocodile napkins by Thomas Fuchs Creative x the NapKing. FASHION, FROM LEFT: Jacket, shirt, and pants by Ron Tomson, sunglasses by Privé Revaux, shoes by Cole Haan; jacket by Le Thanh Hoa, tank top and pants by Dior, sunglasses by Cult Gaia, shoes by Sophia Webster; dress by Trina Turk, sunglasses by Lapima, shoes by Alevi; top and skirt by Zimmermann, sunglasses by Lapima, shoes by Sophia Webster.
PRESENTED BY
STUDIOMLIGHTING.COM INTRODUCING CÉSAR GIRALDO x S T U D I O • M L I G H T I N G
73 E L L E D E C O R DANIEL SCHÄFER The soigné guest bedroom in the Lisbon home of L’Objet founder Elad Yifrach (page 110). Ceramic and bronze floor lamp by Barracuda Interiors; suede and bronze sculpture by Stéphane Parmentier for Giobagnara. For details, see Resources. Inside the lushly layered homes designers craft for themselves. Plus: A jewelry star’s gem of a lair.
BY TANYA DUKES PHOTOGRAPHS BY MAUREEN M. EVANS STYLED BY TESSA WATSON Jewelry star Matthew Harris fashions a pearl of a pied-à-terre in the center of Lisbon.
E L L E D E C O R 75 Matthew Harris, wearing Saint Laurent, in the living room of his Lisbon apartment, which he designed with the architect Rui de Abreu. Chair by Jader Almeida; cocktail table, Area Store Lisbon; Andrew Neyer chandelier, TRNK. OPPOSITE: In his home office, Harris placed a carved-wood panther from Angola on an 18th-century Portuguese desk. Custom sofa from El Corte Inglés; custom wall color; art- work by Magnus Sodamin. For details, see Resources.
hen he was growing up in Jamaica, Mat- thew Harris can recall his excitement at visiting New York City on a trip. Pass- ing through John F. Kennedy Interna- tional Airport, he was dazzled by an artwork hanging overhead: Alexander Calder’s mobile sculpture Flight, with its 45-foot span. He remembers being fascinated by the work, which looked to him like a giant earring. Years later, Harris moved to New York and became a jewelry designer. Soon after he founded his brand, Mateo, in 2009, Rihanna was spotted wearing one of his silver zipper necklaces. A line of chandelier earrings inspired by Calder followed, and Mateo quickly gained a cult following with clients including Zendaya and Oprah. Given his longtime fascination with Calder, it makes sense that when Harris was designing his new pied-à-terre in Lisbon, he was determined to include a piece by the artist. “It was always a dream to own a Calder, but most of the prices are in the stratosphere,” he says. With the help of art adviser Christopher Wolf, he set his sights on a more attainable purchase: a 1975 jute tapestry made by Guatemalan artisans from a design Calder donated to raise money for earthquake victims. Now its organic red and blue pattern hangs over the dining area in his Lisbon apartment. Harris lived in New York for 12 years before making Houston his home base in 2020. His house there has a gal- lery feel, with a black and white palette. “It’s a wow, but it’s hard,” he says. “People don’t know where to sit—is it art or a chair?” Feeling restless during the pandemic, he thought about buying a second home in Europe, where he spends a good chunk of the year working. He remembered how much he enjoyed Lisbon when he visited a decade earlier for busi- ness. “It had the best of everything: amazing food, it’s so multicultural, and the people are actually nice,” he says. From a distance, he researched the local real estate scene and purchased an apartment sight unseen on the top floor of a 19th-century building at the heart of the city near the bustling Avenida da Liberdade. “It’s like Lisbon’s Fifth Avenue,” Harris says. “Just less manic.” The move also allowed him to flex yet another artistic muscle. “It’s always been a dream of mine to work in inte- rior design,” says Harris, who is currently designing a line of decorative objects. He enlisted the Portuguese architect Rui de Abreu and spent a year renovating the residence with the goal of retaining its historic character.
E L L E D E C O R 77 In contrast to his house in Houston, Harris wanted his 1,000-square-foot Lisbon flat to feel immediately approach- able—“like it almost hugs you.” The living area captures that ethos with its vintage Togo lounge seating, which he unexpectedly combined with a stout Brutalist side chair and a mobilelike chandelier by Andrew Neyer. The dining area is furnished minimally with a glass table and filament-slim sconces—supporting players chosen so as not to compete with the star attraction: the Calder tapestry. Harris meticu- lously designed the grooved-oak wall and floating night tables in his tailored bedroom. The primary bath nods to its setting: The walls are tiled in traditional Portuguese blue-and-white azulejos, some depicting a nearly life-size 18th-century gentleman. In A 1975 jute tapestry of Alexander Calder’s “Moon” design anchors the dining area. Vintage glass table; chairs by Rune Krøjgaard; sconces, Area Store Lisbon. OPPOSITE: An artwork by Jean Cocteau on a custom shelf in Portuguese Rosa marble in the kitchen. Vase by Vista Alegre. many Portuguese homes, Harris explains, “there would have been a tile figure at the entry with an outstretched hand to signify hospitality.” Thoughts of his primary occupation are never far from his mind, and the serene office reflects that. “In every home I own, I want a room dedicated to jewelry, and it was time for an emerald room,” says Harris, who achieved the rich hue with 11 coats of paint. Now that his Lisbon apartment is complete, Harris’s urge to devise new spaces has only intensified. He is already designing a villa for himself in Jamaica. After that, he has a more ambitious target. “I’d love to design a hotel from scratch,” Harris says. And wouldn’t a Calder mobile be just the thing for the lobby? ◾
E L L E D E C O R 78 In the primary bathroom, hand-painted Portuguese tiles depict a man in 18th-century garb. Bathtub, rain shower, and fixtures by Roca.
ABOVE: Custom oak wall paneling and a Gubi pendant in the primary bedroom. Bedcovering by Matteo. ABOVE RIGHT: A vintage Portuguese birthing chair in the bedroom. Vintage grain-silo plaque. RIGHT: A vintage sculpture on a custom floating nightstand. “It’s always been a dream of mine to work in interior design.” —MATTHEW HARRIS
E L L E D E C O R 80
BY ANNA FURMAN PHOTOGRAPHS BY CHRIS MOTTALINI Designer Garrett Hunter brings a light touch and a big heart to a historic Los Angeles renovation for his mother and father. The dining room of Rhonda and David Hunter’s home in Los Angeles, which was designed in the 1960s by architect Josef Van der Kar and recently renovated by the couple’s son, Garrett Hunter. Table by Ettore Sottsass; chairs by Afra Tobia Scarpa; pendant by Jeffrey Cheung; artwork by Nadine Schemmann. OPPOSITE: Garrett Hunter (far left) with his parents, David and Rhonda Hunter, in the backyard, with plants chosen by David. For details, see Resources.
E L L E D E C O R 82 rowing up in the Houston suburbs, the designer Garrett Hunter would take architectural tours while on vacation with his parents, artists Rhonda and David Hunter. The trips left a deep impression, inspiring Garrett to pursue a degree in interior architecture at the University of Houston before going on to work for local designer and furniture dealer Pam Kuhl-Linscomb. He launched his eponymous studio in 2009, working across interiors, architecture, furniture, lighting, and product design for private clients including art collectors, tech titans, and the odd celebrity. And, now, Mom and Dad. When Garrett decamped from Houston for Los Angeles in 2020, his parents followed suit two years later, happily downsizing to a three-bedroom house abutting Runyon Canyon in the Hollywood Hills. Rhonda, now the director of operations for her son’s studio, found the property with the help of an architecturally focused real estate agent. “It felt familiar, albeit with a distinct Los Angeles vibe,” she says. “And—perhaps most important—it was perfectly situated to take equal advantage of nature and city views. It has a nest- like feeling, being up in the trees.” Garrett and his team were given full creative latitude, provided the design stayed “casual” and sidestepped stereo- typical interpretations of modernism. The goal was to respect the property’s history while avoiding a formulaic or prescribed look. “We didn’t want to take it too seriously,” he says. “When people choose to embrace midcentury purism, it can read a little stale and uncomfortable.” Designed in the 1960s by architect Josef Van der Kar, the home retains much of its midcentury charm. Working within the original floor plan, the former primary bedroom, situated immediately off the entrance and featuring the most expansive views, was converted into the living room. The travertine and exposed-brick fireplaces are original, as are the wood-paneled walls and beams in the living room. “We didn’t move walls, so our focus was really to enhance the existing architecture,” Garrett says. “It was an exercise in decoration.” The small galley kitchen teems with unusual color and texture combinations, a patchwork approach that pays homage to the Philip Johnson–designed de Menil House, built in 1950 in Houston, with interiors outfitted by couturier Charles James. Irreverent accents like the custom hanging lantern, painted by local artist Jeffrey Cheung, and an anachronistic ketchup-colored sofa in the dining room keep things cool. “While my parents are interested in being comfortable, they’re also charmed by whimsy,” Garrett says. In the living room, the sofa and chairs are vintage. Steel cock- tail table by Michael T. Landrum; resin and fiberglass Ginkgo chair, Tienda X Gallery; floor lamp by Marni; vessel (on pedestal) by Roger Herman; painting (over mantel) by Robert De Niro Sr.
E L L E D E C O R 83 “It has a nestlike feeling, being up in the trees.” —RHONDA HUNTER The living room was updated with wall-to-wall jute carpet tiles in a nod to archival Julius Shulman photographs, while the kitchen, den, and hallways were taken from white to Van Dyke Brown, a muted Sherwin-Williams hue that Van der Kar’s mentor, acclaimed architect Rudolph Schindler, often used to draw residents’ attention to their home’s natural surroundings. To that end, the warm interior tones pull in natural light from the jalousie and floor-to- ceiling windows, which look out onto the balcony and a garden landscaped by David himself, not to mention the sweeping views of central Los Angeles below. “We expressed the architecture while really rewarding the view,” Garrett says. And with just four miles separating the designer from his parents, that’s a reward the whole family can reap. ◾
E L L E D E C O R 84 The kitchen is painted in Sherwin-Williams Van Dyke Brown and features custom cabinetry. Ming dynasty table; Sergio Rodrigues chairs, JF Chen; Skye Chamberlain copper sconces, Tiwa Select; Spanish majolica pendant.
In the family room, the chairs are by Francis Jourdain. Rug by J. James Akston; artwork by Irmgard Arvin.
E L L E D E C O R 86 The custom sofa in the family room is uphol- stered in denim. Cocktail table by Barry Jelinski; side table by Hammer and Spear; pendant by Erik Höglund; 19th-century Chinese coromandel screen. ABOVE: A vintage textile covers the table on the terrace. Chairs by Michael Tracy; Addison Woolsey vase, Tiwa Select. RIGHT: In Rhonda’s dress- ing room, the pine daybed is an homage to Donald Judd. Daybed covered in a Holland Sherry linen; pillows in a Larsen wool; Pierre Frey linen curtains.
In the primary bed- room, a custom bed is upholstered in a Pierre Frey linen with bedding to match. Antique tapestry (behind bed), Tienda X Gallery; vintage artwork.
E L L E D E C O R 88 BY CAMILLE OKHIO PHOTOGRAPHS BY WILLIAM JESS LAIRD STYLED BY BEBE HOWORTH At home in New Orleans, interior designer Michelle R. Smith’s decorating secret weapon is restraint.
Michelle R. Smith, dressed in Attersee, her son, Bash, and their dog, Ingy, in the living room of their 1865 home in New Orleans’s Garden District. Custom chair in a Pierre Frey fabric; custom sconces by MRS Studio; Persian Agra rug; artwork by John Rosis. OPPOSITE: The front porch of the Greek Revival house. For details, see Resources.
E L L E D E C O R 90 uilt in 1865, the Greek Revival house in New Orleans that interior designer Michelle R. Smith calls home is a beacon of ease and refinement. Designed by the society architect Myrlin McCullar, the home’s well-preserved period rooms were a draw for Smith when she decided to relocate from New York City with her young family. And when it comes to impressive architecture, she’s in good company. “All the houses on this street are different,” Smith observes of her neighbors in the city’s Garden District. “Every time I take a walk, I notice a new detail.” Smith grew up in Berwick, Louisiana, where her parents still live, about an hour and a half outside New Orleans. She moved to New York City 15 years ago for law school, then, after a year as a practicing litigator, pursued a graduate degree in tax law. “It was really just an excuse to come to New York,” she says of that period in her life. “I worked long enough at a law firm to understand what that future looked like, and I couldn’t see it for me.” So Smith went in an entirely new direction. Deter- mined to pursue her growing interest in interiors, she interned with Daniel Romualdez, learning everything she could before starting her own design firm, Studio MRS, in Brooklyn in 2013. Since then, she has built a reputation for timeless interiors that are as livable as they are interest- ing. “Her work is comfortable and approachable, but in nearly every space there is something curious, something RIGHT: The entry to the home, where the front door is painted in Benjamin Moore’s Limestone. OPPOSITE: In the dining room, the chandelier is origi- nal to the house. Vintage chairs and tablecloth in Pierre Frey fabrics; curtains of a Fortuny sheer; photograph above mantel by Hong Lei. remarkable,” says Shane Robuck, the Atlanta antiques dealer who is one of Smith’s go-tos. In November 2020, Smith and her partner, the docu- mentary filmmaker Sebastiano Tomada, made the move to New Orleans with their son, Bash, now four years old. The idea was for Smith to commute to her office in New York City, allowing Bash to spend more time with his extended family down South. “I grew up near New Orleans and went to Tulane,” Smith says. “With my parents close by and a big friend group with kids my son’s age, it was easy to make the switch from New York to New Orleans.” Smith wasted no time in drawing up plans for a reno- vation. Wanting to preserve as much of the historic house as possible, she kept alterations to a minimum. A few walls were moved, some bathrooms were redone, and a dark, paneled study leading to the garden became a bright and airy kitchen. Six months after she closed on the house, Smith and her family moved in. Everything had gone so smoothly that surely some- thing would go wrong—and it did. When the moving truck arrived from New York with her furniture and possessions, “every single thing was either broken or covered in what looked like animal fur,” says Smith. “Every chair had three legs. It was madness!” She salvaged and repaired everything she could and was able to save most of her cherished belongings. Today, the house is filled with memories: A guest room’s vintage brass bed has been in her possession since she found it soon
Smith transformed a dark wood-paneled den into a light-filled kitchen that opens onto the back patio. Custom island; fittings by Dornbracht; Mario Bellini stools by Cassina; vintage pendants. OPPOSITE, LEFT: Vitsoe wall shelving holds table- ware in the dining room. OPPOSITE, RIGHT: The powder room’s walls are covered in a textured tile by Quemere Designs. Custom vanity in Nero Marquina marble with fix- tures by Barber Wilsons.
E L L E D E C O R 93 after moving to New York. “My mother and I carried that bed frame for blocks,” she recalls. The Baker chairs in the primary bedroom have been with her since she was in law school. An ornate Italian center table from the 1940s draws attention in the corner of the family room, just as it did in her Brooklyn townhouse. Both she and Tomada favor a mix of old and new. “Growing up in Italy in a house filled with 16th-century furniture, I’ve always had a need to add modern accents,” he says. “Michelle knows how to incorporate that classic European style with the comforts of modern living.” To that end, the couple acquired a few strategic new pieces for the house, the most dramatic of which is the living room’s nine-foot-long sofa. And if its size isn’t “You can’t have a whole room be new. You need things with character.” —MICHELLE R. SMITH impressive enough, the sofa’s striped Loro Piana upholstery adds even more drama. But in Smith’s magical hands it all works; even a boldly striped giant can live in harmony amid the subtle charm that old objects bring. “You can’t have a whole room be new,” Smith says. “You want things you won’t see everywhere. You need things with character.” ◾
LEFT: Garnet Hill quilts cover twin beds in Bash’s room. Vintage cabinet by Carl Malmsten; pendant by Artemide; curtains of a Fortuny linen; rug by Patterson Flynn. BELOW: In Bash’s bathroom, the oil painting is by his paternal grandfather. Custom tiles by Quemere Designs; fixtures by Barber Wilsons.
95 E L L E D E C O R In the main hall, the under-stair cabinet was updated with a Nero Marquina marble top. Macramé light fixture from Wyeth; stair runner by Woodard Greenstein. OPPOSITE, BOTTOM: A guest room is sheathed in a striped wallpaper by Lewis Wood. Vintage Master- craft bed topped by a Bella Notte velvet quilt; vintage side tables, lamps, and artworks.
E L L E D E C O R 96
A four-poster bed by Ironware International in the primary bedroom con- trasts with skirted slipper chairs covered in a Rose Tarlow linen. Quilt by Garnet Hill; curtains, Kravet linen; vintage lamps; vintage May Company Wilshire ceiling pendant. OPPOSITE: The corner tub by Albion Bath was custom painted in Farrow Ball’s Orange Coloured White. Fixtures by Barber Wilsons.
E L L E D E C O R 98 MASSIMO GAMMACURTA . ST YLED BY BEBE HOWORTH. FOR DETAILS, SEE RESOURCES Ontheeveofanewbookof hermother’slatestwork, KateRheinsteinBrodskyreflects onbeingraisedbylegendary designerSuzanneRheinstein. MINE WAS NOT THE TYPICAL 1980S CHILDHOOD. BEING THE daughter of Suzanne Rheinstein, is it any wonder? While other children played in soccer leagues on weekends, I was taken to San Juan Capistrano, California, to see antiquarian Gep Durenberger and the Decorative Arts Study Center. I had been to cocktails at Dawnridge, Tony Duquette’s house, by the time I was 10. I carpeted my dollhouse (a Georgian townhouse, naturally) in fabric samples pilfered from my mother’s desk. My childhood bedroom was pale pink and sage, with cream quatrefoil-painted floors and glazed-chintz balloon shades—a glorious Colefax and Fowler fever dream. Self-expression was encouraged, but posters and collages could be hung only on the inside of the closet door. I was an only child of older parents and, luckily, I was perfectly content to be an anomaly. We did “Interesting Things” on trips. School breaks were spent touring important gardens, house museums, and antiques stores. I knew to ask politely which chair was OK to sit in, and from the time I learned to read, I carried a book with me wherever I went. My mother consistently
Suzanne Rheinstein serves cake at an early birthday party for her daughter, Kate Rheinstein Brodsky. The miniature watering cans are from Kate’s personal collection. Fabric by Suzanne Rheinstein for Lee Jofa.
MASSIMO GAMMACURTA worked hard to engage me wherever we traveled. I remem- ber a trip when I was about 12 to Paris, where my mother found someone to give us a walking architectural tour of ancien régime Paris. She prefaced this by handing me an abridged volume of the letters of Madame de Sévigné and telling me I needed to read it as preparation. Sometimes it felt like Suzanne thought she could single-handedly convince Europe that not all Americans were tacky. We were always well dressed. My mother wore slacks and a cashmere sweater with a scarf and lots of 19th-century gold jewelry. My father, Fred, habitually sported a checked shirt, a blazer, and a bow tie, and, unfail- ingly, an ancient khaki trench coat. I would be dutifully turned out in smocked dresses and pale-blue tweed coats with velvet collars, tights, and the dreaded button shoes. Antiques fairs, flea markets, and small shops were a staple of my childhood. Suzanne’s clever way of making these outings complaint-free was to encourage me to form my own collection. I am not sure how we hit upon minia- ture watering cans, but we did. I would spend hours going through the aisles, scouring for tiny watering cans. As I outgrew miniatures, Suzanne pulled me in by letting me shop alongside her, and I would discover a little aqua blown- glass vase at a market in London or 19th-century fashion prints at a Paris flea market. My mother has always had the ability to take things to a higher level, to bring the magic. This is evident in the parties she has been throwing for decades, gathering dispa- rate people together in a delightful way. Most famously her magic is palpable in the rooms she puts together. For me, that magic was ever-present at her shop. I was eight when my mother opened Hollyhock in Los Angeles, her antiques and furnishings store that quickly became iconic. From the start, I loved going there, enamored of the plump cushions, “Mymotherhas alwayshadthe abilitytotakethings toahigherlevel,to bringthemagic.”
E L L E D E C O R 101 the fragrance of Kenneth Turner candles, the lush colors, even the crisp, glossy dark green of her wrapping paper, tied up with ivory grosgrain ribbon. After school, the carpool or bus dropped me at the shop, and I would sit in the back doing my homework or placing labels on postcards. When I was a little older, I worked there in the summer and on school breaks wrapping presents and Windexing endless amounts of William Yeoward crystal under the watchful eye of Joe Nye, the famously acerbic manager of Hollyhock who went on to become a prominent decorator in his own right, as well as a very dear friend. Somewhere along the way I fell in love with retail. Specifically, retail the way my mother did it: mixing antiques with new furniture and creating vignettes and moments in her shop that showed how a piece might look at home. She loved glorifying the quirky, combining the rustic with the refined and at all times featuring an inordi- nate number of little tables. Her other career, interior design (which hap- pened contemporaneously and for which she is perhaps even more celebrated), gave her great insight into what was lacking in the mar- ket. Anything she wanted that she couldn’t find, she simply had made. That ensured Hollyhock always had a loyal decorator clientele. Watching my mother create beautiful rooms never tempted me into design, but watching her keep shop had me following her footsteps right into retail. All the stores visited, books read, trips taken, and gardens wandered with my mother as a child left an imprint on me and gave me a point of view that I try to bring to my own shop, KRB. I aim for unique pieces—both antique and new—informed by history, brought together in unusual ways, hopefully with curiosity and a touch of humor—in so many ways, a love letter to my mother. ◾ Suzanne’s new book, A Welcoming Elegance (Rizzoli, March 2023), at far left; rooms from a lifetime of designing homes, including several featured in ELLE DECOR; a vintage photograph of Suzanne and Kate.
E L L E D E C O R 103 BY TED LOOS PHOTOGRAPHS BY PERNILLE LOOF STYLED BY TESSA WATSON A 19th-century English sideboard in the down- stairs hall of Antony Todd’s 1758 Georgian house in Millbrook, New York. Runner by Double Knot. OPPOSITE: Todd on the dining terrace. Table by RH, Restoration Hardware; chairs by CB2; umbrella from AuthenTeak. For details, see Resources. A designer and Elton John collaborator breathes new life into his 18th-century New York home.
E L L E D E C O R 104 ny good home design is a balancing act between the strategic and the sentimental. Too much of the for- mer is more admired than loved, and too much of the latter can cloy. At his stately Georgian house in New York’s Hudson Valley, the designer and shop owner Antony Todd made structural moves right away, replacing all the decrepit windows, adding central air, and raising the heights of the exterior doors. And then he softened it all by painting the exterior pink and filling it with items he has been collecting since he was a teenager. Todd wanted to establish a place where those memories could be shown to good advantage, but he left enough room for making new ones with his partner, Lautaro Tambutto. “Form and shape can breathe here,” says Todd, a native of Melbourne, Australia, who has been living in the New York area for the past 30 years. Todd got his start designing events, and he still creates Elton John’s Oscar-viewing party every year in Los Angeles. “With events, it’s all about the impact when you first walk into a party,” he says. “Take people’s breath away and trans- port them. That’s been useful for me.” Notably, though, there’s a more relaxed sense of pacing in his domestic inte- rior work; he does not rush to unveil all the goodies at once. First, he needed the right upstate canvas upon which to apply such artistry. He found the house, set on a wooded two-acre lot, five years ago. “I was looking for a weekender,” Todd says of the sprawling 5,000-square-foot, 18th-century house, which also has an adjacent one-bedroom cottage that dates to the 1920s. But “I quickly fell in love,” he adds. Part of the appeal was that the old house hadn’t had its integrity sullied with too many additions over the centuries, which is the case for many homes in the area. “Too many of them are a labyrinth,” Todd says. “This has the wonderful layout of 35-foot-long, 10-foot-wide corridors, and good, square rooms off the halls.” He moved his eponymous shop, which offers a mix of pieces from his thriving custom furniture line and other objects, from New York City to the charming town of Mill- brook, around the corner from home. Todd’s own designs populate the living room, including a cozy armless sofa in blue linen and slipper chairs in cinnamon suede. He is open to quirky inspirations, part of his overall eclectic taste. “The finials on the slipper chairs are based on the top of a tequila bottle someone sent me,” he says. A dark, dramatic oil paint- ing by Thomas Fougeirol provides extra depth and texture. The approach Todd takes is to design something himself if the perfect piece doesn’t exist. For the dining room, both the ebony-stained oak table and the Louis XVI–style chairs are from his custom line. But in the kitchen, around the simpler dining table that he created in oak, he placed 1950s German school chairs with a retro-modern curved splat. The impulse to acquire began early. As a teenager on a collecting outing with his father in Melbourne, he picked up an 18th-century English mahogany hall chair, which now resides by the front entrance and the charming Dutch-style door, painted apple green. A more recent purchase, an elab- orate 17th-century gilt Italian console, stands nearby in the
E L L E D E C O R 105 The dining area of the kitchen is anchored by a custom solid oak table and side- board. Pendant by FontanaArte; 19th-century Japanese glass hibachi. living room, with a contemporary painting hung above it. Tambutto says that the constellation of collected pieces creates a “beautiful energy.” He adds: “As you move around the house, there’s always something beautiful to look at.” In the wide upstairs hallway, Todd placed an 1815 Portu- guese daybed, made of rosewood and rattan, and covered it in raw silk. “It’s a great spot for a nap,” he says. Sleep is just as easy in the bedrooms, which have original fireplaces for an extra cozy factor. The headboard in the primary bedroom is a green raw silk affair of Todd’s own design; to enrich it, he had some vintage ikat fabric stitched along each side. Throughout the house is evidence of Todd’s ability to give an object new life with the right context: His entry rug is actually a Persian rice dryer, and his dining room curtains are made from a repurposed Indian tablecloth. Uncrowded and thoughtful combinations of new and old make for a decorating scheme that feels like it has always been there, folding the best of the 1750s into 2023. “I like to honor a timeless point of view,” Todd says. “One that doesn’t date itself.” ◾
“Form and shape can breathe here.” —ANTONY TODD The living room’s key feature is a pair of custom armless sofas. Curtains by Holland Sherry; side table by La Roue Vallauris; rug by Merida; decorative pillows by Pat McGann; art- work by Thomas Fougeirol.
107 E L L E D E C O R
LEFT: A painting by Lautaro Tambutto makes a statement in the studio of the guest cottage. Vintage French country table; mirror (on table) by Eve Kaplan. BELOW: The bedding in the main bedroom is by Cultiver Linen. Rug by Merida; curtains by Holland Sherry. OPPOSITE: The guest room features a pair of Early American beds. Rug by Merida; lamp by Lisa Conway; raffia wall decor by Javier Sánchez Medina.
E L L E D E C O R 109
E L L E D E C O R 110 Elad Yifrach outside his apartment in a former mansion in Lisbon’s Principe Real neighborhood. OPPOSITE: In the living room, the custom sectional is in a Dedar silk velvet and topped with Fortuny pil- lows. Terra-cotta side table by Barracuda Interiors; artwork by Roger Lersy. For details, see Resources.
BY JULIE LASKY PHOTOGRAPHS BY DANIEL SCHÄFER Captivated by the allure of Lisbon, a globe-trotting design entrepreneur puts down roots in a former aristocrat’s residence.
E L L E D E C O R 112 hen, in 2019, pandemic was still mostly a word in science fiction novels, Elad Yifrach picked up and moved to Portugal. He had lost patience with New York’s intensity, he says, speaking from his home in a former mansion on a hilltop in downtown Lisbon. Having grown up in the Mediterranean sunshine of Israel and later the mellow embrace of Los Angeles, he was attracted to the country, whose easy climate and lifestyle have led it to be called the California of Europe. Yifrach is the founder and creative director of the lux- ury design company L’Objet. It is his habit to roam the world, collaborating with the artisans who make L’Objet’s refined tableware and expressive furnishings. After growing fond of Portugal over many visits, he decided to move there, especially since he’d found the home of his dreams. “You know that kind of place,” he says. “It’s the one you pass every day, always wondering who lives there.” Located on the Avenida da Liberdade, the Champs-Élysées of Lisbon, the building that sparked his imagination dates from the early 19th century and has a massive arched entry of volca- nic stone inset with an iron-studded wood door that could admit a team of oxen. An aristocratic family had occupied the mansion for 140 years before it was divided in the 1990s into two apartments, plus ground-level commercial space. When Yifrach learned that the Swiss tenants in the upstairs unit were vacating, he swooped in. The apartment, comprising about 2,700 square feet, had authentic grandeur but was far from perfect. He set about introducing the things he loves and is known for: exquisite materials, details that can be wrought only by hand, and tributes to Art Deco and its close relation, 1970s style. The first uh-oh moment in renovating his new home was what to do with the entrance gallery, a white space that wasn’t “wide enough to be a room or narrow enough to be a hallway.” He made it a jewel box, with walls painted in a high-gloss terra-cotta and a white travertine dining table that sweeps down the space like a contrail. Voilà, he had a room after all, where guests can gather around the table, set with dishware by L’Objet designers like the Haas brothers, along with his collection of 1930s Puiforcat silver. In the jumbo-size living room, the tone shifts from fire to ice, with pale blue walls and soft, lavish seating. Yifrach designed the nearly 15-foot silk-velvet modular sectional, which can be split to create conversational areas. The larger of two cocktail tables in the space is eight feet long and made of Portuguese cedar, with a curved top to diminish its ABOVE: The kitchen retains marble details from when the space was the mansion’s principal bathroom. Christian Haas stools by Favius; shell bowl by L’Objet. RIGHT: A vintage Danish mirror and a 1970s vase rest on an antique shelf in the entry hall. Paint in Picture Gallery Red by Farrow Ball. OPPOSITE: The hallway doubles as a dining area, with a white travertine table designed by Yifrach. Vintage chairs by Bruno Rey; vintage pendant by Tony Duquette; custom rug by Holland Sherry; artwork by Vasco Araújo.
114 E L L E D E C O R A custom velvet bed pairs with a vintage Berber rug in the guest room. Vintage Mexican rocking chair; pendant by Apparatus Studio; artwork by Lynn Umlauf. OPPOSITE, LEFT: The bath- room is painted in Skylight by Farrow Ball. Artwork by Sebastião Lobo. OPPOSITE, RIGHT: Yifrach with his son, Levi, in the nursery. Custom armchair; throw by the Elder Statesman; chest by Oliver Furniture; wallpaper by Fornasetti.
bulk. “I didn’t want one rectangular piece that looked like a tomb,” he explains. For all the ways the living room tempts you to fling yourself onto a sofa, the primary bedroom is even more of a master class in relaxation. It is meant to be an ocular “palate cleanser” after a long day of visual stimulation. The walls are covered in a neutral grass cloth that scatters light like an overexposed photo, and the bed is topped with sage green linen that had been acid washed to “kill the vibrant tones.” “I’m a big bath person,” says Yifrach of the claw-foot tub in his bathroom. This is where he retreats to soak off the aches of frequent yoga sessions. The kitchen, carved out of the mansion’s former main bathroom, marble and all, overlooks Lisbon’s botanical gardens: “A really nice back- drop to washing dishes,” he says. Among the apartment’s dozens of striking objects— including a Ghanaian fertility goddess, a palm tree picked up in the Azores, and L’Objet’s delicate Neptune bowl made of fused porcelain seashells—a standout is a pair of 1940s Portuguese iron sconces that resemble kelp. With the encouragement of Alexandre Neimann, of Barracuda Inte- riors in Lisbon, who designed and supplied several pieces for the home, Yifrach said he set the sconces close together on the living room wall so that their “fronds are kissing.” Speaking of love, soon after he moved into his new home, Yifrach enlisted the help of a surrogate and is now the father of a baby boy. The room he designed for his son, Levi, is made for dreaming: Clouds float along the Forna- setti wallpaper, and a white bouclé armchair spreads its welcoming arms. “Levi is a gift I got from the pandemic, when we were all forced to stop and reflect,” Yifrach says. “I realized, What was I waiting for?” ◾
116 E L L E D E C O R After a long day of visual stimulation, the primary bedroom is meant to be an ocular “palate cleanser,” Yifrach says.
Yifrach’s friend, designer Robert Passal, collabo- rated on the design of the main bedroom’s sofa, which is in a Fortuny cash- mere velvet. 1970s Italian cocktail table; sea-grass wallcovering by Mark Alexander; artworks by Vasco Araújo.
ELLEDECOR(ISSN1046-1957)Volume34,Number3,April2023,ispublishedmonthly except forcombinedissuesinDecember/January/FebruaryandJune/July/August,byHearst, 300West57thStreet,NewYork,NY10019U.S.A.StevenR.Swartz,PresidentChief Executive Officer;WilliamR.HearstIII,Chairman;FrankA.Bennack,Jr.,ExecutiveViceChairman; MarkE.Aldam,ChiefOperatingOfficer.HearstMagazineMedia,Inc.:DebiChirichella,President; KateLewis,ChiefContentOfficer;ReginaBuckley,ChiefFinancialandStrategyOfficer Treasurer;CatherineA.Bostron,Secretary. ©2023byHearstMagazineMedia,Inc.Allrights reserved.ELLEandELLEDECORareusedunderlicensefromthetrademarkowner,Hachette FilipacchiPresse.PeriodicalspostagepaidatN.Y.,N.Y.,andadditionalmailingoffices. CanadaPostInternationalPublicationsmailproduct(Canadiandistribution)salesagreement No.40012499.EditorialandAdvertisingOffices:300West57thStreet,NewYork,NY10019. Subscriptionprices:UnitedStatesandpossessions:$15foroneyear.Canada:$41foroneyear. Allothercountries:$60foroneyear.SubscriptionServices:ELLEDECORwill,uponreceiptofa completesubscriptionorder,undertakefulfillmentofthatordersoastoprovidethefirstcopyfor deliverybythePostalServiceoralternatecarrierwithin4–6weeks.Forcustomerservice,changes ofaddress,andsubscriptionorders,logontoelledecor.com/serviceorwritetoCustomerService Department,ELLEDECOR,P.O.Box6000,Harlan,IA51593.Fromtimetotime,wemakeour subscriberlistavailabletocompanieswhosellgoodsandservicesbymailthatwebelievewould interestourreaders.Ifyouwouldrathernotreceivesuchoffersviapostalmail,pleasesendyour currentmailinglabelorexactcopytoMailPreferenceService,P.O.Box6000,Harlan,IA51593. Youcanalsovisitpreferences.hearstmags.comtomanageyourpreferencesandoptoutofreceiving marketingoffersbyemail.ELLEDECORisnotresponsibleforunsolicitedmanuscriptsorart. Nonewillbereturnedunlessaccompaniedbyaself-addressedstampedenvelope.Canadian registrationnumber126018209RT0001.POSTMASTER:Pleasesendaddresschangesto ELLEDECOR,P.O.Box6000,Harlan,IA51593.PrintedintheU.S.A. E L L E D E C O R 118 R E S O U RC E S DANIEL SCHÄFER Items pictured but not listed are from private collections. TABLE OF CONTENTS PAGE 22: Sofa fabric: LoroPiana, us.loropiana.com. Cocktail table: AndriannaShamaris,andrianna shamarisinc.com.PAGE 24: Vase: L’Objet,l-objet.com.PAGE 26: Sofa: Poltronova,poltronova.it. HOUSE CALL Interior design: Andre Herrero, Charlap Hyman Herrero, ch-herrero.com. PAGE 56: Sculpture: OliviaErlanger, oliviaerlanger.com.PAGE 58: Paper cutouts: AdamCharlapHyman, ch-herrero.com. Ceiling lights: Zangra,zangra.com.PAGE 60: Lamp: Artemide,artemide.com. FURNITURE FANTASY Furniture: Janus et Cie, janusetcie .com. PAGES 68–69: Cardigan and pants: Missoni,missoni.com. Bathing suit: ShaniShemer,shanishemer.com. Jacket, shirt, skirt, and earrings: Moschino,moschino.com. Shoes: SophiaWebster,sophiawebster.com. Bathing suit: MaraHoffman, marahoffman.com. Shirt: Soraya, soraya.pk. Shorts: RalphLauren, ralphlauren.com. Shoes: RonTomson, rontomson.com.PAGE 70: Cover-up and bathing suit:ShaniShemer. Sunglasses: Lapima,us.lapima.com. Hat: SenseStudio,sensestudio.nyc. PAGE 71: Melamine bowl: Thomas FuchsCreative,thomasfuchscreative .com.Bathing suits, pants, jacket, sunglasses:Gucci,gucci.com.Shirt and skirt:Etro,etro.com.Shirt and shorts: Prada,prada.com. Caftan: SilviaTcherassi,silviatcherassi .com. Dress: GiambattistaValli, giambattistavalli.com. Shoes: Sophia Webster. Glasses: ThomasFuchs Creative. Napkins: ThomasFuchs CreativextheNapKing,thenapking .com. Jacket, shirt, and pants:Ron Tomson. Sunglasses: PrivéRevaux, priverevaux.com. Shoes: ColeHaan, colehaan.com. Jacket: LeThanh Hoa,lethanhhoa.com.Tank top and pants:Dior,dior.com. Sunglasses: CultGaia,cultgaia.com. Shoes: SophiaWebster. Dress: TrinaTurk, trinaturk.com. Sunglasses: Lapima. Shoes: Alevi,alevimilano.com.Top and skirt:Zimmermann,zimmermann .com. Sunglasses: Lapima. Shoes: SophiaWebster. A REAL GEM Interior design: Matthew Harris, matthewharris.studio. PAGE 74: Sofa: ElCorteInglés,el corteingles.es. Artwork: Magnus Sodamin,@magnificentmagnus. PAGE 75: Clothing: SaintLaurent, ysl.com. Chair: JaderAlmeida, jaderalmeida.com. Cocktail table: AreaStoreLisbon,areastore.com. Chandelier: AndrewNeyer, andrewneyer.com.PAGE 76: Vase: VistaAlegre,vistaalegre.com. PAGE 77: Sconces: AreaStoreLisbon. PAGE 78: Fixtures: Roca,roca.com. PAGE 79: Pendant: Gubi,gubi.com. Bedcovering: Matteo,matteola.com. MEET THE PARENTS Interior design: Garrett Hunter, garretthunter.com. PAGE 81: Pendant: JeffreyCheung, @jeffcheung1. Artwork: Nadine Schemmann,nadineschemmann .com.PAGES 82–83: Cocktail table: MichaelT.Landrum,michaelt landruminc.com. Floor lamp: Marni, marni.com.PAGE 84: Paint: Sherwin- Williams,sherwin-williams.com. Sconces: TiwaSelect,tiwa-select .com.PAGE 86: Side table: Hammer andSpear,hammerandspear.com. Vase: AddisonWoolsey,addison woolsey.co. Mattress linen: Holland Sherry,hollandandsherry.com. Pillow wool: Larsen,cowtan.com. Curtains: PierreFrey,pierrefrey.com. BIG EASY ELEGANCE Interior design: Michelle R. Smith, studiomrs.com. PAGE 89: Chair fabric: PierreFrey, pierrefrey.com. Sconces: Studio MRS,studiomrs.com. Artwork: John Rosis,johnrosis.webs.com.PAGE 90: Paint: BenjaminMoore,benjamin moore.com.PAGE 91: Chair fabric: PierreFrey. Curtains: Fortuny,fortuny .com.PAGE 92: Fittings: Dornbracht, dornbracht.com. Stools: MarioBellini byCassina,cassina.com. Chiminea pot: SundayShop,sundayshop.co. PAGE 93: Wall shelving: Vitsoe, vitsoe.com. Tiles: QuemereDesigns, quemeredesigns.com. Fixtures: BarberWilsons,barberwilsons.com. PAGE 94: Quilts: GarnetHill,garnet hill.com. Pendant: Artemide, artemide.com. Curtains: Fortuny. Rug: PattersonFlynn,pattersonflynn .com. Tiles: QuemereDesigns. Fixtures: BarberWilsons. Wallpaper: LewisWood,lewisandwood.co.uk. Quilt: BellaNotte,bellanotte.nyc. PAGE 95: Light fixture: Wyeth, wyeth.nyc. Stair runner: Woodard Greenstein,woodardweave.com. PAGE 96: Tub: AlbionBath,albion bathco.com. Paint: FarrowBall, farrow-ball.com. Fixtures: Barber Wilsons.PAGE 97: Bed: Ironware International,ironwareinternational .com. Armchair linen: RoseTarlow, rosetarlow.com. Quilt: GarnetHill. Curtains: Kravet,kravet.com. LIFE’S RICH TAPESTRY Suzanne Rheinstein, suzanne rheinstein.com. KRB, krbnyc.com. PAGE 99: Fabric: LeeJofa, kravet.com. IT’S STILL STANDING Interior design: Antony Todd, antonytodd.com. PAGE 102: Table: RH,Restoration Hardware,rh.com. Chairs: CB2,cb2 .com. Umbrella: AuthenTeak,authen teak.com.PAGE 103: Runner: Double Knot,double-knot.com.PAGE 105: Pendant: FontanaArte,fontanaarte .com.PAGE 106: Curtains: Holland Sherry,hollandandsherry.com. Rug: Merida,meridastudio.com. Pillows: PatMcGann,patmcganngallery.com. Artwork: ThomasFougeirol,thomas fougeirol.com.PAGE 108: Mirror: EveKaplan,geraldblandinc.com. Bedding: CultiverLinen,cultiver.com. Rug: Merida. Curtains: Holland Sherry.PAGE 109: Rug: Merida. Lamp: LisaConway,lisaconway.com. Wall decor: JavierSánchezMedina, javiersmedina.com. TUDO BEM! Interior design: Elad Yifrach, @eladyifrach. PAGE 73: Lamp: BarracudaInteriors, barracuda-interiors.com. Sculpture: StéphaneParmentier,stephane parmentier.com.PAGE 111: Sofa fabric: Dedar,dedar.com. Pillows: Fortuny,fortuny.com. Side table: BarracudaInteriors.PAGE 112: Stools: Favius,favius.de. Shell bowl: L’Objet,l-objet.com. Paint: FarrowBall,farrow-ball.com. PAGE 113: Pendant: TonyDuquette, tonyduquette.com. Rug: Holland Sherry,hollandandsherry.com. Artwork: VascoAraújo,vasco araujo.org.PAGE 114: Pendant: ApparatusStudio,apparatusstudio .com.PAGE 115: Paint: Farrow Ball. Artwork: SebastiãoLobo, sebastiaolobo.com. Throw: TheElder Statesman,elder-statesman.com. Chest: OliverFurniture,oliverfurniture .com. Wallpaper: Fornasetti, fornasetti.com. PAGES 116–117: Sofa fabric: Fortuny. Wallcovering: MarkAlexander,markalexander.com. Artwork: VascoAraújo. CORRECTION InourMarchissue,theTalentcolumn (page58)misidentifiedtheportrait ofWilliSmithasaself-portrait.The portraitisbytheartistRobertRisko. The living room of Elad Yifrach’s Lisbon apartment (page 110).
DESIGN. FASHION. CULTURE. ELLE DECOR|LIFE PROMOTION FLEXFORM The Marley armchair, designed by Antonio Citterio, is distinguished by its soft shapes and sleek design, the ideal blend of classic appeal and contemporary spirit. A swivel metal base makes contrast with the superior comfort of the seat and backrest cushions that are filled with goose down. The perfect seating to relax. flexform.it/en JANUS ET CIE On the eve of Art Basel, JANUS et Cie celebrated exquisite design and inventive fare in Coral Gables with an exclusive dinner event at TUR Kitchen in partnership with ELLE DECOR. Guests enjoyed a five-course tasting menu, concluding with drinks and desserts at the nearby JANUS et Cie showroom. janusetcie.com TODD MERRILL STUDIO The Sarcomere Console by Joseph Cleghorn and Connor Moxam uses a proprietary technique that manipulates woven strands of cardboard encased in a series of resin pours into complex patterns. The new material is durable, sustainable, with endless possibilities for both construction and design. Glazes, lacquers and applied metals, give the surface a metal-like look and feel. The cabinet features doored compartments lined in bronze, and a hidden side cabinet with shelves for barware. toddmerrillstudio.com From left: Bill Pittel, Alexis Contant, Parker Larson, and Ingrid Abramovitch
120 E L L E D E C O R MY K I N D O F RO OM ANNA AND EUGENI BACH “I had always wanted to see Sainte-Marie de la Tourette, the priory Le Corbusier built between 1953 and 1960 outside Lyon, France. In 2011, I took a train down from Paris—almost 300 miles away—only to dis- cover that it was closed. A priest on the grounds took pity on me, offered me food and water, and allowed me to spend the night. I remember following him into the kitchen for bread, and the feeling of never wanting to leave coming over me. The space is delicate yet powerful, and for- ever inspiring for its use of color and the austerity of its lines.” —As told to Camille Okhio The kitchen at Sainte-Marie de la Tourette priory in Éveux, France. couventdelatourette.fr LIKE APRAYER Designer Harry Nuriev finds himself enraptured with architectural asceticism.
Mastering the art of outdoor living since 1945. Brown Jordan is a registered trademark of Brown Jordan Inc.
ELLE DECOR - April 2023

Recommended

ELLE DECOR - Winter 2023
ELLE DECOR - Winter 2023ELLE DECOR - Winter 2023
ELLE DECOR - Winter 2023Lucky Gods
 
Elle Decor USA - Winter 2024
Elle Decor USA - Winter 2024Elle Decor USA - Winter 2024
Elle Decor USA - Winter 2024Lucky Gods
 
ELLE DECOR - March 2023
ELLE DECOR - March 2023ELLE DECOR - March 2023
ELLE DECOR - March 2023Lucky Gods
 
ELLE DECOR - May 2023
ELLE DECOR - May 2023ELLE DECOR - May 2023
ELLE DECOR - May 2023Lucky Gods
 
ELLE DECOR - November 2023
ELLE DECOR - November 2023ELLE DECOR - November 2023
ELLE DECOR - November 2023Lucky Gods
 
ELLE DECOR - Summer 2023
ELLE DECOR - Summer 2023ELLE DECOR - Summer 2023
ELLE DECOR - Summer 2023Lucky Gods
 
ELLE DECOR - September 2023
ELLE DECOR - September 2023ELLE DECOR - September 2023
ELLE DECOR - September 2023Lucky Gods
 
Atc wicker furniture manufacturer and supplier
Atc wicker furniture manufacturer and supplierAtc wicker furniture manufacturer and supplier
Atc wicker furniture manufacturer and supplierATC Furniture
 

Recommended

ELLE DECOR - Winter 2023
ELLE DECOR - Winter 2023ELLE DECOR - Winter 2023
ELLE DECOR - Winter 2023Lucky Gods
 
Elle Decor USA - Winter 2024
Elle Decor USA - Winter 2024Elle Decor USA - Winter 2024
Elle Decor USA - Winter 2024Lucky Gods
 
ELLE DECOR - March 2023
ELLE DECOR - March 2023ELLE DECOR - March 2023
ELLE DECOR - March 2023Lucky Gods
 
ELLE DECOR - May 2023
ELLE DECOR - May 2023ELLE DECOR - May 2023
ELLE DECOR - May 2023Lucky Gods
 
ELLE DECOR - November 2023
ELLE DECOR - November 2023ELLE DECOR - November 2023
ELLE DECOR - November 2023Lucky Gods
 
ELLE DECOR - Summer 2023
ELLE DECOR - Summer 2023ELLE DECOR - Summer 2023
ELLE DECOR - Summer 2023Lucky Gods
 
ELLE DECOR - September 2023
ELLE DECOR - September 2023ELLE DECOR - September 2023
ELLE DECOR - September 2023Lucky Gods
 
Atc wicker furniture manufacturer and supplier
Atc wicker furniture manufacturer and supplierAtc wicker furniture manufacturer and supplier
Atc wicker furniture manufacturer and supplierATC Furniture
 
Home & Decor - December 2023
Home & Decor - December 2023Home & Decor - December 2023
Home & Decor - December 2023Lucky Gods
 
Home & Decor - November 2023
Home & Decor - November 2023Home & Decor - November 2023
Home & Decor - November 2023Lucky Gods
 
Home & Decor - June 2023
Home & Decor - June 2023Home & Decor - June 2023
Home & Decor - June 2023Lucky Gods
 
"LOVE CURES CANCER" 2009 to 2011 Book of Press
"LOVE CURES CANCER" 2009 to 2011 Book of Press"LOVE CURES CANCER" 2009 to 2011 Book of Press
"LOVE CURES CANCER" 2009 to 2011 Book of PressDavid Mack
 
THE Stylemate Clarity 01|2023
THE Stylemate Clarity 01|2023THE Stylemate Clarity 01|2023
THE Stylemate Clarity 01|2023THE Stylemate
 
The Joy of Gratitude - 2024
The Joy of Gratitude - 2024The Joy of Gratitude - 2024
The Joy of Gratitude - 2024Lucky Gods
 
Home & Decor - July 2023
Home & Decor - July 2023Home & Decor - July 2023
Home & Decor - July 2023Lucky Gods
 
THE Stylemate 01-2022_EN_Einzel.pdf
THE Stylemate 01-2022_EN_Einzel.pdfTHE Stylemate 01-2022_EN_Einzel.pdf
THE Stylemate 01-2022_EN_Einzel.pdfThomasHolzleithner1
 
fantasyissue
fantasyissuefantasyissue
fantasyissueMorgan Ratner
 
Art hive#30issuu
Art hive#30issuuArt hive#30issuu
Art hive#30issuuAlphonso Jefferson, Jr.
 
Eurobest 2015: what we remembered
Eurobest 2015: what we rememberedEurobest 2015: what we remembered
Eurobest 2015: what we rememberedBrandhome
 
Vogue paris
Vogue parisVogue paris
Vogue parisoliviallagostera
 
Home & Decor - October 2023
Home & Decor - October 2023Home & Decor - October 2023
Home & Decor - October 2023Lucky Gods
 
Lush Mag winter 2015 beauty
Lush Mag winter 2015 beautyLush Mag winter 2015 beauty
Lush Mag winter 2015 beautyStacie Houlker
 
Cultural Movement - Cannes workshop - Strategic Planning
Cultural Movement - Cannes workshop - Strategic PlanningCultural Movement - Cannes workshop - Strategic Planning
Cultural Movement - Cannes workshop - Strategic PlanningPatricia De Luca
 
Strawberry Frog Cannes Workshop 2011
Strawberry Frog Cannes Workshop 2011Strawberry Frog Cannes Workshop 2011
Strawberry Frog Cannes Workshop 2011Heather LeFevre
 
Compliance_Proof_TOC (2)
Compliance_Proof_TOC (2)Compliance_Proof_TOC (2)
Compliance_Proof_TOC (2)Belinda Godin
 
Woman's world usa september 13,2021
Woman's world usa september 13,2021Woman's world usa september 13,2021
Woman's world usa september 13,2021LAZREGABDELAZIZ
 
The Mountain Creative Proposal
The Mountain Creative ProposalThe Mountain Creative Proposal
The Mountain Creative ProposalChristopher Brown
 
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...Peter James
 
Foods to Fight Cancer: What to Eat to Reduce Your Risk
Foods to Fight Cancer: What to Eat to Reduce Your RiskFoods to Fight Cancer: What to Eat to Reduce Your Risk
Foods to Fight Cancer: What to Eat to Reduce Your RiskLucky Gods
 
The Art of Deception: Unraveling Logical Fallacies
The Art of Deception: Unraveling Logical FallaciesThe Art of Deception: Unraveling Logical Fallacies
The Art of Deception: Unraveling Logical FallaciesLucky Gods
 

More Related Content

Similar to ELLE DECOR - April 2023

Home & Decor - December 2023
Home & Decor - December 2023Home & Decor - December 2023
Home & Decor - December 2023Lucky Gods
 
Home & Decor - November 2023
Home & Decor - November 2023Home & Decor - November 2023
Home & Decor - November 2023Lucky Gods
 
Home & Decor - June 2023
Home & Decor - June 2023Home & Decor - June 2023
Home & Decor - June 2023Lucky Gods
 
"LOVE CURES CANCER" 2009 to 2011 Book of Press
"LOVE CURES CANCER" 2009 to 2011 Book of Press"LOVE CURES CANCER" 2009 to 2011 Book of Press
"LOVE CURES CANCER" 2009 to 2011 Book of PressDavid Mack
 
THE Stylemate Clarity 01|2023
THE Stylemate Clarity 01|2023THE Stylemate Clarity 01|2023
THE Stylemate Clarity 01|2023THE Stylemate
 
The Joy of Gratitude - 2024
The Joy of Gratitude - 2024The Joy of Gratitude - 2024
The Joy of Gratitude - 2024Lucky Gods
 
Home & Decor - July 2023
Home & Decor - July 2023Home & Decor - July 2023
Home & Decor - July 2023Lucky Gods
 
THE Stylemate 01-2022_EN_Einzel.pdf
THE Stylemate 01-2022_EN_Einzel.pdfTHE Stylemate 01-2022_EN_Einzel.pdf
THE Stylemate 01-2022_EN_Einzel.pdfThomasHolzleithner1
 
Eurobest 2015: what we remembered
Eurobest 2015: what we rememberedEurobest 2015: what we remembered
Eurobest 2015: what we rememberedBrandhome
 
Home & Decor - October 2023
Home & Decor - October 2023Home & Decor - October 2023
Home & Decor - October 2023Lucky Gods
 
Lush Mag winter 2015 beauty
Lush Mag winter 2015 beautyLush Mag winter 2015 beauty
Lush Mag winter 2015 beautyStacie Houlker
 
Cultural Movement - Cannes workshop - Strategic Planning
Cultural Movement - Cannes workshop - Strategic PlanningCultural Movement - Cannes workshop - Strategic Planning
Cultural Movement - Cannes workshop - Strategic PlanningPatricia De Luca
 
Strawberry Frog Cannes Workshop 2011
Strawberry Frog Cannes Workshop 2011Strawberry Frog Cannes Workshop 2011
Strawberry Frog Cannes Workshop 2011Heather LeFevre
 
Compliance_Proof_TOC (2)
Compliance_Proof_TOC (2)Compliance_Proof_TOC (2)
Compliance_Proof_TOC (2)Belinda Godin
 
Woman's world usa september 13,2021
Woman's world usa september 13,2021Woman's world usa september 13,2021
Woman's world usa september 13,2021LAZREGABDELAZIZ
 
The Mountain Creative Proposal
The Mountain Creative ProposalThe Mountain Creative Proposal
The Mountain Creative ProposalChristopher Brown
 
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...Peter James
 

Similar to ELLE DECOR - April 2023 (20)

Home & Decor - December 2023
Home & Decor - December 2023Home & Decor - December 2023
Home & Decor - December 2023
 
Home & Decor - November 2023
Home & Decor - November 2023Home & Decor - November 2023
Home & Decor - November 2023
 
Home & Decor - June 2023
Home & Decor - June 2023Home & Decor - June 2023
Home & Decor - June 2023
 
"LOVE CURES CANCER" 2009 to 2011 Book of Press
"LOVE CURES CANCER" 2009 to 2011 Book of Press"LOVE CURES CANCER" 2009 to 2011 Book of Press
"LOVE CURES CANCER" 2009 to 2011 Book of Press
 
THE Stylemate Clarity 01|2023
THE Stylemate Clarity 01|2023THE Stylemate Clarity 01|2023
THE Stylemate Clarity 01|2023
 
The Joy of Gratitude - 2024
The Joy of Gratitude - 2024The Joy of Gratitude - 2024
The Joy of Gratitude - 2024
 
Home & Decor - July 2023
Home & Decor - July 2023Home & Decor - July 2023
Home & Decor - July 2023
 
THE Stylemate 01-2022_EN_Einzel.pdf
THE Stylemate 01-2022_EN_Einzel.pdfTHE Stylemate 01-2022_EN_Einzel.pdf
THE Stylemate 01-2022_EN_Einzel.pdf
 
fantasyissue
fantasyissuefantasyissue
fantasyissue
 
Art hive#30issuu
Art hive#30issuuArt hive#30issuu
Art hive#30issuu
 
Eurobest 2015: what we remembered
Eurobest 2015: what we rememberedEurobest 2015: what we remembered
Eurobest 2015: what we remembered
 
Vogue paris
Vogue parisVogue paris
Vogue paris
 
Home & Decor - October 2023
Home & Decor - October 2023Home & Decor - October 2023
Home & Decor - October 2023
 
Lush Mag winter 2015 beauty
Lush Mag winter 2015 beautyLush Mag winter 2015 beauty
Lush Mag winter 2015 beauty
 
Cultural Movement - Cannes workshop - Strategic Planning
Cultural Movement - Cannes workshop - Strategic PlanningCultural Movement - Cannes workshop - Strategic Planning
Cultural Movement - Cannes workshop - Strategic Planning
 
Strawberry Frog Cannes Workshop 2011
Strawberry Frog Cannes Workshop 2011Strawberry Frog Cannes Workshop 2011
Strawberry Frog Cannes Workshop 2011
 
Compliance_Proof_TOC (2)
Compliance_Proof_TOC (2)Compliance_Proof_TOC (2)
Compliance_Proof_TOC (2)
 
Woman's world usa september 13,2021
Woman's world usa september 13,2021Woman's world usa september 13,2021
Woman's world usa september 13,2021
 
The Mountain Creative Proposal
The Mountain Creative ProposalThe Mountain Creative Proposal
The Mountain Creative Proposal
 
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...
The Mountain Creative Proposal | Advertising Copywriting and Art Direction Pr...
 

More from Lucky Gods

Foods to Fight Cancer: What to Eat to Reduce Your Risk
Foods to Fight Cancer: What to Eat to Reduce Your RiskFoods to Fight Cancer: What to Eat to Reduce Your Risk
Foods to Fight Cancer: What to Eat to Reduce Your RiskLucky Gods
 
The Art of Deception: Unraveling Logical Fallacies
The Art of Deception: Unraveling Logical FallaciesThe Art of Deception: Unraveling Logical Fallacies
The Art of Deception: Unraveling Logical FallaciesLucky Gods
 
Automotive Technician Training: Theory 2nd Edition
Automotive Technician Training: Theory 2nd EditionAutomotive Technician Training: Theory 2nd Edition
Automotive Technician Training: Theory 2nd EditionLucky Gods
 
How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...
How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...
How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...Lucky Gods
 
The Benefits of Remote Working: The Freedom of Working from Anywhere
The Benefits of Remote Working: The Freedom of Working from AnywhereThe Benefits of Remote Working: The Freedom of Working from Anywhere
The Benefits of Remote Working: The Freedom of Working from AnywhereLucky Gods
 
Medical Presentations: A Prescription for Success 1st Edition
Medical Presentations: A Prescription for Success 1st EditionMedical Presentations: A Prescription for Success 1st Edition
Medical Presentations: A Prescription for Success 1st EditionLucky Gods
 
The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...
The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...
The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...Lucky Gods
 
Textbook of Contraception, Sexual and Reproductive Health
Textbook of Contraception, Sexual and Reproductive HealthTextbook of Contraception, Sexual and Reproductive Health
Textbook of Contraception, Sexual and Reproductive HealthLucky Gods
 
DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...
DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...
DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...Lucky Gods
 
ChatGPT - The AI Rich Dad: Fire Prompts And Grow Rich
ChatGPT - The AI Rich Dad: Fire Prompts And Grow RichChatGPT - The AI Rich Dad: Fire Prompts And Grow Rich
ChatGPT - The AI Rich Dad: Fire Prompts And Grow RichLucky Gods
 
Earth Knowledge Genius! (DK Knowledge Genius)
Earth Knowledge Genius! (DK Knowledge Genius)Earth Knowledge Genius! (DK Knowledge Genius)
Earth Knowledge Genius! (DK Knowledge Genius)Lucky Gods
 
Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...
Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...
Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...Lucky Gods
 
Fit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s Guide
Fit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s GuideFit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s Guide
Fit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s GuideLucky Gods
 
Digital Business and E-Commerce Management 7th Edition
Digital Business and E-Commerce Management 7th EditionDigital Business and E-Commerce Management 7th Edition
Digital Business and E-Commerce Management 7th EditionLucky Gods
 
Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...
Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...
Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...Lucky Gods
 
Palm Reading (The Psychic Arts)
Palm Reading (The Psychic Arts)Palm Reading (The Psychic Arts)
Palm Reading (The Psychic Arts)Lucky Gods
 
Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...
Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...
Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...Lucky Gods
 
Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...
Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...
Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...Lucky Gods
 
Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...
Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...
Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...Lucky Gods
 
How It Works – Understanding Human Anatomy, 1st Edition, 2023
How It Works – Understanding Human Anatomy, 1st Edition, 2023How It Works – Understanding Human Anatomy, 1st Edition, 2023
How It Works – Understanding Human Anatomy, 1st Edition, 2023Lucky Gods
 

More from Lucky Gods (20)

Foods to Fight Cancer: What to Eat to Reduce Your Risk
Foods to Fight Cancer: What to Eat to Reduce Your RiskFoods to Fight Cancer: What to Eat to Reduce Your Risk
Foods to Fight Cancer: What to Eat to Reduce Your Risk
 
The Art of Deception: Unraveling Logical Fallacies
The Art of Deception: Unraveling Logical FallaciesThe Art of Deception: Unraveling Logical Fallacies
The Art of Deception: Unraveling Logical Fallacies
 
Automotive Technician Training: Theory 2nd Edition
Automotive Technician Training: Theory 2nd EditionAutomotive Technician Training: Theory 2nd Edition
Automotive Technician Training: Theory 2nd Edition
 
How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...
How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...
How Not to Get Eaten: More than 75 Incredible Animal Defenses (Wonders of Wil...
 
The Benefits of Remote Working: The Freedom of Working from Anywhere
The Benefits of Remote Working: The Freedom of Working from AnywhereThe Benefits of Remote Working: The Freedom of Working from Anywhere
The Benefits of Remote Working: The Freedom of Working from Anywhere
 
Medical Presentations: A Prescription for Success 1st Edition
Medical Presentations: A Prescription for Success 1st EditionMedical Presentations: A Prescription for Success 1st Edition
Medical Presentations: A Prescription for Success 1st Edition
 
The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...
The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...
The Artificial Intelligence Handbook for Real Estate Brokers: "Future-Proof Y...
 
Textbook of Contraception, Sexual and Reproductive Health
Textbook of Contraception, Sexual and Reproductive HealthTextbook of Contraception, Sexual and Reproductive Health
Textbook of Contraception, Sexual and Reproductive Health
 
DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...
DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...
DIGITAL GOLD RUSH: A Guide to Cryptocurrency Mining Optimization for Wealth C...
 
ChatGPT - The AI Rich Dad: Fire Prompts And Grow Rich
ChatGPT - The AI Rich Dad: Fire Prompts And Grow RichChatGPT - The AI Rich Dad: Fire Prompts And Grow Rich
ChatGPT - The AI Rich Dad: Fire Prompts And Grow Rich
 
Earth Knowledge Genius! (DK Knowledge Genius)
Earth Knowledge Genius! (DK Knowledge Genius)Earth Knowledge Genius! (DK Knowledge Genius)
Earth Knowledge Genius! (DK Knowledge Genius)
 
Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...
Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...
Animal Knowledge Genius: A Quiz Encyclopedia to Boost Your Brain (DK Knowledg...
 
Fit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s Guide
Fit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s GuideFit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s Guide
Fit @ Any Age Fitness tips from a 92 year old runner A Practitioner’s Guide
 
Digital Business and E-Commerce Management 7th Edition
Digital Business and E-Commerce Management 7th EditionDigital Business and E-Commerce Management 7th Edition
Digital Business and E-Commerce Management 7th Edition
 
Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...
Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...
Build Autonomous Mobile Robot from Scratch using ROS: Simulation and Hardware...
 
Palm Reading (The Psychic Arts)
Palm Reading (The Psychic Arts)Palm Reading (The Psychic Arts)
Palm Reading (The Psychic Arts)
 
Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...
Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...
Pathfinders: Extraordinary Stories of People Like You on the Quest for Financ...
 
Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...
Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...
Overcoming Debt, Achieving Financial Freedom: 8 Pillars to Build Wealth 1st E...
 
Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...
Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...
Broken Money: Why Our Financial System Is Failing Us and How We Can Make It B...
 
How It Works – Understanding Human Anatomy, 1st Edition, 2023
How It Works – Understanding Human Anatomy, 1st Edition, 2023How It Works – Understanding Human Anatomy, 1st Edition, 2023
How It Works – Understanding Human Anatomy, 1st Edition, 2023
 

Recently uploaded

SD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptxSD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptxjanettecruzeiro1
 
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️soniya singh
 
Government polytechnic college-1.pptxabcd
Government polytechnic college-1.pptxabcdGovernment polytechnic college-1.pptxabcd
Government polytechnic college-1.pptxabcdshivubhavv
 
The_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdf
The_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdfThe_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdf
The_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdfAmirYakdi
 
Stark Industries Marketing Plan (1).pptx
Stark Industries Marketing Plan (1).pptxStark Industries Marketing Plan (1).pptx
Stark Industries Marketing Plan (1).pptxjeswinjees
 
CALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun service
CALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun serviceCALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun service
CALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun serviceanilsa9823
 
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...Call Girls in Nagpur High Profile
 
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...Call Girls in Nagpur High Profile
 
Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...
Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...
Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...kumaririma588
 
Chapter 19_DDA_TOD Policy_First Draft 2012.pdf
Chapter 19_DDA_TOD Policy_First Draft 2012.pdfChapter 19_DDA_TOD Policy_First Draft 2012.pdf
Chapter 19_DDA_TOD Policy_First Draft 2012.pdfParomita Roy
 
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...Call Girls in Nagpur High Profile
 
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...Pooja Nehwal
 
Delhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip Call
Delhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip CallDelhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip Call
Delhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip Callshivangimorya083
 
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130Suhani Kapoor
 
CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵
CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵
CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵anilsa9823
 
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai DouxDubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Douxkojalkojal131
 
WAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past QuestionsWAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past QuestionsCharles Obaleagbon
 
The history of music videos a level presentation
The history of music videos a level presentationThe history of music videos a level presentation
The history of music videos a level presentationamedia6
 
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...ranjana rawat
 

Recently uploaded (20)

SD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptxSD_The MATATAG Curriculum Training Design.pptx
SD_The MATATAG Curriculum Training Design.pptx
 
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
Call Girls in Kalkaji Delhi 8264348440 call girls ❤️
 
Government polytechnic college-1.pptxabcd
Government polytechnic college-1.pptxabcdGovernment polytechnic college-1.pptxabcd
Government polytechnic college-1.pptxabcd
 
The_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdf
The_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdfThe_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdf
The_Canvas_of_Creative_Mastery_Newsletter_April_2024_Version.pdf
 
Stark Industries Marketing Plan (1).pptx
Stark Industries Marketing Plan (1).pptxStark Industries Marketing Plan (1).pptx
Stark Industries Marketing Plan (1).pptx
 
CALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun service
CALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun serviceCALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun service
CALL ON ➥8923113531 🔝Call Girls Aminabad Lucknow best Night Fun service
 
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
Top Rated Pune Call Girls Saswad ⟟ 6297143586 ⟟ Call Me For Genuine Sex Serv...
 
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
VVIP Pune Call Girls Hadapsar (7001035870) Pune Escorts Nearby with Complete ...
 
Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...
Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...
Verified Trusted Call Girls Adugodi💘 9352852248 Good Looking standard Profil...
 
Chapter 19_DDA_TOD Policy_First Draft 2012.pdf
Chapter 19_DDA_TOD Policy_First Draft 2012.pdfChapter 19_DDA_TOD Policy_First Draft 2012.pdf
Chapter 19_DDA_TOD Policy_First Draft 2012.pdf
 
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
Top Rated Pune Call Girls Koregaon Park ⟟ 6297143586 ⟟ Call Me For Genuine S...
 
Call Girls Service Mukherjee Nagar @9999965857 Delhi 🫦 No Advance VVIP 🍎 SER...
Call Girls Service Mukherjee Nagar @9999965857 Delhi 🫦 No Advance VVIP 🍎 SER...Call Girls Service Mukherjee Nagar @9999965857 Delhi 🫦 No Advance VVIP 🍎 SER...
Call Girls Service Mukherjee Nagar @9999965857 Delhi 🫦 No Advance VVIP 🍎 SER...
 
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
Pooja 9892124323, Call girls Services and Mumbai Escort Service Near Hotel Gi...
 
Delhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip Call
Delhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip CallDelhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip Call
Delhi Call Girls Paharganj 9711199171 ☎✔👌✔ Whatsapp Hard And Sexy Vip Call
 
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
VIP Call Girls Service Kukatpally Hyderabad Call +91-8250192130
 
CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵
CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵
CALL ON ➥8923113531 🔝Call Girls Kalyanpur Lucknow best Female service 🧵
 
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai DouxDubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
Dubai Call Girls Pro Domain O525547819 Call Girls Dubai Doux
 
WAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past QuestionsWAEC Carpentry and Joinery Past Questions
WAEC Carpentry and Joinery Past Questions
 
The history of music videos a level presentation
The history of music videos a level presentationThe history of music videos a level presentation
The history of music videos a level presentation
 
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
(AISHA) Ambegaon Khurd Call Girls Just Call 7001035870 [ Cash on Delivery ] P...
 

ELLE DECOR - April 2023

  • 1.
  • 2. 🌟Welcome to Your Journey of Ultimate Wellness! 🌈💖 Thank you for choosing our ebook/magazine! 📘✨To enhance your health and beauty experience, we've curated some phenomenal products that promise to elevate your well-being. 🌺🌟 Skincare Saviors: Hydrossential - Unique Beauty Serum: 💦One Simple Way To Maintain A Flawless Skin. Link: https://mas.so/hydrossential Sun-Kissed Confidence: Totally Bangin' Tan by Turbo Babe: ☀️Go From “Pale Princess” to “Golden Goddess” with this Anti-Aging Sunless Tanning. Link: https://mas.so/bangin Hairraisingly Healthy: FoliPrime - The Natural Egyptian Hair Balm: 💆‍♀️Supports Hair Health. Link: https://mas.so/foliprime Men's Wellness Wonders: Endo Pump - Male Enhancement MONSTER: 💪U.S. Scientists Discover Secret For Stamina & Virility At Any Age. Link: https://mas.so/endopump African “Sex Monkeys” Unveil How To Reverse Erectile Dysfunction So You Can Have A Rock Hard Erection Again And Last At Least 30 Minute In Bed! (Note: Due to the potentially offensive language, I recommend considering revising this title and description.) Link: https://mas.so/edprotocol Conquer Health Concerns: MenoRescue: 🧘‍♀️Support healthy hormone levels with MenoRescue™. Formulated using the latest Ivy League research. Link: https://mas.so/menorescue GlucoFence - Blood Sugar Support: 🛡️#1 Most Hated By Big Pharma , Rogue Doctor Fixes Type 2 Diabetes. Link: https://mas.so/glucofence Bonus Goodies: NEW '23: Archangel Health Prayers for 400 Diseases, Weight Loss... Link: https://mas.so/archangels Natural Therapy With Killer VSL & Captivating Hook That Converts Like Crazy For Both Health & PD Niches! Powerful Therapy Based On Acupuncture. New Non- Invasive Alternative. To Electro-Acupuncture, Producing Astounding Results… Self- Application Is Easy, Rapid Response. Link: https://mas.so/naturaltherapy Every Morning This Ancient Amazonian “Drip Method” Is Being Used To Support Healthy Weight Loss. Link: https://mas.so/ignite The "Hidden Survival Muscle" In Your Body Missed By Modern Physicians That Keep Millions Of Men And Women Defeated By Pain, Frustrated With Belly Fat, And Struggling To Feel Energized Every Day… Link: https://mas.so/hipflexors Meditation - "InnaPeace Meditation Program" : The InnaPeace Program for Anxiety Sufferers, Discover why thousands are flocking to what experts are calling “the most advanced self-development method known to human kind”. Link: https://mas.so/innapeace Don't miss out on these amazing products! Click the links above and start your journey to a healthier, happier you! Don't let shortened links with mas.so send shivers down your spine! 🥶It's just a friendly URL shrinker, like a superhero packing superpowers into a tiny suit. 💪👀Fear not, visit https://mas.so and see what mas.so is. ✨Then, click with confidence and discover your favorite products! 🗺️Trust needs to be built on the first click. Thanks!💎
  • 3.
  • 4.
  • 5.
  • 6.
  • 7.
  • 8.
  • 9.
  • 11. In-store interior design & 3D modeling services.(1) Quick Ship program available.(2) Mah Jong Outdoor. Modular sofa, designed by Hans Hopfer. Upholstered in Jean Paul Gaultier outdoor fabrics, Autour du Monde collection. Bases in metal openwork, lacquered, in black-color satin finish. Bilboquet. Pedestal table, designed by Kateryna Sokolova. Made in Europe.
  • 12. French Art de Vivre Photos by Michel Gibert, Baptiste Le Quiniou, for advertising purposes only. (1) Conditions apply, contact store for details. (2) Quick Ship Program available on select products in stock, subject to availability. Images are for reference only and models, sizes, colors and finishes may vary. Please contact your local store for more information. Fabrics by
  • 13.
  • 14.
  • 15. RENAISSANCE – STA X – PAVÉFLEX
  • 17. CALIFORNIACLOSETS.COM | 866.221.0415 | VISIT A SHOWROOM | COMPLIMENTARY IN-HOME DESIGN CONSULTATION MAKE ROOM FOR ALL OF YOU ©2023 California Closet Company, Inc. All rights reserved. Each California Closets® franchised location is independently owned and operated. California Closet Company, Inc., 1414 Harbour Way S, Suite 1750, Richmond, CA 94804 USA.
  • 18.
  • 19.
  • 20.
  • 21.
  • 22.
  • 25.
  • 26.
  • 27. Subscribe to ELLE DECOR at elledecor.com/join CONTENTS APRIL 2023 E L L E D E C O R 22 WILLIAM JESS L AIRD. FOR DETAILS, SEE RESOURCES THE DESIGNERS AT HOME ISSUE 74 A REAL GEM See how jewelry star Matthew Harris fashioned a pearl of a pied-à-terre in the center of Lisbon. BY TANYA DUKES DESIGNER MATTHEW HARRIS 80 MEET THE PARENTS Garrett Hunter brings a light touch and a big heart to a historic Los Angeles renovation for his mother and father. BY ANNA FURMAN DESIGNER GARRETT HUNTER 88 BIG EASY ELEGANCE At home in New Orleans, designer Michelle R. Smith’s decorating secret weapon is restraint. BY CAMILLE OKHIO DESIGNER MICHELLE R. SMITH 98 LIFE’S RICH TAPESTRY On the eve of a new book of her mother’s latest work, Kate Rheinstein Brodsky reflects on being raised by legendary designer Suzanne Rheinstein. BY KATE RHEINSTEIN BRODSKY 102 IT’S STILL STANDING Antony Todd—who has collaborated with none other than Elton John—breathes new life into his 18th-century New York home. BY TED LOOS DESIGNER ANTONY TODD 110 TUDO BEM! Captivated by the allure of Lisbon, a globe- trotting design entrepreneur puts down roots in an aristocrat’s former residence. BY JULIE LASKY DESIGNER ELAD YIFRACH In the living room of designer Michelle R. Smith’s New Orleans home (page 88), the custom sofa is upholstered in a Loro Piana velvet, and the live- edge cocktail table is by Andrianna Shamaris.
  • 28.
  • 29. E L L E D E C O R 24 C O N T E N T S DANIEL SCHÄFER 32 EDITOR’S LETTER 35 WHAT’S NEXT Objects that make the most of recycled components. Plus: A new Stockholm flagship for rug brand Nordic Knots 40 FASHION + FURNITURE The most curvaceous outdoor furniture you’ll find, as well as pieces in every shade of green 44 THE AGENDA What’s shaping our tastes and topping our to-do lists this month 48 JEWELRY BOX David Yurman’s Carlyle collection brings razzle-dazzle with a Deco twist 50 SHORTLIST Book Club: The Next Chapter star Candice Bergen shares eight things she can’t live without 52 COLLAB TO COVET Designer Barry Dixon mines entomology and ancient history to craft modern heirlooms for Arteriors 56 HOUSE CALL For his sweetheart and her sister, Andre Herrero creates a chic pied-à-terre in West Hollywood 65 BUILDER What’s the secret to gardening more sustainably? Let Mother Nature lead the way. BY TIM MCKEOUGH In the design studio of L’Objet founder Elad Yifrach’s Lisbon home (page 110), the African chair is antique, the vase is from L’Objet, and the 19th-century tiles are Portuguese.
  • 30.
  • 31. elledecor@hearst.com @elledecor facebook.com/ELLEDECORmag WRITE TO US: Mailbox, ELLE DECOR, 300 W. 57th St., 27th Fl., NY, NY 10019 Visit elledecor.com/service to order a print subscription, pay your bill, renew your subscription, update your mailing and email addresses, and more. Or write to: Customer Service Department, ELLE DECOR, P.O. Box 6000, Harlan, IA 51593. One-year subscription rate $15 for U.S. and possessions, $41 for Canada, and $60 for other international. To purchase digital back issues, please go to backissues.elledecor.com. E L L E D E C O R 26 C O N T E N T S CHRIS MOT TALINI The dining room of the midcentury Los Angeles home that Garrett Hunter renovated for his parents (page 80) features a sofa by Archizoom Associati for Poltronova. 118 RESOURCES 120 MY KIND OF ROOM Designer Harry Nuriev finds himself enraptured with the kitchen of a priory in France 68 FURNITURE FANTASY As winter wanes, a family luxuriates in Palm Springs on Janus et Cie’s latest outdoor furniture. PRESENTED BY JANUS ET CIE Scan the QR code to join ELLE DECOR All Access for exclusive digital home tours and more! ON THE COVERS LEFT: Michelle R. Smith in the dining room of her New Orleans home; long shirt and trousers by Attersee, shoes by Manolo Blahnik. RIGHT: Matthew Harris in the living room of his Lisbon apartment, wearing Saint Laurent. PHOTOGRAPH (LEFT) BY WILLIAM JESS LAIRD PHOTOGRAPH (RIGHT) BY MAUREEN M. EVANS
  • 32.
  • 33. E L L E D E C O R 28 ASAD SYRKETT EDITOR IN CHIEF EXECUTIVE EDITOR Ingrid Abramovitch EXECUTIVE MANAGING EDITOR Jeffrey Bauman DESIGN DIRECTOR Erin Knutson DEPUTY EDITOR Sean Santiago STYLE DIRECTOR Parker Bowie Larson DEPUTY EDITOR, DIGITAL Anna Fixsen SENIOR INTERIORS EDITOR Bebe Howorth ARTICLES EDITOR Charles Curkin SENIOR DESIGN WRITER Camille Okhio DEPUTY DESIGN DIRECTOR Allie Adams MARKET EDITOR Helena Madden ASSISTANT MANAGING EDITOR Lillian Dondero COPY CHIEF Lisa DeLisle ASSISTANT EDITOR, DIGITAL Rachel Silva EDITORIAL ASSISTANT Sofia Quintero DIGITAL IMAGING SPECIALIST Kevin Arnold HEARST VISUAL GROUP CHIEF VISUAL CONTENT DIRECTOR, HEARST MAGAZINES Alix Campbell VISUAL DIRECTOR Audrey Levine SENIOR VISUAL EDITOR Nelida Mortensen DEPUTY VISUAL DIRECTOR Marina Schoger VISUAL ASSISTANT Natalie Boyce ELLE DECOR CONTRIBUTING EDITORS CONSULTING EDITOR Daniel Boulud CONTRIBUTING DESIGN EDITOR Senga Mortimer CONTRIBUTORS Alyse Archer-Coité, Chesie Breen, Marella Caracciolo Chia, Jerald Cooper, Tanya Dukes, Christopher Garis, Nancy Hass, Patricia Hearst, Kathryn M. Ireland, Kelsey Keith, Mercedes Kraus, William Li, David Netto, Judi Roaman, Alex Tieghi-Walker, Bunny Williams, Gisela Williams STELLENE VOLANDES EDITORIAL DIRECTOR INTERNATIONAL COORDINATOR Monique Boniol PRODUCTION OPERATIONS DIRECTOR Chris Wengiel PRODUCTION MANAGER David Brickey PUBLISHED BY HEARST PRESIDENT CHIEF EXECUTIVE OFFICER Steven R. Swartz CHAIRMAN William R. Hearst III EXECUTIVE VICE CHAIRMAN Frank A. Bennack, Jr. CHIEF OPERATING OFFICER Mark E. Aldam HEARST MAGAZINE MEDIA, INC. PRESIDENT Debi Chirichella GLOBAL CHIEF REVENUE OFFICER Lisa Ryan Howard CHIEF CONTENT OFFICER Kate Lewis CHIEF FINANCIAL AND STRATEGY OFFICER; TREASURER Regina Buckley SENIOR VICE PRESIDENT, CONSUMER REVENUE DEVELOPMENT Brian Madden PRESIDENT, HEARST MAGAZINES INTERNATIONAL Jonathan Wright SECRETARY Catherine A. Bostron PUBLISHING CONSULTANTS Gilbert C. Maurer, Mark F. Miller CUSTOMER SERVICE CALL: 800-274-4687 EMAIL: EDCcustserv@cdsfulfillment.com VISIT: elledecor.com/service WRITE: Customer Service Dept., ELLE DECOR P.O. Box 6000, Harlan, IA 51593 Published at 300 West 57th Street, New York, NY 10019. Tel: 212-649-2000. ELLE® and ELLE DECOR™ are used under license from the trademark owner, Hachette Filipacchi Presse. Printed in the USA. For information on reprints and e-prints, please contact Brian Kolb at Wright’s Reprints, 877-652-5295 or bkolb@wrightsreprints.com. TWIST GLASSES $560 per pair. louisvuitton.com ROYAL OAK SELF-WINDING TOURBILLON Price upon request. audemarspiguet.com LEGGERA OUTDOOR CHAIR BY GIO PONTI $2,050. cassina.com
  • 34. Explore Spring 2023 at Arhaus.com
  • 35. E L L E D E C O R 30 JENNIFER LEVENE BRUNO SENIOR VICE PRESIDENT, GROUP PUBLISHING DIRECTOR VICE PRESIDENT, SALES David Hamilton VICE PRESIDENT, MARKETING SALES STRATEGY Julia Fry EXECUTIVE DIRECTOR, BRAND PARTNERSHIPS DEVELOPMENT Hillary Koota Krevlin EXECUTIVE DIRECTOR, SALES MARKETING STRATEGY Angela Jett Okenica EXECUTIVE DIRECTOR, NATIONAL DIGITAL SALES Tara Weedfald GROUP MARKETING DIRECTORS Esther Deming, Matthew Hare GROUP FINANCE DIRECTOR Christopher J. Tosti DIRECTOR, ADVERTISING SERVICES Merrill Diamond SALES EXECUTIVE SALES DIRECTOR, HOME APPLIANCES, FINANCE TRAVEL Taylor Rae Berish EXECUTIVE SALES DIRECTOR, MIDWEST Donna Schultz EXECUTIVE SALES DIRECTOR, HOME FURNISHINGS Jon Walker SALES DIRECTOR, RETAIL, BEAUTY, WINE SPIRITS Kristin Cassidy SALES ASSISTANTS Bianca Bonetti, Cierra McMahan, Yvonne Villareal MARKETING CREATIVE DIRECTOR Glenn Maryansky ASSOCIATE MARKETING DIRECTOR Mary Kate Murray SENIOR MARKETING MANAGER Jessica Platz MARKETING MANAGER Julia McColligan ASSOCIATE MARKETING MANAGER Katie Fritz MARKETING COORDINATOR Lizzie Roswig U.S. BRANCH OFFICES SOUTHEAST Whitney Otto, Jackie Orwig-Teall, Blaze, Otto Associates, 704-651-1204 SOUTHWEST Virginia Davis, Wisdom Media, 214-526-3800 WEST COAST Cynthia McKnight, CM Media Sales, 310-291-2730; Kurt DeMars, DeMars Media, 415-990-1999 INTERNATIONAL OFFICES ITALY Roberta Battocchio, Global General Manager, 39-02-6619-2327, rbattocchio@hearst.it; Lavinia Cerutti, Head of Editorial Coordination for International Editions, Via Bracco 6, 20159 Milano, 39-02-6619-2935, lcerutti@hearst.it UNITED KINGDOM Ben Chesters, Head of Global Sales, Hearst Global, 72 Broadwick Street, London, W1F 9EP, 44-20-7439-0000, ben.chesters@hearst.co.uk HEARST DIRECT MEDIA VICE PRESIDENT, GROUP EXECUTIVE DIRECTOR Christine L. Hall SALES MANAGER Gina Pisacreta CONSUMER MARKETING VICE PRESIDENT Rick Day ASSOCIATE DIRECTOR, RESEARCH Lenore Montaperto ADVERTISING PRODUCTION PRODUCTION MANAGER David Brickey TRADEMARK NOTICE ELLE® AND ELLE DECORATION™ ARE USED UNDER LICENSE FROM THE TRADEMARK OWNER, HACHETTE FILIPACCHI PRESSE, A SUBSIDIARY OF LAGARDÈRE SCA. A DIVISION OF CEO Constance Benqué CEO ELLE INTERNATIONAL LICENSES François Coruzzi SVP/INTERNATIONAL DIRECTOR OF ELLE ELLE DECORATION Valéria Bessolo Llopiz CREATIVE DIRECTOR OF ELLE DECORATION Linda Bergmark MARKETING DIRECTOR OF ELLE ELLE DECORATION Morgane Rohée DIGITAL GRAPHIC DESIGN DIRECTOR OF ELLE ELLE DECORATION Marine Le Bris SYNDICATION DIRECTOR Séverine Laporte SYNDICATION COORDINATOR Johanna Jegou COPYRIGHTS MANAGER Kenza Allal PIXELLE DATABASE MANAGER Pascal Iacono INTERNATIONAL AD SALES HOUSE: LAGARDÈRE GLOBAL ADVERTISING SVP/INTERNATIONAL ADVERTISING Julian Daniel jdaniel@lagarderenews.com MELOR CHANDELIER BY COLIN KING $1,590. hvlgroup.com HACKER 1 VASE #4 BY MANUEL COLTRI $12,635. artemest.com GOLD AND CERAMIC DIAMOND RING AND DIAMOND STACKING RING SET $2,550 and $3,200. lagos.com
  • 36. KOA IVORY RUG STARKCARPET.COM 844.40.STARK STAIN RESISTANT EASY TO CLEAN HIGH-END PERFORMANCE
  • 37. @as4d E L L E D E C O R 32 E D I TO R ’S L E T T E R FROM LEFT: MARCUS MORRIS; DANIEL SCHÄFER H ere at E L L E DECOR , designers and decorators are always the stars of our show. So you can imagine how much the team relishes the voy- euristic pleasure of assembling our Designers at Home issue. There’s the alluring opportunity to discover insider secrets—the specific antiques and vintage finds, textiles, tile, and more the experts select for themselves. And there’s also the chance to see how top talents with diverse aesthetic sensibilities decide to rest their eyes, away from professional mood boards and meetings. As we worked on the issue, a theme emerged: a sense of calm. And with chaos reigning in the outside world, what could be more seductive at home than that? Don’t get me wrong—“calm” doesn’t equal “quiet.” In each of the homes in this issue, there is texture and color deployed intelligently, and at full voice, not at a whisper. (If you need another reference point for the power and prominence of this kind of design thinking right now, you can look to the latest fashion runways in Milan and Paris.) Perhaps a better analogy for the lush, layered homes in these pages isn’t auditory, but tactile: rooms that look the way cashmere or velvet feels; rooms with true depth and an enveloping appeal—plus details that keep you coming back for closer inspection. Our two swoon-worthy cover stories both embody this idea— and how. In New Orleans, interior designer Michelle R. Smith’s family home, a Greek Revival pile in the city’s Garden District, is an eleganza extravaganza. The Louisiana native, who studied under decorating icon Daniel Romualdez, combines antiques and contemporary touches to KNOCK, KNOCK astonishing effect. I’ll be thinking about her vintage dining chairs, draped in smart navy- and-cream slipcovers, for a long time. And because jewelry design is an obses- sion of ours at ELLE DECOR, we stopped in at the Lisbon pied-à-terre of our second cover star, Matthew Harris, founder of Mateo. There, he magicked up a pared-back space that takes inspiration from his work and—surprise!— nods to his next endeavor: creating decorative accessories for the home. There’s so much to pore over in this edi- tion of the magazine. We hope you have as much fun peeking behind the curtain as we did. Come on in. You’re invited. ◾ Designer and L’Objet founder Elad Yifrach’s handsome Lisbon bedroom (page 110).
  • 38.
  • 39. 800 620 8490 | OFFICINEGULLO.COM THE QUINTESSENTIAL KITCHEN
  • 40. 35 E L L E D E C O R THE BEST DESIGN DISCOVERIES BY PARKER BOWIE LARSON PHOTOGRAPHS BY SHARON RADISCH STYLED BY REBECCA BARTOSHESKY FULL CIRCLE Five new launches make the most of components that are recycled, repurposed, and ready for the spotlight. CAST GLASS Water Illusion vase by Assia Karaguiozova for Poltrona Frau. 12″ w. x 12″ h.; $840. poltronafrau.com
  • 41. 36 E L L E D E C O R W H AT ’S N E X T FELLED TREES Hand-carved black walnut chair by Ian Love Design. 25″ w. x 22″ d. x 28″ h.; $5,500. verso-works.com PAPER PULP Satellite Uplighter by Palefire Studio. 16″ dia. x 13″ h.; $746. palefirestudio.com RECYCLED POLYESTER Skynest pendant light by Marcel Wanders for Flos. 36″ dia. x 8″ h.; $4,345. flos.com FABRIC REMNANTS Bruco sofa by Studio Campana for Paola Lenti. 83″ w. x 31″ d. x 28″ h.; $13,365. paolalenti.it
  • 42. MOLTENIC FLAGSHIP STORES 160 MADISON AVE, NEW YORK NY 10016, T 212 673 7106 — 4100 NE 2ND AVE, SUITE #103-203, 33137, MIAMI, T 786 652 1500 — SHOP.MOLTENI.IT BOSTON CHICAGO DALLAS HOUSTON LOS ANGELES MEXICO CITY BOGOTÀ moltenigroup.com
  • 43. E L L E D E C O R 38 W H AT ’S N E X T TOP: MAGNUS MÅRDING WHEN INTERIOR DESIGNER AND ARCHITECT GIANCARLO VALLE first saw the space that would become the new Nordic Knots flagship showroom—a vacant early-20th-century movie theater in Stockholm’s design district—he felt instant chemistry. “There was so much worth keeping, and I could see it would take only a light touch to give it a more modern edge,” Valle says. That feeling reminded him of his first meeting with husband and wife Fabian Berglund and Liza Laserow, who founded the local label along with Fabian’s brother, Felix. Their creative synergy led to a new rug collection by the designer, launched earlier this year, as well as the stately new headquarters to house the brand’s cost- conscious New Zealand–wool and jute rugs. Valle adopted a less-is-more approach to the historic space in an effort to let its unique architecture and eye-catching details take center stage. Rich green marble walls and terrazzo flooring in the lobby are now offset by a sleek metal coffee bar and seating, a nod to the region’s pewter traditions. Warm wood accents throughout pay homage to the pine furnishings that were popular in the 1920s and ’30s. The approach felt only natural for Nordic Knots, which has fused Swedish craft traditions with cozy Scandinavian minimalism since its founding in 2016. WEAVERTAKESITALL A Swedish rug brand scores big with a dramatic new Stockholm HQ by designer Giancarlo Valle. Nordic Knots cofounders Liza Laserow and Fabian Berglund in the new Stockholm showroom (seen above). nordicknots.com The overall effect is more residential than commercial, and that’s the point. “We wanted it to feel as if you are entering our home,” Laserow says. “Our showroom is a place where you can feel at ease, retreat, and hopefully come to be inspired.” —Helena Madden
  • 44. LUXURY P ERF O RM A NC E FA B RI C S A ND RUGS P ER ENNI A L SFA B R I C S .C O M
  • 45. E L L E D E C O R 40 FAS H I O N + F U R N I T U R E COOL CURVES AHEAD Considering a springtime splurge on a Kagan sofa or a kidney- bean cocktail table? Good news: You can now bring the no-straight-lines trend out of your living room and onto your backyard terrace. Take the look a step further by adding a touch of wicker, which trended on the spring runways, into the mix. —Helena Madden Ribbon curved sofa. 126″ w. x 30″ d. x 35″ h.; price upon request. launlosangeles.com Temps Calme Outdoor sunbed. 34″ w. x 61″ d. x 30″ h.; $4,380. roche-bobois.com Flair O’ chair by Monica Armani. 24″ w. x 24″ d. x 29″ h.; $2,680. bebitalia.com French Braid hanging chair by Sasha Bikoff. 69″ w. x 53″ d. x 52″ h.; $7,989. walterswicker.com Balmain’s spring/summer 2023 show brought wicker to the runway. Rondo lounge chair. 26″ w. x 27″ d. x 32″ h.; $1,398. janusetcie.com
  • 46.
  • 47. E L L E D E C O R 42 FAS H I O N + F U R N I T U R E GETYOUR POWER GREENS Outdoor furniture that’s as lush as the leaves and trees? Yes, please. Pair classic gray with eye-popping chartreuse, deep forest, or zingy lime—the juicy hues du jour this season. And if you’re really head over heels for botanicals, there’s an outfit for that. —H.M. Contoured Chaise by Walter Lamb. 28″ w. x 66″ d. x 32″ h.; $1,525. brownjordan.com Ridge lounge chair. 41″ w. x 36″ d. x 31″ h.; $2,495. bludot.com Daydream daybed by Richard Frinier. 85″ w. x 54″ d. x 83″ h.; $13,735. dedon.us Loewe’s acclaimed spring/summer 2023 looks include fabricated anthur- ium blooms. Crosshatch lounge chair by EOOS. 31″ w. x 30″ d. x 26″ h.; $2,595. dwr.com
  • 48.
  • 49. E L L E D E C O R 44 W H AT ’S N E X T FROM TOP: ANDREW GEMMA INGALLS; CHRISTIAN HARDER THEAGENDA What’s shaping our tastes and topping our to-do lists this month. SHOP: LA NYC CULT OF CHIC Since launching Cult Gaia—made famous by the bestselling bamboo Ark bag—in 2012, Jasmin Larian Hekmat has turned her brand into a fashion force with everything from dresses to shoes. A new pair of flagship stores, in New York’s SoHo and on Melrose Avenue in Los Angeles, showcase her theatrical styles in suitably dramatic backdrops. The West Coast branch was designed by Alexis Brown and Anno Mille. “We tried to make it feel monumental,” says Brown, who referenced Roman and Greek archi- tecture. The space features onyx mosaic flooring, silver Roberto Matta puzzle fur- niture, and a goddess sculpture on the roof. Adds Brown: “We really got into the ritual references.” –Ingrid Abramovitch cultgaia.com DINE: NYC ROMAN HOLIDAY Spread across 6,500 square feet on the third floor of the Shops at Columbus Circle, Bad Roman is a superbly atypical red-sauce joint from the Quality Branded group. The space “winks at Italian visual culture with no pretense to correctness,” says Rustam Mehta, founding partner of GRT Architects, the firm behind the restaurant’s outré interiors. Guests are greeted by a large boar statue collared in neon, modeled after the Uffizi gallery’s Porcellino, while the dining room’s strigil motif is rendered in plaster and echoed in the curving banquettes and light fixtures. “Every opportunity to do a little more was taken,” Mehta says. –Sean Santiago badromannyc.com Cult Gaia’s flagship store in Los Angeles. The Bad Roman dining room in New York City.
  • 50. hvlgroup.com Sacramento Chandelier Leif Sconce Troy Lighting
  • 51. E L L E D E C O R 46 W H AT ’S N E X T CLOCK WISE FROM TOP: SHANIQWA JARVIS; DARIA KLEPIKOVA; FR ANCISCO NOGUEIR A; CLÉMENT CHEVELT; GET T Y IMAGES LISBON MATTHEW HARRIS “The Museum of Art, Architecture, and Technology [above] is an architectural masterpiece. I adore the art, and it’s so lovely to sit on the terrace for lunch and watch the sail- boats pass by. Also, Rua de São Bento has great stores like Velharias de António Azevedo for 17th- and 18th-century Portuguese furniture.” maat.pt We asked three designers—two with homes in this issue—for their favorite spots in this dynamic style destination. ELAD YIFRACH “A favorite Lisbon gallery is Made in Situ, designer Noé Duchaufour- Lawrance’s exploration of materials and Portuguese craft [above]. For contem- porary art, Galeria Francisco Fino is the best; the owner has a great curating eye and a beautiful roster of Portuguese artists.” madeinsitu.com; franciscofino.com JOANA ASTOLFI “As an architect, I’m always inspired by the Calouste Gulbenkian Museum. It cel- ebrates 1950s architecture, where concrete, wood, and glass come together in per- fect harmony. For a night out, I love Rocco restaurant [above]. The food is good, and the interior design is playful, warm, and cozy.” –I.A. gulbenkian.pt; rocco.pt STAY: MILAN HALLOWED HALLS Known for its iconic Italian fashion brand, the Ferragamo family also owns the Lungarno Collection, a group of stylish hotels. The latest to open, Portrait Milano, is the result of an ambitious restoration of a 1564 building that is a former archiepiscopal seminary. Milanese architect Michele De Lucchi led the four- year renovation of historic elements like a Baroque entrance and loggia, while Michele Bönan oversaw the decoration of the property’s 73 rooms, which overlook an internal piazza and garden. The mas- sive project is opening in stages, with a restaurant coming soon, and a spa and a swimming pool excavated from the semi- nary’s old basement dining hall expected by this summer. –I.A. lungarnocollection.com SEE: BOSTON IN FULL VIEW Fresh off her historic turn representing the United States at last year’s Venice Art Biennale, Simone Leigh’s first dedicated museum survey is on view at the Institute of Contemporary Art/ Boston through September 4. The exhibition will encompass pieces from almost 20 years of the New York–based artist’s practice and includes key examples of her ceram- ics, bronzes, videos, and installations. “Although this is the first survey dedi- cated to Leigh, the work has always been there,” said Eva Respini, ICA deputy director for curatorial affairs, in a statement. “Its impact and power can no longer be denied.” –S.S. icaboston.org TICKET TO Artist Simone Leigh. A loggia at the Portrait Milano hotel.
  • 52.
  • 53. 48 E L L E D E C O R J E W E L RY B OX PHOTOGRAPH BY SHARON RADISCH STYLED BY REBECCA BARTOSHESKY Necklace, ring, and earrings from the David Yurman Carlyle collection. From $1,200. davidyurman.com CHAIN REACTION The Carlyle collection from David Yurman takes its design cues from the New York City hotel of the same name—the launch campaign starred Scarlett Johansson on location at its iconic Bemelmans Bar—refracting Jazz Age elegance through an archi- tectural sensibility. A riff on Yurman’s signature cable motif, Carlyle’s silver and gold hexagonal links feature knife-edge faceting and contrasting matte finishes that subtly evolve the brand’s history of mixing metals. Ever practical, the links are open on the underside, minimizing the weight of each piece while maximizing its aesthetic impact. It’s razzle-dazzle with a Deco twist. —Sean Santiago
  • 54. Nooch sofa system, design Piero Lissoni. bebitalia.com
  • 55. E L L E D E C O R 50 S H O R T L I S T AS TOLD TO SEAN SANTIAGO PORTR AIT: JESSE DIT TMAR/REDUX; WATCH: COURTESY OF ROLEX VIA GOOP; PEONIES, VENICE: GET T Y IMAGES; MOVIE STILL: AL AMY CANDICE BERGEN The star of Book Club: The Next Chapter is no stranger to gracious living with good friends. Here’s what keeps her inspired, delighted, and entertained. 1. ROLEX The only watch I have is my vintage Submariner. Lucky for me it keeps great time. rolex.com 3. VENICE We had the best time shooting the Book Club sequel in Venice and Rome. I’m partial to Venice, myself. 2. PEONIES I always like to have flowers at home, preferably from my garden or Gelson’s market. Peonies are my favorite. gelsons.com 8. NANCY MEYERS FILMS I’m in a perfect little 1950s house in L.A., but Nancy always makes me want to play with a bigger canvas. She does it so well. 4. CUSTOM FURNITURE I have a lot from Rooms Gardens’ former location in Santa Monica, California, including upholstered chairs. roomsandgardens.com 6. CLARIDGE’S I love the elegance and quality of service at this London hotel. Also, the restaurant has a fantastic breakfast. claridges.co.uk 5. TIFFANY FLOOR LAMP My standing lamp is one of my most prized possessions. The shade is a poin- settia pattern. It’s magnificent. 7. AMAZON ALEXA I’ll ask Alexa to play Frank Sinatra, or Bobby Darin if I want something a little perky. alexa.amazon.com
  • 57. E L L E D E C O R 52 C O L L A B TO C OV E T PHOTOGRAPHS BY SHARON RADISCH STYLED BY REBECCA BARTOSHESKY Mosquito chair and desk by Barry Dixon for Arteriors. arteriorshome.com. FOR HIS SIXTH COLLECTION WITH ARTERIORS, THE Virginia-based designer Barry Dixon looked to an unlikely source for inspiration: the mosquito. “It was all about the legs,” says Dixon, who found himself particularly drawn to the look of the insect’s limbs. “I had an epiphany: Perhaps this is the natural form that inspired the ancient Greeks to create the klismos chair, as that design so clearly recalls the graceful arc of a mosquito’s legs.” Keeping this in mind, Dixon worked with Arteriors to craft a sinewy iron base that could be paired with lighter materials like vellum for the body of a desk and cocktail and side tables, as well as linen upholstery for a chair. Released in March, the 19-piece collection includes furniture, lighting, and accessories. In it, Dixon further explored his ancient inspirations by “looking back to think forward,” using bronzed iron, antique brass, and marble in more contemporary silhouettes. Each piece feels vital, as Dixon approaches every collaboration by thinking first of what is missing in the marketplace. This time, versatility came out on top. “I often design products that I can’t find readily out there in the universe,” he says. “And I’ll have an idea of something that I can use over and over again.” The desk, for example, is small enough to also function as a console in a foyer, or paired up as bedside tables. It’s a philosophy that dovetails neatly with Arteriors’ own—necessity is the mother of inven- tion, after all—and proof perfect that in design, the past is ever present. —Parker Bowie Larson ALL THE BUZZ Designer Barry Dixon mines entomology and ancient history to craft modern heirlooms.
  • 58.
  • 59. ADVERTISEMENT INTERIOR DESIGNER, BETH DIANA SMITH, SHARES HOW TO FILL ANY ROOM WITH WARMTH AND JOY BY INCORPORATING SHERWIN-WILLIAMS® 2023 COLOR OF THE YEAR, REDEND POINT, INTO YOUR ONE-OF-A-KIND SPACE. Our Designers at Home issue highlights those that inspire us most, spotlighting the exquisite atmospheres they create for their toughest client—themselves. BETH DIANA SMITH, who is well-versed in curating artful interiors and experimenting with color in the home, shows us how to use a blushing beige to bring a bold flare to spaces where individuality can flourish. A LOVELY LOOK Redend Point will add a rich, inviting, earthy hue to your space. Beth described the Sherwin-Williams® Color of the Year— now the color of her home office—like a warm hug. “It’s the perfect neutral—it feels like a mix of terracotta and salmon that I immediately gravitated to. It can be used to enhance any type of room, from an office to a living room.” A blushing and calming neutral like Redend Point can bring your space to life as the bond that brings a room together. When working with clients to pick a color, Beth explains, “My goal is to achieve a look that reflects how the homeowners want to live and how they want to feel in their home and move throughout their day. Paint color is crucial for setting that tone.” CONNECT WITH A SHERWIN-WILLIAMS COLOR EXPERT Book a FREE Virtual Color Consultation to receive expert advice from a Sherwin-Williams Color Consultant. WELLNESS Beth believes wellness at home is an all- encompassing mix of what it takes for us to feel at peace and relaxed. Color, pattern, and texture all play into that. “Adding Redend Point to your space creates a tranquil, warm and welcoming escape from the outside world. Nothing exudes wellness like a serene blush.” GET UP AND GLOW Redend Point SW 9081 (195-C4) Redend Point SW 9081 (195-C4) Redend Point SW 9081 (195-C4) and Pure White SW 7005 (255-C1)
  • 60. FREE COLOR CONSULTATIONS Choosing a color is hard, but booking a FREE color consult with Sherwin-Williams is easy. Our team of experts can help you find your color for any project, no matter the state of your canvas. Book at swcolorconsult.com BOOK IT • FIND IT • PAINT IT • LOVE IT • BOOK IT • FIND IT • PAINT IT • LOVE IT • BOOK IT • FIND IT • PAINT IT • LOVE IT
  • 61. 1 2 E L L E D E C O R 56 H O U S E C A L L BY CAMILLE OKHIO PHOTOGRAPHS BY CHRIS MOTTALINI F ixing up a house can be a romantic endeavor. Andre Herrero, a founder of the architecture and design studio Charlap Hyman Herrero, discovered this when designing an apartment for his girlfriend, Paige Zollars, who works in fashion. In 2020, Zollars and her sister, Laura, a music manager, purchased a West Hollywood duplex that was “ugly as sin,” Herrero says. Untouched since the 1970s, it had a dated ski-chalet aesthetic and a suffocating layout. “I’m so grateful Andre came with us to view it,” Paige says. “Only an archi- tect could have seen the potential.” Herrero took it down to the studs and built THREE’S COMPANY Architect Andre Herrero designs a chic West Hollywood pied-à-terre for his sweetheart and her sister. MAKING A LIVELY MIX 1. Playful works of art bal- ance out serious antiques throughout the apartment. In the living room, an Olivia Erlanger sculpture of a room within an eye hangs above the sofa. Intensely surreal, it recalls the doll- houses both sisters played with as children. 2. In the convivial spirit, a pair of 19th-century Queen Anne–style side tables pro- vide space to work or eat from the sofa. it into a modern home of muted hues and airy spaces. Things got more layered when Herrero introduced his favorite materials—stainless steel and metal mesh—throughout the home, helping to distinguish areas by use: “We hate open floor plans for small apartments,” Herrero says. “Everything feels smaller.” Cheeky art enlivens the apartment, while American antiques ground it. Everything was done on a shoestring budget without sacrificing quality. “We were crafty with our resources and took advantage of architectural quirks,” Herrero says. “Things that seem like negatives can contribute to a more romantic narrative.”
  • 62. L.A. flagship showroom opening soon TRIBU.COM
  • 63. 4 3 6 5 E L L E D E C O R 58 H O U S E C A L L KEEPING IT HIGH-TECH 3. A series of material interventions—like metal mesh and stainless steel— take cues from historic interi- ors while remaining freshly up to date. In front of the kitchen, white metal mesh folding screens inspired by Pierre Chareau and Bernard Bijvoet’s modernist 1932 Maison de Verre delineate space without blocking nat- ural light. Framed paper cut- outs by Herrero’s business partner, Adam Charlap Hyman, hang easily on a perforated panel. 4. Two significant Pierre Legrain armchairs of the same period as Maison de Verre offer movable seat- ing and visual gravity in the living room. 5. “I try to create a bit of drama in every space I do,” Herrero says. “I want an emotional look.” Flanked by sculptural Lucky Star candles, the striking double-height steel fire- place is an homage to the Paris home of one of Yves Saint Laurent’s muses, Betty Catroux. Hidden behind it is a large-screen TV. 6. “The kitchen was a disas- ter,” Herrero says. Barely functional before the reno- vation, it is now rendered spacious by the use of under-stair storage and smart shelving above the stove. A 19th-century French Directoire candelabra by the sink is the perfect foil to the industrial Zangra pill- shaped ceiling lights. “ We w a n t e d s o m e w h e r e t o r e l a x a n d r e s e t .” – L a u r a Z o l l a r s
  • 64.
  • 65. 7 9 8 60 E L L E D E C O R H O U S E C A L L SAVING SPACE 7. To introduce some theatri- cality into Paige’s bedroom, linen was hung behind the bed, which is topped by a vintage kimono pillow and bookended by Adirondack twig tables: “We loved their witchy quality,” Charlap Hyman says. 8. “We were thinking a bit about ‘High Tech,’ the late- 1970s and early-’80s design moment,” says Charlap Hyman of the steel Anne Libby sculpture above Laura’s bed. Its form, which mimics a pulled blind, adds some whimsy to the room. The rest of the decor is firmly functional: A Victorian papier-mâché chair serves as a nightstand opposite a 1972 Tizio lamp from Artemide. 9. Herrero doubled the size of the lofted study-cum– dining room, where he sits at a table made after Enzo Mari’s Autoprogettazione series. Paige (left) and Laura lean on metal mesh bookshelves. A 1950s Murano bell-jar light hangs above the table. ◾
  • 66. DECK COLLECTION BY HENRIK PEDERSEN LOS ANGELES · CHICAGO · DANIA BEACH · VIRGINIA · NEW YORK FLAGSHIP WWW.GLOSTER.COM
  • 67.
  • 68.
  • 69. COUTURE FOR HOMES SPECIALIZING IN L ARGE-SCALE LUXURY PROJECTS WALL UPHOLSTERY • CUSTOM-MADE WINDOW TREATMENTS coutureforhomes.com • 201.356.9074 DESIGN AND FABRICS BY MURIEL BRANDOLINI • MURIELBRANDOLINI.COM ESTABLISHED IN 2007
  • 72. AVAILABLE AT AMAZON.COM, OVERSTOCK.COM WAYFAIR.COM THE TROPEZ COLLECTION
  • 73.
  • 74. E L L E D E C O R 65 B U I L D E R BY TIM McKEOUGH JENNIFER HUGHES YOU CAN CREATE YOUR OWN EDEN Top landscape designers are gardening more sustainably by letting Mother Nature lead the way. At his Virginia home, landscape architect Thomas Woltz placed a marble sculpture among hydrangeas, horn- beam hedges, and serviceberry trees.
  • 75. 66 E L L E D E C O R B U I L D E R A n immaculate flower bed bursting with lipstick- pink peonies, exotic lilies, and elegant climbing roses is a beautiful thing to behold. But after spending decades feeling as though they had to conquer nature by beating back weeds, banishing insects and animals, and toiling to maintain verdant swaths of green, many designers are now more focused on working hand in hand with nature to help landscapes tell their own stories. “The garden has gone from just a place of pleasure to becoming the essential place of our well-being,” says Thomas Woltz, the owner of Nelson Byrd Woltz Landscape Architects, noting that the pandemic caused many people to realize just how vital it is to maintain a connection with the outdoors. At the same time, he says, the alarming effects of climate change—droughts, floods, wildfires, and fluctua- tions in wildlife populations—are forcing us to recalibrate our relationship with our surroundings and recognize the built-in genius of Mother Nature’s master plan. “Previously the conversation was always focused on issues of color, texture, and form,” Woltz says, as many of us sought to recreate elements of great gardens spied in Europe and Asia. While aesthetics are as important as ever, there is a new appreciation for gardens that are also beneficial to the environment and reflective of their unique place in the world. “Eighty-five percent of our residential gardens are exotic plants, which is wild to think about, and much of the United States is covered by lawn,” says the landscape designer Lily Kwong. “People are looking at these yards that consume a ton of resources and asking, ‘Can I turn this into a native meadow? Can I turn this into a pollinator garden?’” For many, the answer is an emphatic yes. “It used to be a hard sell to get people to do a natural-plant garden, but it’s not now,” says landscape architect Janice Parker. “People want sustainability and don’t want to use fertilizers, insecti- cides, and chemicals. They also understand that native plants will please our native wildlife and pollinators like bees, butterflies, and birds.” As Anooshey Rahim, the principal of landscape archi- tecture firm Dune Hai, puts it: “No two gardens should look the same if they’re in different climates.” Rahim’s focus on sustainability extends to hardscaping too. In a recent garden in Northern California, for instance, she used offcuts of nat- ural stone left over from other people’s projects to build ser- pentine walls that define planting beds stuffed with helenium and ornamental grasses. “It doesn’t need to be expensive to A Lily Kwong–designed landscape at the Shou Sugi Ban House in Water Mill, New York, includes a Japanese-style pebble walkway. “We all have ancestral connections to the land.” —LILY KWONG
  • 76. BY HELENA MADDEN THIS PAGE: CAITLIN ATKINSON. OPPOSITE PAGE: FREDRIK A STJÄRNE 4. DIOR GARDENING SET Dior’s stainless steel and leather tool kit makes even pulling weeds look chic. $9,300. At select Dior Men stores. GARDEN VARIETIES Our must-haves for a truly great outdoors. 2. ROSEWOOD CEDAR ARBOR A timeless trellis like this one always creates a grand entrance. 47″ w. x 24″ d. x 89″ h.; $280. homedepot.com 3. BLOOMING BLOSSOM KIT Hoses can be stylish too, like this pale pink option with brass accents. $279. gardenglory.com 5. GARDEN TUB Take a bath surrounded by trees and perennials for maximum zen. 83″ w. x 61″ d. x 36″ h.; price upon request. soakepools.com 1. MODERN URN BY MANSCAPERS Add some pizzazz to your flora and seedlings with an azure planter. 31″ dia. x 27″ h.; $1,950. tulestefactory.com be beautiful, and you don’t have to ship in stone from Italy,” she says. “You can use simple materials in exciting ways.” Of course, it’s important to remember that humans are garden creatures just as much as insects and animals are. The pandemic kicked off demand for functional spaces that allow people to get outside, Parker says, and that newfound passion for outdoor living is not abating. People want food production, including everything from herb and vegetable gardens to chicken coops; spaces for open-air exercise; and firepits and dining areas that allow family and friends to congregate even when the weather isn’t perfect. With the renewed interest in celebrating both people and place, some designers are also using gardens to commu- nicate elements of history and culture. Woltz, for instance, recently completed Machicomoco, a state park in Virginia dedicated to the history of the Virginia Algonquian. Kwong dug into her ancestry and based her design of this year’s orchid show at the New York Botanical Garden on traditional Chinese landscape painting. “We all have ancestral connections to the land,” Kwong says. “And rediscovering those connections is so important as we move forward in this incredibly precarious time.” ◾ A California estate landscape by the firm Dune Hai has a path of repurposed concrete blocks and a boulder retaining wall.
  • 77. 68 E L L E D E C O R F U R N I T U R E FA N TAS Y WRITTEN AND PRODUCED BY PARKER BOWIE LARSON PHOTOGRAPHS BY DENNIS LEUPOLD APLACE IN THESUN As winter wanes, a family luxuriates in Palm Springs on Janus et Cie’s latest outdoor furniture.
  • 78. POOL PARTY FROM LEFT: Bon Vivant poufs, Duo round daybeds in Overland fabric, Titan café umbrellas in Jardin Solid fabric, Duo Mesh chaise longues, and Drum side tables, all by Janus et Cie. FASHION, FROM LEFT: Cardigan and pants by Missoni, bathing suit by Shani Shemer; hat, jacket, shirt, and skirt by Moschino, shoes by Sophia Webster; bathing suit by Mara Hoffman; shirt by Soraya, shorts by Ralph Lauren Men, shoes by Ron Tomson. janusetcie.com For details, see Resources. PRESENTED BY
  • 79. E L L E D E C O R 70 F U R N I T U R E FA N TAS Y FASHION ST YLIST: R AFAEL LINARES; HAIR: DARINE SENGSEEVONG AT ART DEPARTMENT; MAKEUP AND GROOMING: IRIS MOREAU AT HONEY ARTISTS; MODELS: MALICK DIOUCK AND NICOLE NAGEL AT ICONIC FOCUS, PARIS NARO AT T WO MANAGEMENT L. A ., JAYDEN ROBISON AT ONE MANAGEMENT CHAMPAGNE FOR ONE ABOVE: Duo Cabana upholstered in Bandeau fabric, throw pillow in Overland fabric, Bon Vivant pouf, and Facet side table, all by Janus et Cie. FASHION: Cover-up and bathing suit by Shani Shemer, sun- glasses by Lapima, hat by Sense Studio. GAME TIME OPPOSITE, TOP RIGHT: Tangent pool table by Janus et Cie. FASHION, FROM LEFT: Shirt and skirt by Etro; shirt and shorts by Prada; caftan by Silvia Tcherassi, rings by Tara; dress by Giambattista Valli, shoes by Sophia Webster. CATCHING UP OPPOSITE, TOP LEFT: Matisse club chairs and sofa, throw pillows in Overland and Bandeau fabrics, and Monsoon Ixora vase, all by Janus et Cie. Melamine bowl by Thomas Fuchs Creative. FASHION: Bathing suits, pants, jacket, and sun- glasses by Gucci. AFTERNOON APERITIF OPPOSITE, BOTTOM: Koko II stackable sling-arm and side chairs, Duo round dining tables, teak umbrel- las in Palm Beach fabric, and Monsoon Pandanus vases, all by Janus et Cie. Melamine ware and Murano drinking glasses by Thomas Fuchs Creative; pink crocodile napkins by Thomas Fuchs Creative x the NapKing. FASHION, FROM LEFT: Jacket, shirt, and pants by Ron Tomson, sunglasses by Privé Revaux, shoes by Cole Haan; jacket by Le Thanh Hoa, tank top and pants by Dior, sunglasses by Cult Gaia, shoes by Sophia Webster; dress by Trina Turk, sunglasses by Lapima, shoes by Alevi; top and skirt by Zimmermann, sunglasses by Lapima, shoes by Sophia Webster.
  • 81. STUDIOMLIGHTING.COM INTRODUCING CÉSAR GIRALDO x S T U D I O • M L I G H T I N G
  • 82. 73 E L L E D E C O R DANIEL SCHÄFER The soigné guest bedroom in the Lisbon home of L’Objet founder Elad Yifrach (page 110). Ceramic and bronze floor lamp by Barracuda Interiors; suede and bronze sculpture by Stéphane Parmentier for Giobagnara. For details, see Resources. Inside the lushly layered homes designers craft for themselves. Plus: A jewelry star’s gem of a lair.
  • 83. BY TANYA DUKES PHOTOGRAPHS BY MAUREEN M. EVANS STYLED BY TESSA WATSON Jewelry star Matthew Harris fashions a pearl of a pied-à-terre in the center of Lisbon.
  • 84. E L L E D E C O R 75 Matthew Harris, wearing Saint Laurent, in the living room of his Lisbon apartment, which he designed with the architect Rui de Abreu. Chair by Jader Almeida; cocktail table, Area Store Lisbon; Andrew Neyer chandelier, TRNK. OPPOSITE: In his home office, Harris placed a carved-wood panther from Angola on an 18th-century Portuguese desk. Custom sofa from El Corte Inglés; custom wall color; art- work by Magnus Sodamin. For details, see Resources.
  • 85. hen he was growing up in Jamaica, Mat- thew Harris can recall his excitement at visiting New York City on a trip. Pass- ing through John F. Kennedy Interna- tional Airport, he was dazzled by an artwork hanging overhead: Alexander Calder’s mobile sculpture Flight, with its 45-foot span. He remembers being fascinated by the work, which looked to him like a giant earring. Years later, Harris moved to New York and became a jewelry designer. Soon after he founded his brand, Mateo, in 2009, Rihanna was spotted wearing one of his silver zipper necklaces. A line of chandelier earrings inspired by Calder followed, and Mateo quickly gained a cult following with clients including Zendaya and Oprah. Given his longtime fascination with Calder, it makes sense that when Harris was designing his new pied-à-terre in Lisbon, he was determined to include a piece by the artist. “It was always a dream to own a Calder, but most of the prices are in the stratosphere,” he says. With the help of art adviser Christopher Wolf, he set his sights on a more attainable purchase: a 1975 jute tapestry made by Guatemalan artisans from a design Calder donated to raise money for earthquake victims. Now its organic red and blue pattern hangs over the dining area in his Lisbon apartment. Harris lived in New York for 12 years before making Houston his home base in 2020. His house there has a gal- lery feel, with a black and white palette. “It’s a wow, but it’s hard,” he says. “People don’t know where to sit—is it art or a chair?” Feeling restless during the pandemic, he thought about buying a second home in Europe, where he spends a good chunk of the year working. He remembered how much he enjoyed Lisbon when he visited a decade earlier for busi- ness. “It had the best of everything: amazing food, it’s so multicultural, and the people are actually nice,” he says. From a distance, he researched the local real estate scene and purchased an apartment sight unseen on the top floor of a 19th-century building at the heart of the city near the bustling Avenida da Liberdade. “It’s like Lisbon’s Fifth Avenue,” Harris says. “Just less manic.” The move also allowed him to flex yet another artistic muscle. “It’s always been a dream of mine to work in inte- rior design,” says Harris, who is currently designing a line of decorative objects. He enlisted the Portuguese architect Rui de Abreu and spent a year renovating the residence with the goal of retaining its historic character.
  • 86. E L L E D E C O R 77 In contrast to his house in Houston, Harris wanted his 1,000-square-foot Lisbon flat to feel immediately approach- able—“like it almost hugs you.” The living area captures that ethos with its vintage Togo lounge seating, which he unexpectedly combined with a stout Brutalist side chair and a mobilelike chandelier by Andrew Neyer. The dining area is furnished minimally with a glass table and filament-slim sconces—supporting players chosen so as not to compete with the star attraction: the Calder tapestry. Harris meticu- lously designed the grooved-oak wall and floating night tables in his tailored bedroom. The primary bath nods to its setting: The walls are tiled in traditional Portuguese blue-and-white azulejos, some depicting a nearly life-size 18th-century gentleman. In A 1975 jute tapestry of Alexander Calder’s “Moon” design anchors the dining area. Vintage glass table; chairs by Rune Krøjgaard; sconces, Area Store Lisbon. OPPOSITE: An artwork by Jean Cocteau on a custom shelf in Portuguese Rosa marble in the kitchen. Vase by Vista Alegre. many Portuguese homes, Harris explains, “there would have been a tile figure at the entry with an outstretched hand to signify hospitality.” Thoughts of his primary occupation are never far from his mind, and the serene office reflects that. “In every home I own, I want a room dedicated to jewelry, and it was time for an emerald room,” says Harris, who achieved the rich hue with 11 coats of paint. Now that his Lisbon apartment is complete, Harris’s urge to devise new spaces has only intensified. He is already designing a villa for himself in Jamaica. After that, he has a more ambitious target. “I’d love to design a hotel from scratch,” Harris says. And wouldn’t a Calder mobile be just the thing for the lobby? ◾
  • 87. E L L E D E C O R 78 In the primary bathroom, hand-painted Portuguese tiles depict a man in 18th-century garb. Bathtub, rain shower, and fixtures by Roca.
  • 88. ABOVE: Custom oak wall paneling and a Gubi pendant in the primary bedroom. Bedcovering by Matteo. ABOVE RIGHT: A vintage Portuguese birthing chair in the bedroom. Vintage grain-silo plaque. RIGHT: A vintage sculpture on a custom floating nightstand. “It’s always been a dream of mine to work in interior design.” —MATTHEW HARRIS
  • 89. E L L E D E C O R 80
  • 90. BY ANNA FURMAN PHOTOGRAPHS BY CHRIS MOTTALINI Designer Garrett Hunter brings a light touch and a big heart to a historic Los Angeles renovation for his mother and father. The dining room of Rhonda and David Hunter’s home in Los Angeles, which was designed in the 1960s by architect Josef Van der Kar and recently renovated by the couple’s son, Garrett Hunter. Table by Ettore Sottsass; chairs by Afra Tobia Scarpa; pendant by Jeffrey Cheung; artwork by Nadine Schemmann. OPPOSITE: Garrett Hunter (far left) with his parents, David and Rhonda Hunter, in the backyard, with plants chosen by David. For details, see Resources.
  • 91. E L L E D E C O R 82 rowing up in the Houston suburbs, the designer Garrett Hunter would take architectural tours while on vacation with his parents, artists Rhonda and David Hunter. The trips left a deep impression, inspiring Garrett to pursue a degree in interior architecture at the University of Houston before going on to work for local designer and furniture dealer Pam Kuhl-Linscomb. He launched his eponymous studio in 2009, working across interiors, architecture, furniture, lighting, and product design for private clients including art collectors, tech titans, and the odd celebrity. And, now, Mom and Dad. When Garrett decamped from Houston for Los Angeles in 2020, his parents followed suit two years later, happily downsizing to a three-bedroom house abutting Runyon Canyon in the Hollywood Hills. Rhonda, now the director of operations for her son’s studio, found the property with the help of an architecturally focused real estate agent. “It felt familiar, albeit with a distinct Los Angeles vibe,” she says. “And—perhaps most important—it was perfectly situated to take equal advantage of nature and city views. It has a nest- like feeling, being up in the trees.” Garrett and his team were given full creative latitude, provided the design stayed “casual” and sidestepped stereo- typical interpretations of modernism. The goal was to respect the property’s history while avoiding a formulaic or prescribed look. “We didn’t want to take it too seriously,” he says. “When people choose to embrace midcentury purism, it can read a little stale and uncomfortable.” Designed in the 1960s by architect Josef Van der Kar, the home retains much of its midcentury charm. Working within the original floor plan, the former primary bedroom, situated immediately off the entrance and featuring the most expansive views, was converted into the living room. The travertine and exposed-brick fireplaces are original, as are the wood-paneled walls and beams in the living room. “We didn’t move walls, so our focus was really to enhance the existing architecture,” Garrett says. “It was an exercise in decoration.” The small galley kitchen teems with unusual color and texture combinations, a patchwork approach that pays homage to the Philip Johnson–designed de Menil House, built in 1950 in Houston, with interiors outfitted by couturier Charles James. Irreverent accents like the custom hanging lantern, painted by local artist Jeffrey Cheung, and an anachronistic ketchup-colored sofa in the dining room keep things cool. “While my parents are interested in being comfortable, they’re also charmed by whimsy,” Garrett says. In the living room, the sofa and chairs are vintage. Steel cock- tail table by Michael T. Landrum; resin and fiberglass Ginkgo chair, Tienda X Gallery; floor lamp by Marni; vessel (on pedestal) by Roger Herman; painting (over mantel) by Robert De Niro Sr.
  • 92. E L L E D E C O R 83 “It has a nestlike feeling, being up in the trees.” —RHONDA HUNTER The living room was updated with wall-to-wall jute carpet tiles in a nod to archival Julius Shulman photographs, while the kitchen, den, and hallways were taken from white to Van Dyke Brown, a muted Sherwin-Williams hue that Van der Kar’s mentor, acclaimed architect Rudolph Schindler, often used to draw residents’ attention to their home’s natural surroundings. To that end, the warm interior tones pull in natural light from the jalousie and floor-to- ceiling windows, which look out onto the balcony and a garden landscaped by David himself, not to mention the sweeping views of central Los Angeles below. “We expressed the architecture while really rewarding the view,” Garrett says. And with just four miles separating the designer from his parents, that’s a reward the whole family can reap. ◾
  • 93. E L L E D E C O R 84 The kitchen is painted in Sherwin-Williams Van Dyke Brown and features custom cabinetry. Ming dynasty table; Sergio Rodrigues chairs, JF Chen; Skye Chamberlain copper sconces, Tiwa Select; Spanish majolica pendant.
  • 94. In the family room, the chairs are by Francis Jourdain. Rug by J. James Akston; artwork by Irmgard Arvin.
  • 95. E L L E D E C O R 86 The custom sofa in the family room is uphol- stered in denim. Cocktail table by Barry Jelinski; side table by Hammer and Spear; pendant by Erik Höglund; 19th-century Chinese coromandel screen. ABOVE: A vintage textile covers the table on the terrace. Chairs by Michael Tracy; Addison Woolsey vase, Tiwa Select. RIGHT: In Rhonda’s dress- ing room, the pine daybed is an homage to Donald Judd. Daybed covered in a Holland Sherry linen; pillows in a Larsen wool; Pierre Frey linen curtains.
  • 96. In the primary bed- room, a custom bed is upholstered in a Pierre Frey linen with bedding to match. Antique tapestry (behind bed), Tienda X Gallery; vintage artwork.
  • 97. E L L E D E C O R 88 BY CAMILLE OKHIO PHOTOGRAPHS BY WILLIAM JESS LAIRD STYLED BY BEBE HOWORTH At home in New Orleans, interior designer Michelle R. Smith’s decorating secret weapon is restraint.
  • 98. Michelle R. Smith, dressed in Attersee, her son, Bash, and their dog, Ingy, in the living room of their 1865 home in New Orleans’s Garden District. Custom chair in a Pierre Frey fabric; custom sconces by MRS Studio; Persian Agra rug; artwork by John Rosis. OPPOSITE: The front porch of the Greek Revival house. For details, see Resources.
  • 99. E L L E D E C O R 90 uilt in 1865, the Greek Revival house in New Orleans that interior designer Michelle R. Smith calls home is a beacon of ease and refinement. Designed by the society architect Myrlin McCullar, the home’s well-preserved period rooms were a draw for Smith when she decided to relocate from New York City with her young family. And when it comes to impressive architecture, she’s in good company. “All the houses on this street are different,” Smith observes of her neighbors in the city’s Garden District. “Every time I take a walk, I notice a new detail.” Smith grew up in Berwick, Louisiana, where her parents still live, about an hour and a half outside New Orleans. She moved to New York City 15 years ago for law school, then, after a year as a practicing litigator, pursued a graduate degree in tax law. “It was really just an excuse to come to New York,” she says of that period in her life. “I worked long enough at a law firm to understand what that future looked like, and I couldn’t see it for me.” So Smith went in an entirely new direction. Deter- mined to pursue her growing interest in interiors, she interned with Daniel Romualdez, learning everything she could before starting her own design firm, Studio MRS, in Brooklyn in 2013. Since then, she has built a reputation for timeless interiors that are as livable as they are interest- ing. “Her work is comfortable and approachable, but in nearly every space there is something curious, something RIGHT: The entry to the home, where the front door is painted in Benjamin Moore’s Limestone. OPPOSITE: In the dining room, the chandelier is origi- nal to the house. Vintage chairs and tablecloth in Pierre Frey fabrics; curtains of a Fortuny sheer; photograph above mantel by Hong Lei. remarkable,” says Shane Robuck, the Atlanta antiques dealer who is one of Smith’s go-tos. In November 2020, Smith and her partner, the docu- mentary filmmaker Sebastiano Tomada, made the move to New Orleans with their son, Bash, now four years old. The idea was for Smith to commute to her office in New York City, allowing Bash to spend more time with his extended family down South. “I grew up near New Orleans and went to Tulane,” Smith says. “With my parents close by and a big friend group with kids my son’s age, it was easy to make the switch from New York to New Orleans.” Smith wasted no time in drawing up plans for a reno- vation. Wanting to preserve as much of the historic house as possible, she kept alterations to a minimum. A few walls were moved, some bathrooms were redone, and a dark, paneled study leading to the garden became a bright and airy kitchen. Six months after she closed on the house, Smith and her family moved in. Everything had gone so smoothly that surely some- thing would go wrong—and it did. When the moving truck arrived from New York with her furniture and possessions, “every single thing was either broken or covered in what looked like animal fur,” says Smith. “Every chair had three legs. It was madness!” She salvaged and repaired everything she could and was able to save most of her cherished belongings. Today, the house is filled with memories: A guest room’s vintage brass bed has been in her possession since she found it soon
  • 100.
  • 101. Smith transformed a dark wood-paneled den into a light-filled kitchen that opens onto the back patio. Custom island; fittings by Dornbracht; Mario Bellini stools by Cassina; vintage pendants. OPPOSITE, LEFT: Vitsoe wall shelving holds table- ware in the dining room. OPPOSITE, RIGHT: The powder room’s walls are covered in a textured tile by Quemere Designs. Custom vanity in Nero Marquina marble with fix- tures by Barber Wilsons.
  • 102. E L L E D E C O R 93 after moving to New York. “My mother and I carried that bed frame for blocks,” she recalls. The Baker chairs in the primary bedroom have been with her since she was in law school. An ornate Italian center table from the 1940s draws attention in the corner of the family room, just as it did in her Brooklyn townhouse. Both she and Tomada favor a mix of old and new. “Growing up in Italy in a house filled with 16th-century furniture, I’ve always had a need to add modern accents,” he says. “Michelle knows how to incorporate that classic European style with the comforts of modern living.” To that end, the couple acquired a few strategic new pieces for the house, the most dramatic of which is the living room’s nine-foot-long sofa. And if its size isn’t “You can’t have a whole room be new. You need things with character.” —MICHELLE R. SMITH impressive enough, the sofa’s striped Loro Piana upholstery adds even more drama. But in Smith’s magical hands it all works; even a boldly striped giant can live in harmony amid the subtle charm that old objects bring. “You can’t have a whole room be new,” Smith says. “You want things you won’t see everywhere. You need things with character.” ◾
  • 103. LEFT: Garnet Hill quilts cover twin beds in Bash’s room. Vintage cabinet by Carl Malmsten; pendant by Artemide; curtains of a Fortuny linen; rug by Patterson Flynn. BELOW: In Bash’s bathroom, the oil painting is by his paternal grandfather. Custom tiles by Quemere Designs; fixtures by Barber Wilsons.
  • 104. 95 E L L E D E C O R In the main hall, the under-stair cabinet was updated with a Nero Marquina marble top. Macramé light fixture from Wyeth; stair runner by Woodard Greenstein. OPPOSITE, BOTTOM: A guest room is sheathed in a striped wallpaper by Lewis Wood. Vintage Master- craft bed topped by a Bella Notte velvet quilt; vintage side tables, lamps, and artworks.
  • 105. E L L E D E C O R 96
  • 106. A four-poster bed by Ironware International in the primary bedroom con- trasts with skirted slipper chairs covered in a Rose Tarlow linen. Quilt by Garnet Hill; curtains, Kravet linen; vintage lamps; vintage May Company Wilshire ceiling pendant. OPPOSITE: The corner tub by Albion Bath was custom painted in Farrow Ball’s Orange Coloured White. Fixtures by Barber Wilsons.
  • 107. E L L E D E C O R 98 MASSIMO GAMMACURTA . ST YLED BY BEBE HOWORTH. FOR DETAILS, SEE RESOURCES Ontheeveofanewbookof hermother’slatestwork, KateRheinsteinBrodskyreflects onbeingraisedbylegendary designerSuzanneRheinstein. MINE WAS NOT THE TYPICAL 1980S CHILDHOOD. BEING THE daughter of Suzanne Rheinstein, is it any wonder? While other children played in soccer leagues on weekends, I was taken to San Juan Capistrano, California, to see antiquarian Gep Durenberger and the Decorative Arts Study Center. I had been to cocktails at Dawnridge, Tony Duquette’s house, by the time I was 10. I carpeted my dollhouse (a Georgian townhouse, naturally) in fabric samples pilfered from my mother’s desk. My childhood bedroom was pale pink and sage, with cream quatrefoil-painted floors and glazed-chintz balloon shades—a glorious Colefax and Fowler fever dream. Self-expression was encouraged, but posters and collages could be hung only on the inside of the closet door. I was an only child of older parents and, luckily, I was perfectly content to be an anomaly. We did “Interesting Things” on trips. School breaks were spent touring important gardens, house museums, and antiques stores. I knew to ask politely which chair was OK to sit in, and from the time I learned to read, I carried a book with me wherever I went. My mother consistently
  • 108. Suzanne Rheinstein serves cake at an early birthday party for her daughter, Kate Rheinstein Brodsky. The miniature watering cans are from Kate’s personal collection. Fabric by Suzanne Rheinstein for Lee Jofa.
  • 109. MASSIMO GAMMACURTA worked hard to engage me wherever we traveled. I remem- ber a trip when I was about 12 to Paris, where my mother found someone to give us a walking architectural tour of ancien régime Paris. She prefaced this by handing me an abridged volume of the letters of Madame de Sévigné and telling me I needed to read it as preparation. Sometimes it felt like Suzanne thought she could single-handedly convince Europe that not all Americans were tacky. We were always well dressed. My mother wore slacks and a cashmere sweater with a scarf and lots of 19th-century gold jewelry. My father, Fred, habitually sported a checked shirt, a blazer, and a bow tie, and, unfail- ingly, an ancient khaki trench coat. I would be dutifully turned out in smocked dresses and pale-blue tweed coats with velvet collars, tights, and the dreaded button shoes. Antiques fairs, flea markets, and small shops were a staple of my childhood. Suzanne’s clever way of making these outings complaint-free was to encourage me to form my own collection. I am not sure how we hit upon minia- ture watering cans, but we did. I would spend hours going through the aisles, scouring for tiny watering cans. As I outgrew miniatures, Suzanne pulled me in by letting me shop alongside her, and I would discover a little aqua blown- glass vase at a market in London or 19th-century fashion prints at a Paris flea market. My mother has always had the ability to take things to a higher level, to bring the magic. This is evident in the parties she has been throwing for decades, gathering dispa- rate people together in a delightful way. Most famously her magic is palpable in the rooms she puts together. For me, that magic was ever-present at her shop. I was eight when my mother opened Hollyhock in Los Angeles, her antiques and furnishings store that quickly became iconic. From the start, I loved going there, enamored of the plump cushions, “Mymotherhas alwayshadthe abilitytotakethings toahigherlevel,to bringthemagic.”
  • 110. E L L E D E C O R 101 the fragrance of Kenneth Turner candles, the lush colors, even the crisp, glossy dark green of her wrapping paper, tied up with ivory grosgrain ribbon. After school, the carpool or bus dropped me at the shop, and I would sit in the back doing my homework or placing labels on postcards. When I was a little older, I worked there in the summer and on school breaks wrapping presents and Windexing endless amounts of William Yeoward crystal under the watchful eye of Joe Nye, the famously acerbic manager of Hollyhock who went on to become a prominent decorator in his own right, as well as a very dear friend. Somewhere along the way I fell in love with retail. Specifically, retail the way my mother did it: mixing antiques with new furniture and creating vignettes and moments in her shop that showed how a piece might look at home. She loved glorifying the quirky, combining the rustic with the refined and at all times featuring an inordi- nate number of little tables. Her other career, interior design (which hap- pened contemporaneously and for which she is perhaps even more celebrated), gave her great insight into what was lacking in the mar- ket. Anything she wanted that she couldn’t find, she simply had made. That ensured Hollyhock always had a loyal decorator clientele. Watching my mother create beautiful rooms never tempted me into design, but watching her keep shop had me following her footsteps right into retail. All the stores visited, books read, trips taken, and gardens wandered with my mother as a child left an imprint on me and gave me a point of view that I try to bring to my own shop, KRB. I aim for unique pieces—both antique and new—informed by history, brought together in unusual ways, hopefully with curiosity and a touch of humor—in so many ways, a love letter to my mother. ◾ Suzanne’s new book, A Welcoming Elegance (Rizzoli, March 2023), at far left; rooms from a lifetime of designing homes, including several featured in ELLE DECOR; a vintage photograph of Suzanne and Kate.
  • 111.
  • 112. E L L E D E C O R 103 BY TED LOOS PHOTOGRAPHS BY PERNILLE LOOF STYLED BY TESSA WATSON A 19th-century English sideboard in the down- stairs hall of Antony Todd’s 1758 Georgian house in Millbrook, New York. Runner by Double Knot. OPPOSITE: Todd on the dining terrace. Table by RH, Restoration Hardware; chairs by CB2; umbrella from AuthenTeak. For details, see Resources. A designer and Elton John collaborator breathes new life into his 18th-century New York home.
  • 113. E L L E D E C O R 104 ny good home design is a balancing act between the strategic and the sentimental. Too much of the for- mer is more admired than loved, and too much of the latter can cloy. At his stately Georgian house in New York’s Hudson Valley, the designer and shop owner Antony Todd made structural moves right away, replacing all the decrepit windows, adding central air, and raising the heights of the exterior doors. And then he softened it all by painting the exterior pink and filling it with items he has been collecting since he was a teenager. Todd wanted to establish a place where those memories could be shown to good advantage, but he left enough room for making new ones with his partner, Lautaro Tambutto. “Form and shape can breathe here,” says Todd, a native of Melbourne, Australia, who has been living in the New York area for the past 30 years. Todd got his start designing events, and he still creates Elton John’s Oscar-viewing party every year in Los Angeles. “With events, it’s all about the impact when you first walk into a party,” he says. “Take people’s breath away and trans- port them. That’s been useful for me.” Notably, though, there’s a more relaxed sense of pacing in his domestic inte- rior work; he does not rush to unveil all the goodies at once. First, he needed the right upstate canvas upon which to apply such artistry. He found the house, set on a wooded two-acre lot, five years ago. “I was looking for a weekender,” Todd says of the sprawling 5,000-square-foot, 18th-century house, which also has an adjacent one-bedroom cottage that dates to the 1920s. But “I quickly fell in love,” he adds. Part of the appeal was that the old house hadn’t had its integrity sullied with too many additions over the centuries, which is the case for many homes in the area. “Too many of them are a labyrinth,” Todd says. “This has the wonderful layout of 35-foot-long, 10-foot-wide corridors, and good, square rooms off the halls.” He moved his eponymous shop, which offers a mix of pieces from his thriving custom furniture line and other objects, from New York City to the charming town of Mill- brook, around the corner from home. Todd’s own designs populate the living room, including a cozy armless sofa in blue linen and slipper chairs in cinnamon suede. He is open to quirky inspirations, part of his overall eclectic taste. “The finials on the slipper chairs are based on the top of a tequila bottle someone sent me,” he says. A dark, dramatic oil paint- ing by Thomas Fougeirol provides extra depth and texture. The approach Todd takes is to design something himself if the perfect piece doesn’t exist. For the dining room, both the ebony-stained oak table and the Louis XVI–style chairs are from his custom line. But in the kitchen, around the simpler dining table that he created in oak, he placed 1950s German school chairs with a retro-modern curved splat. The impulse to acquire began early. As a teenager on a collecting outing with his father in Melbourne, he picked up an 18th-century English mahogany hall chair, which now resides by the front entrance and the charming Dutch-style door, painted apple green. A more recent purchase, an elab- orate 17th-century gilt Italian console, stands nearby in the
  • 114. E L L E D E C O R 105 The dining area of the kitchen is anchored by a custom solid oak table and side- board. Pendant by FontanaArte; 19th-century Japanese glass hibachi. living room, with a contemporary painting hung above it. Tambutto says that the constellation of collected pieces creates a “beautiful energy.” He adds: “As you move around the house, there’s always something beautiful to look at.” In the wide upstairs hallway, Todd placed an 1815 Portu- guese daybed, made of rosewood and rattan, and covered it in raw silk. “It’s a great spot for a nap,” he says. Sleep is just as easy in the bedrooms, which have original fireplaces for an extra cozy factor. The headboard in the primary bedroom is a green raw silk affair of Todd’s own design; to enrich it, he had some vintage ikat fabric stitched along each side. Throughout the house is evidence of Todd’s ability to give an object new life with the right context: His entry rug is actually a Persian rice dryer, and his dining room curtains are made from a repurposed Indian tablecloth. Uncrowded and thoughtful combinations of new and old make for a decorating scheme that feels like it has always been there, folding the best of the 1750s into 2023. “I like to honor a timeless point of view,” Todd says. “One that doesn’t date itself.” ◾
  • 115. “Form and shape can breathe here.” —ANTONY TODD The living room’s key feature is a pair of custom armless sofas. Curtains by Holland Sherry; side table by La Roue Vallauris; rug by Merida; decorative pillows by Pat McGann; art- work by Thomas Fougeirol.
  • 116. 107 E L L E D E C O R
  • 117. LEFT: A painting by Lautaro Tambutto makes a statement in the studio of the guest cottage. Vintage French country table; mirror (on table) by Eve Kaplan. BELOW: The bedding in the main bedroom is by Cultiver Linen. Rug by Merida; curtains by Holland Sherry. OPPOSITE: The guest room features a pair of Early American beds. Rug by Merida; lamp by Lisa Conway; raffia wall decor by Javier Sánchez Medina.
  • 118. E L L E D E C O R 109
  • 119. E L L E D E C O R 110 Elad Yifrach outside his apartment in a former mansion in Lisbon’s Principe Real neighborhood. OPPOSITE: In the living room, the custom sectional is in a Dedar silk velvet and topped with Fortuny pil- lows. Terra-cotta side table by Barracuda Interiors; artwork by Roger Lersy. For details, see Resources.
  • 120. BY JULIE LASKY PHOTOGRAPHS BY DANIEL SCHÄFER Captivated by the allure of Lisbon, a globe-trotting design entrepreneur puts down roots in a former aristocrat’s residence.
  • 121. E L L E D E C O R 112 hen, in 2019, pandemic was still mostly a word in science fiction novels, Elad Yifrach picked up and moved to Portugal. He had lost patience with New York’s intensity, he says, speaking from his home in a former mansion on a hilltop in downtown Lisbon. Having grown up in the Mediterranean sunshine of Israel and later the mellow embrace of Los Angeles, he was attracted to the country, whose easy climate and lifestyle have led it to be called the California of Europe. Yifrach is the founder and creative director of the lux- ury design company L’Objet. It is his habit to roam the world, collaborating with the artisans who make L’Objet’s refined tableware and expressive furnishings. After growing fond of Portugal over many visits, he decided to move there, especially since he’d found the home of his dreams. “You know that kind of place,” he says. “It’s the one you pass every day, always wondering who lives there.” Located on the Avenida da Liberdade, the Champs-Élysées of Lisbon, the building that sparked his imagination dates from the early 19th century and has a massive arched entry of volca- nic stone inset with an iron-studded wood door that could admit a team of oxen. An aristocratic family had occupied the mansion for 140 years before it was divided in the 1990s into two apartments, plus ground-level commercial space. When Yifrach learned that the Swiss tenants in the upstairs unit were vacating, he swooped in. The apartment, comprising about 2,700 square feet, had authentic grandeur but was far from perfect. He set about introducing the things he loves and is known for: exquisite materials, details that can be wrought only by hand, and tributes to Art Deco and its close relation, 1970s style. The first uh-oh moment in renovating his new home was what to do with the entrance gallery, a white space that wasn’t “wide enough to be a room or narrow enough to be a hallway.” He made it a jewel box, with walls painted in a high-gloss terra-cotta and a white travertine dining table that sweeps down the space like a contrail. Voilà, he had a room after all, where guests can gather around the table, set with dishware by L’Objet designers like the Haas brothers, along with his collection of 1930s Puiforcat silver. In the jumbo-size living room, the tone shifts from fire to ice, with pale blue walls and soft, lavish seating. Yifrach designed the nearly 15-foot silk-velvet modular sectional, which can be split to create conversational areas. The larger of two cocktail tables in the space is eight feet long and made of Portuguese cedar, with a curved top to diminish its ABOVE: The kitchen retains marble details from when the space was the mansion’s principal bathroom. Christian Haas stools by Favius; shell bowl by L’Objet. RIGHT: A vintage Danish mirror and a 1970s vase rest on an antique shelf in the entry hall. Paint in Picture Gallery Red by Farrow Ball. OPPOSITE: The hallway doubles as a dining area, with a white travertine table designed by Yifrach. Vintage chairs by Bruno Rey; vintage pendant by Tony Duquette; custom rug by Holland Sherry; artwork by Vasco Araújo.
  • 122.
  • 123. 114 E L L E D E C O R A custom velvet bed pairs with a vintage Berber rug in the guest room. Vintage Mexican rocking chair; pendant by Apparatus Studio; artwork by Lynn Umlauf. OPPOSITE, LEFT: The bath- room is painted in Skylight by Farrow Ball. Artwork by Sebastião Lobo. OPPOSITE, RIGHT: Yifrach with his son, Levi, in the nursery. Custom armchair; throw by the Elder Statesman; chest by Oliver Furniture; wallpaper by Fornasetti.
  • 124. bulk. “I didn’t want one rectangular piece that looked like a tomb,” he explains. For all the ways the living room tempts you to fling yourself onto a sofa, the primary bedroom is even more of a master class in relaxation. It is meant to be an ocular “palate cleanser” after a long day of visual stimulation. The walls are covered in a neutral grass cloth that scatters light like an overexposed photo, and the bed is topped with sage green linen that had been acid washed to “kill the vibrant tones.” “I’m a big bath person,” says Yifrach of the claw-foot tub in his bathroom. This is where he retreats to soak off the aches of frequent yoga sessions. The kitchen, carved out of the mansion’s former main bathroom, marble and all, overlooks Lisbon’s botanical gardens: “A really nice back- drop to washing dishes,” he says. Among the apartment’s dozens of striking objects— including a Ghanaian fertility goddess, a palm tree picked up in the Azores, and L’Objet’s delicate Neptune bowl made of fused porcelain seashells—a standout is a pair of 1940s Portuguese iron sconces that resemble kelp. With the encouragement of Alexandre Neimann, of Barracuda Inte- riors in Lisbon, who designed and supplied several pieces for the home, Yifrach said he set the sconces close together on the living room wall so that their “fronds are kissing.” Speaking of love, soon after he moved into his new home, Yifrach enlisted the help of a surrogate and is now the father of a baby boy. The room he designed for his son, Levi, is made for dreaming: Clouds float along the Forna- setti wallpaper, and a white bouclé armchair spreads its welcoming arms. “Levi is a gift I got from the pandemic, when we were all forced to stop and reflect,” Yifrach says. “I realized, What was I waiting for?” ◾
  • 125. 116 E L L E D E C O R After a long day of visual stimulation, the primary bedroom is meant to be an ocular “palate cleanser,” Yifrach says.
  • 126. Yifrach’s friend, designer Robert Passal, collabo- rated on the design of the main bedroom’s sofa, which is in a Fortuny cash- mere velvet. 1970s Italian cocktail table; sea-grass wallcovering by Mark Alexander; artworks by Vasco Araújo.
  • 127. ELLEDECOR(ISSN1046-1957)Volume34,Number3,April2023,ispublishedmonthly except forcombinedissuesinDecember/January/FebruaryandJune/July/August,byHearst, 300West57thStreet,NewYork,NY10019U.S.A.StevenR.Swartz,PresidentChief Executive Officer;WilliamR.HearstIII,Chairman;FrankA.Bennack,Jr.,ExecutiveViceChairman; MarkE.Aldam,ChiefOperatingOfficer.HearstMagazineMedia,Inc.:DebiChirichella,President; KateLewis,ChiefContentOfficer;ReginaBuckley,ChiefFinancialandStrategyOfficer Treasurer;CatherineA.Bostron,Secretary. ©2023byHearstMagazineMedia,Inc.Allrights reserved.ELLEandELLEDECORareusedunderlicensefromthetrademarkowner,Hachette FilipacchiPresse.PeriodicalspostagepaidatN.Y.,N.Y.,andadditionalmailingoffices. CanadaPostInternationalPublicationsmailproduct(Canadiandistribution)salesagreement No.40012499.EditorialandAdvertisingOffices:300West57thStreet,NewYork,NY10019. Subscriptionprices:UnitedStatesandpossessions:$15foroneyear.Canada:$41foroneyear. Allothercountries:$60foroneyear.SubscriptionServices:ELLEDECORwill,uponreceiptofa completesubscriptionorder,undertakefulfillmentofthatordersoastoprovidethefirstcopyfor deliverybythePostalServiceoralternatecarrierwithin4–6weeks.Forcustomerservice,changes ofaddress,andsubscriptionorders,logontoelledecor.com/serviceorwritetoCustomerService Department,ELLEDECOR,P.O.Box6000,Harlan,IA51593.Fromtimetotime,wemakeour subscriberlistavailabletocompanieswhosellgoodsandservicesbymailthatwebelievewould interestourreaders.Ifyouwouldrathernotreceivesuchoffersviapostalmail,pleasesendyour currentmailinglabelorexactcopytoMailPreferenceService,P.O.Box6000,Harlan,IA51593. Youcanalsovisitpreferences.hearstmags.comtomanageyourpreferencesandoptoutofreceiving marketingoffersbyemail.ELLEDECORisnotresponsibleforunsolicitedmanuscriptsorart. Nonewillbereturnedunlessaccompaniedbyaself-addressedstampedenvelope.Canadian registrationnumber126018209RT0001.POSTMASTER:Pleasesendaddresschangesto ELLEDECOR,P.O.Box6000,Harlan,IA51593.PrintedintheU.S.A. E L L E D E C O R 118 R E S O U RC E S DANIEL SCHÄFER Items pictured but not listed are from private collections. TABLE OF CONTENTS PAGE 22: Sofa fabric: LoroPiana, us.loropiana.com. Cocktail table: AndriannaShamaris,andrianna shamarisinc.com.PAGE 24: Vase: L’Objet,l-objet.com.PAGE 26: Sofa: Poltronova,poltronova.it. HOUSE CALL Interior design: Andre Herrero, Charlap Hyman Herrero, ch-herrero.com. PAGE 56: Sculpture: OliviaErlanger, oliviaerlanger.com.PAGE 58: Paper cutouts: AdamCharlapHyman, ch-herrero.com. Ceiling lights: Zangra,zangra.com.PAGE 60: Lamp: Artemide,artemide.com. FURNITURE FANTASY Furniture: Janus et Cie, janusetcie .com. PAGES 68–69: Cardigan and pants: Missoni,missoni.com. Bathing suit: ShaniShemer,shanishemer.com. Jacket, shirt, skirt, and earrings: Moschino,moschino.com. Shoes: SophiaWebster,sophiawebster.com. Bathing suit: MaraHoffman, marahoffman.com. Shirt: Soraya, soraya.pk. Shorts: RalphLauren, ralphlauren.com. Shoes: RonTomson, rontomson.com.PAGE 70: Cover-up and bathing suit:ShaniShemer. Sunglasses: Lapima,us.lapima.com. Hat: SenseStudio,sensestudio.nyc. PAGE 71: Melamine bowl: Thomas FuchsCreative,thomasfuchscreative .com.Bathing suits, pants, jacket, sunglasses:Gucci,gucci.com.Shirt and skirt:Etro,etro.com.Shirt and shorts: Prada,prada.com. Caftan: SilviaTcherassi,silviatcherassi .com. Dress: GiambattistaValli, giambattistavalli.com. Shoes: Sophia Webster. Glasses: ThomasFuchs Creative. Napkins: ThomasFuchs CreativextheNapKing,thenapking .com. Jacket, shirt, and pants:Ron Tomson. Sunglasses: PrivéRevaux, priverevaux.com. Shoes: ColeHaan, colehaan.com. Jacket: LeThanh Hoa,lethanhhoa.com.Tank top and pants:Dior,dior.com. Sunglasses: CultGaia,cultgaia.com. Shoes: SophiaWebster. Dress: TrinaTurk, trinaturk.com. Sunglasses: Lapima. Shoes: Alevi,alevimilano.com.Top and skirt:Zimmermann,zimmermann .com. Sunglasses: Lapima. Shoes: SophiaWebster. A REAL GEM Interior design: Matthew Harris, matthewharris.studio. PAGE 74: Sofa: ElCorteInglés,el corteingles.es. Artwork: Magnus Sodamin,@magnificentmagnus. PAGE 75: Clothing: SaintLaurent, ysl.com. Chair: JaderAlmeida, jaderalmeida.com. Cocktail table: AreaStoreLisbon,areastore.com. Chandelier: AndrewNeyer, andrewneyer.com.PAGE 76: Vase: VistaAlegre,vistaalegre.com. PAGE 77: Sconces: AreaStoreLisbon. PAGE 78: Fixtures: Roca,roca.com. PAGE 79: Pendant: Gubi,gubi.com. Bedcovering: Matteo,matteola.com. MEET THE PARENTS Interior design: Garrett Hunter, garretthunter.com. PAGE 81: Pendant: JeffreyCheung, @jeffcheung1. Artwork: Nadine Schemmann,nadineschemmann .com.PAGES 82–83: Cocktail table: MichaelT.Landrum,michaelt landruminc.com. Floor lamp: Marni, marni.com.PAGE 84: Paint: Sherwin- Williams,sherwin-williams.com. Sconces: TiwaSelect,tiwa-select .com.PAGE 86: Side table: Hammer andSpear,hammerandspear.com. Vase: AddisonWoolsey,addison woolsey.co. Mattress linen: Holland Sherry,hollandandsherry.com. Pillow wool: Larsen,cowtan.com. Curtains: PierreFrey,pierrefrey.com. BIG EASY ELEGANCE Interior design: Michelle R. Smith, studiomrs.com. PAGE 89: Chair fabric: PierreFrey, pierrefrey.com. Sconces: Studio MRS,studiomrs.com. Artwork: John Rosis,johnrosis.webs.com.PAGE 90: Paint: BenjaminMoore,benjamin moore.com.PAGE 91: Chair fabric: PierreFrey. Curtains: Fortuny,fortuny .com.PAGE 92: Fittings: Dornbracht, dornbracht.com. Stools: MarioBellini byCassina,cassina.com. Chiminea pot: SundayShop,sundayshop.co. PAGE 93: Wall shelving: Vitsoe, vitsoe.com. Tiles: QuemereDesigns, quemeredesigns.com. Fixtures: BarberWilsons,barberwilsons.com. PAGE 94: Quilts: GarnetHill,garnet hill.com. Pendant: Artemide, artemide.com. Curtains: Fortuny. Rug: PattersonFlynn,pattersonflynn .com. Tiles: QuemereDesigns. Fixtures: BarberWilsons. Wallpaper: LewisWood,lewisandwood.co.uk. Quilt: BellaNotte,bellanotte.nyc. PAGE 95: Light fixture: Wyeth, wyeth.nyc. Stair runner: Woodard Greenstein,woodardweave.com. PAGE 96: Tub: AlbionBath,albion bathco.com. Paint: FarrowBall, farrow-ball.com. Fixtures: Barber Wilsons.PAGE 97: Bed: Ironware International,ironwareinternational .com. Armchair linen: RoseTarlow, rosetarlow.com. Quilt: GarnetHill. Curtains: Kravet,kravet.com. LIFE’S RICH TAPESTRY Suzanne Rheinstein, suzanne rheinstein.com. KRB, krbnyc.com. PAGE 99: Fabric: LeeJofa, kravet.com. IT’S STILL STANDING Interior design: Antony Todd, antonytodd.com. PAGE 102: Table: RH,Restoration Hardware,rh.com. Chairs: CB2,cb2 .com. Umbrella: AuthenTeak,authen teak.com.PAGE 103: Runner: Double Knot,double-knot.com.PAGE 105: Pendant: FontanaArte,fontanaarte .com.PAGE 106: Curtains: Holland Sherry,hollandandsherry.com. Rug: Merida,meridastudio.com. Pillows: PatMcGann,patmcganngallery.com. Artwork: ThomasFougeirol,thomas fougeirol.com.PAGE 108: Mirror: EveKaplan,geraldblandinc.com. Bedding: CultiverLinen,cultiver.com. Rug: Merida. Curtains: Holland Sherry.PAGE 109: Rug: Merida. Lamp: LisaConway,lisaconway.com. Wall decor: JavierSánchezMedina, javiersmedina.com. TUDO BEM! Interior design: Elad Yifrach, @eladyifrach. PAGE 73: Lamp: BarracudaInteriors, barracuda-interiors.com. Sculpture: StéphaneParmentier,stephane parmentier.com.PAGE 111: Sofa fabric: Dedar,dedar.com. Pillows: Fortuny,fortuny.com. Side table: BarracudaInteriors.PAGE 112: Stools: Favius,favius.de. Shell bowl: L’Objet,l-objet.com. Paint: FarrowBall,farrow-ball.com. PAGE 113: Pendant: TonyDuquette, tonyduquette.com. Rug: Holland Sherry,hollandandsherry.com. Artwork: VascoAraújo,vasco araujo.org.PAGE 114: Pendant: ApparatusStudio,apparatusstudio .com.PAGE 115: Paint: Farrow Ball. Artwork: SebastiãoLobo, sebastiaolobo.com. Throw: TheElder Statesman,elder-statesman.com. Chest: OliverFurniture,oliverfurniture .com. Wallpaper: Fornasetti, fornasetti.com. PAGES 116–117: Sofa fabric: Fortuny. Wallcovering: MarkAlexander,markalexander.com. Artwork: VascoAraújo. CORRECTION InourMarchissue,theTalentcolumn (page58)misidentifiedtheportrait ofWilliSmithasaself-portrait.The portraitisbytheartistRobertRisko. The living room of Elad Yifrach’s Lisbon apartment (page 110).
  • 128. DESIGN. FASHION. CULTURE. ELLE DECOR|LIFE PROMOTION FLEXFORM The Marley armchair, designed by Antonio Citterio, is distinguished by its soft shapes and sleek design, the ideal blend of classic appeal and contemporary spirit. A swivel metal base makes contrast with the superior comfort of the seat and backrest cushions that are filled with goose down. The perfect seating to relax. flexform.it/en JANUS ET CIE On the eve of Art Basel, JANUS et Cie celebrated exquisite design and inventive fare in Coral Gables with an exclusive dinner event at TUR Kitchen in partnership with ELLE DECOR. Guests enjoyed a five-course tasting menu, concluding with drinks and desserts at the nearby JANUS et Cie showroom. janusetcie.com TODD MERRILL STUDIO The Sarcomere Console by Joseph Cleghorn and Connor Moxam uses a proprietary technique that manipulates woven strands of cardboard encased in a series of resin pours into complex patterns. The new material is durable, sustainable, with endless possibilities for both construction and design. Glazes, lacquers and applied metals, give the surface a metal-like look and feel. The cabinet features doored compartments lined in bronze, and a hidden side cabinet with shelves for barware. toddmerrillstudio.com From left: Bill Pittel, Alexis Contant, Parker Larson, and Ingrid Abramovitch
  • 129. 120 E L L E D E C O R MY K I N D O F RO OM ANNA AND EUGENI BACH “I had always wanted to see Sainte-Marie de la Tourette, the priory Le Corbusier built between 1953 and 1960 outside Lyon, France. In 2011, I took a train down from Paris—almost 300 miles away—only to dis- cover that it was closed. A priest on the grounds took pity on me, offered me food and water, and allowed me to spend the night. I remember following him into the kitchen for bread, and the feeling of never wanting to leave coming over me. The space is delicate yet powerful, and for- ever inspiring for its use of color and the austerity of its lines.” —As told to Camille Okhio The kitchen at Sainte-Marie de la Tourette priory in Éveux, France. couventdelatourette.fr LIKE APRAYER Designer Harry Nuriev finds himself enraptured with architectural asceticism.
  • 130. Mastering the art of outdoor living since 1945. Brown Jordan is a registered trademark of Brown Jordan Inc.