Medgenics is developing a proprietary biopump technology using autologous tissue to produce and deliver therapeutic proteins locally and continuously for chronic diseases. Their lead products address large markets for anemia, hepatitis C, and hemophilia. Clinical trials of their EPODURE product for anemia treatment have shown hemoglobin levels can be sustained for 6-28 months from a single administration, replacing frequent injections. Medgenics believes their biopump platform could transform treatment by improving outcomes and lowering costs compared to current protein therapies.
What have you learned from your audience feedbackmariaa800
The document discusses research conducted to inform the creation of an R&B music video. Initial research through questionnaires found that Usher was the most associated artist with R&B and that black and gold colors should be used. A focus group of 13-17 year olds provided feedback that the video should have a clear narrative, limited dancing, and good clothing associated with R&B. Audience feedback questionnaires after the video's release collected reviews from the film class and others to improve future videos.
Photosynthesis is the process by which plants, algae, and some bacteria use sunlight, carbon dioxide, and water to produce oxygen and energy in the form of glucose. It occurs in chloroplasts in plant leaves. Chloroplasts contain chlorophyll which captures light energy and drives the photosynthetic process. Photosynthesis splits water molecules to produce oxygen gas and electrons that are used to reduce carbon dioxide into sugars. It is a redox process consisting of two stages - the light-dependent reactions where ATP and NADPH are produced, and the Calvin cycle where sugars are assembled from carbon dioxide.
Dokumen tersebut membahas tentang berbagai jenis ekosistem, baik ekosistem air maupun ekosistem darat. Dokumen menjelaskan komponen-komponen pembentuk ekosistem seperti abiotik dan biotik, serta contoh-contoh ekosistem akuatik seperti sungai, danau, laut; dan ekosistem darat seperti hutan hujan tropis, sabana, gurun. Dokumen juga membahas tentang ekosistem buatan yang dibuat oleh manusia
This letter discusses the results of the LateTIME trial, which found no benefit of intracoronary delivery of bone marrow mononuclear cells (BMCs) 2-3 weeks after myocardial infarction. The authors provide several points for consideration:
1) Patient selection is important, and it is unclear why some patients with non-left anterior descending artery lesions were included.
2) A mixed cardiomyopathy could have explained the initial left ventricular dysfunction in some patients.
3) Delivering cells to patients with more severe and persistent left ventricular dysfunction may have shown greater benefit.
4) The number of CD34 cells delivered in this trial was lower than levels found to be efficacious in other studies.
Medgenics is developing a proprietary biopump technology using autologous tissue to produce and deliver therapeutic proteins locally and continuously for chronic diseases. Their lead products address large markets for anemia, hepatitis C, and hemophilia. Clinical trials of their EPODURE product for anemia treatment have shown hemoglobin levels can be sustained for 6-28 months from a single administration, replacing frequent injections. Medgenics believes their biopump platform could transform treatment by improving outcomes and lowering costs compared to current protein therapies.
What have you learned from your audience feedbackmariaa800
The document discusses research conducted to inform the creation of an R&B music video. Initial research through questionnaires found that Usher was the most associated artist with R&B and that black and gold colors should be used. A focus group of 13-17 year olds provided feedback that the video should have a clear narrative, limited dancing, and good clothing associated with R&B. Audience feedback questionnaires after the video's release collected reviews from the film class and others to improve future videos.
Photosynthesis is the process by which plants, algae, and some bacteria use sunlight, carbon dioxide, and water to produce oxygen and energy in the form of glucose. It occurs in chloroplasts in plant leaves. Chloroplasts contain chlorophyll which captures light energy and drives the photosynthetic process. Photosynthesis splits water molecules to produce oxygen gas and electrons that are used to reduce carbon dioxide into sugars. It is a redox process consisting of two stages - the light-dependent reactions where ATP and NADPH are produced, and the Calvin cycle where sugars are assembled from carbon dioxide.
Dokumen tersebut membahas tentang berbagai jenis ekosistem, baik ekosistem air maupun ekosistem darat. Dokumen menjelaskan komponen-komponen pembentuk ekosistem seperti abiotik dan biotik, serta contoh-contoh ekosistem akuatik seperti sungai, danau, laut; dan ekosistem darat seperti hutan hujan tropis, sabana, gurun. Dokumen juga membahas tentang ekosistem buatan yang dibuat oleh manusia
This letter discusses the results of the LateTIME trial, which found no benefit of intracoronary delivery of bone marrow mononuclear cells (BMCs) 2-3 weeks after myocardial infarction. The authors provide several points for consideration:
1) Patient selection is important, and it is unclear why some patients with non-left anterior descending artery lesions were included.
2) A mixed cardiomyopathy could have explained the initial left ventricular dysfunction in some patients.
3) Delivering cells to patients with more severe and persistent left ventricular dysfunction may have shown greater benefit.
4) The number of CD34 cells delivered in this trial was lower than levels found to be efficacious in other studies.
The document is a collection of pages from a publication by Kaihan Krippendorff discussing strategic narratives and outthinking competitors. It provides summaries of 5 strategic narratives ("Force two-front battle", "Create something out of nothing", "Move early to the next battleground", "Coordinate the uncoordinated", "Be good") and discusses how to apply them to identify leverage points, generate alternative strategies, and select an option that will be difficult for competitors to copy. The document aims to provide tools for imagining and committing to alternative futures.
Talk I delivered April 25, 2014 to the "Gathering of Titan's" event in Boston, a room full of entrepreneurial CEOs, building businesses. Pulled from my "Way of Innovation," here are the five phases the journey of any innovator/ titan/ outthinker passes through:
1. Metal - grow discontented
2. Water - create possibility
3. Wood - formation, pushing through resistance
4. Fire - breakout, passing the tipping point
5. Earth - consolidating your gains
Then you destroy your innovation and start again, as Pablo Picasso said "All creativity is at first an act of destruction."
Link to book: http://www.amazon.com/Way-Innovation-Elements-Reinvent-Organization-ebook/dp/B0045U9UGQ/ref=sr_1_1?ie=UTF8&qid=1398457130&sr=8-1&keywords=way+of+innovation
The document discusses the results of a study on the effects of a new drug on memory and cognitive function in older adults. The double-blind study involved giving either the new drug or a placebo to 100 volunteers aged 65-80 over a 6 month period. Testing showed those receiving the drug experienced statistically significant improvements in short-term memory retention and processing speed compared to the placebo group.
Accessing the Power of Pro Bono Through the Readiness Roadmap Yvonne Turner
Have you ever wondered how you could help your nonprofit partners take their organization to the next level with pro bono support? On July 22, speakers from Points of Light, Taproot Foundation and Capital one led a training on a new tool-- the Readiness Roadmap—a one-stop shop designed to help nonprofits navigate and manage skills-based volunteering. Explore each stop on the Roadmap that will empower nonprofits to: improve their readiness to receive pro bono, identify their skills-based volunteer needs, find the right volunteers, and more!
The document provides information about travel destinations in several countries, including Singapore, Malaysia, Australia, and New Zealand. It discusses the history and attractions of each location. In Singapore, it describes tourist attractions like the Singapore Flyer Ferris wheel and Sentosa Island amusement park. For Malaysia, it mentions places such as Langkawi island and the Petronas Twin Towers in Kuala Lumpur. Major Australian attractions highlighted include the Sydney Opera House and Harbor Bridge. In New Zealand, the Beehive government building in Wellington and volcanic Rangitoto Island are summarized.
XXII - Rodman & Renshaw Research Report - May 2011.
22nd Century Ltd, LLC (OTCBB: XXII; Twitter: $XXII) is a plant biotechnology company and the global leader in modifying the content of nicotinic alkaloids in plants, including the tobacco plant, through genetic engiineering and plant breeding.
BioNeutral Group (OTCBB: BONU) is a specialty technology-based life science company which has developed a technology platform that neutralizes harmful environmental contaminants, toxins and dangerous micro-organisms including bacteria, viruses, mold, fungi and spores. BioNeutral's products, Ygiene™ and Ogiene™, kill germs and clean surfaces with a dramatic increase in speed and power over their rivals in the marketplace.
1) NeoStem will begin a Phase II clinical trial of its product AMR-001 for the treatment of Acute Myocardial Infarction by the fourth quarter of 2011. AMR-001 uses enriched bone marrow derived stem cells to increase blood flow in heart muscle and limit damage after a heart attack.
2) China pharmaceutical sales for NeoStem were down in the second quarter due to a strategic decision to discontinue certain low margin products, but are expected to rebound as higher margin products increase.
3) NeoStem is transitioning to focus on cellular therapeutics and stem cell services through acquisitions like Progenitor Cell Therapy, while exploring options for non-core
The document provides an overview of a specialty pharmaceutical company and its product pipeline. It summarizes 6 abbreviated new drug applications (ANDAs) under FDA review for generic versions of branded drugs representing $6.6 billion in sales. It also describes a proprietary abuse-resistant drug delivery platform. Examples of potential US market size and revenue for the generic products are estimated based on assumptions around market share and pricing.
Spago4Q at ePractice 2011 workshop "Open Source: Its place in a cross-border ...Davide Dalle Carbonare
1) The SLA approach in open source quality improvement in products & projects realization and in services supply through an effective OSS measuring and monitoring platform.
2) Public administrations goal is to purchase quality services from providers to provide quality services to citizens, enterprises, and employees. Quality must be correlated to goals, allow formalizing requested service levels, and allow verifying attained levels transparently.
3) The tool, SLAs and quality indicators, allows providing operational goals with measurable results, monitoring the supply lifecycle and all ICT services activities, and monitoring quality over time.
The document is a collection of pages from a publication by Kaihan Krippendorff discussing strategic narratives and outthinking competitors. It provides summaries of 5 strategic narratives ("Force two-front battle", "Create something out of nothing", "Move early to the next battleground", "Coordinate the uncoordinated", "Be good") and discusses how to apply them to identify leverage points, generate alternative strategies, and select an option that will be difficult for competitors to copy. The document aims to provide tools for imagining and committing to alternative futures.
Talk I delivered April 25, 2014 to the "Gathering of Titan's" event in Boston, a room full of entrepreneurial CEOs, building businesses. Pulled from my "Way of Innovation," here are the five phases the journey of any innovator/ titan/ outthinker passes through:
1. Metal - grow discontented
2. Water - create possibility
3. Wood - formation, pushing through resistance
4. Fire - breakout, passing the tipping point
5. Earth - consolidating your gains
Then you destroy your innovation and start again, as Pablo Picasso said "All creativity is at first an act of destruction."
Link to book: http://www.amazon.com/Way-Innovation-Elements-Reinvent-Organization-ebook/dp/B0045U9UGQ/ref=sr_1_1?ie=UTF8&qid=1398457130&sr=8-1&keywords=way+of+innovation
The document discusses the results of a study on the effects of a new drug on memory and cognitive function in older adults. The double-blind study involved giving either the new drug or a placebo to 100 volunteers aged 65-80 over a 6 month period. Testing showed those receiving the drug experienced statistically significant improvements in short-term memory retention and processing speed compared to the placebo group.
Accessing the Power of Pro Bono Through the Readiness Roadmap Yvonne Turner
Have you ever wondered how you could help your nonprofit partners take their organization to the next level with pro bono support? On July 22, speakers from Points of Light, Taproot Foundation and Capital one led a training on a new tool-- the Readiness Roadmap—a one-stop shop designed to help nonprofits navigate and manage skills-based volunteering. Explore each stop on the Roadmap that will empower nonprofits to: improve their readiness to receive pro bono, identify their skills-based volunteer needs, find the right volunteers, and more!
The document provides information about travel destinations in several countries, including Singapore, Malaysia, Australia, and New Zealand. It discusses the history and attractions of each location. In Singapore, it describes tourist attractions like the Singapore Flyer Ferris wheel and Sentosa Island amusement park. For Malaysia, it mentions places such as Langkawi island and the Petronas Twin Towers in Kuala Lumpur. Major Australian attractions highlighted include the Sydney Opera House and Harbor Bridge. In New Zealand, the Beehive government building in Wellington and volcanic Rangitoto Island are summarized.
XXII - Rodman & Renshaw Research Report - May 2011.
22nd Century Ltd, LLC (OTCBB: XXII; Twitter: $XXII) is a plant biotechnology company and the global leader in modifying the content of nicotinic alkaloids in plants, including the tobacco plant, through genetic engiineering and plant breeding.
BioNeutral Group (OTCBB: BONU) is a specialty technology-based life science company which has developed a technology platform that neutralizes harmful environmental contaminants, toxins and dangerous micro-organisms including bacteria, viruses, mold, fungi and spores. BioNeutral's products, Ygiene™ and Ogiene™, kill germs and clean surfaces with a dramatic increase in speed and power over their rivals in the marketplace.
1) NeoStem will begin a Phase II clinical trial of its product AMR-001 for the treatment of Acute Myocardial Infarction by the fourth quarter of 2011. AMR-001 uses enriched bone marrow derived stem cells to increase blood flow in heart muscle and limit damage after a heart attack.
2) China pharmaceutical sales for NeoStem were down in the second quarter due to a strategic decision to discontinue certain low margin products, but are expected to rebound as higher margin products increase.
3) NeoStem is transitioning to focus on cellular therapeutics and stem cell services through acquisitions like Progenitor Cell Therapy, while exploring options for non-core
The document provides an overview of a specialty pharmaceutical company and its product pipeline. It summarizes 6 abbreviated new drug applications (ANDAs) under FDA review for generic versions of branded drugs representing $6.6 billion in sales. It also describes a proprietary abuse-resistant drug delivery platform. Examples of potential US market size and revenue for the generic products are estimated based on assumptions around market share and pricing.
Spago4Q at ePractice 2011 workshop "Open Source: Its place in a cross-border ...Davide Dalle Carbonare
1) The SLA approach in open source quality improvement in products & projects realization and in services supply through an effective OSS measuring and monitoring platform.
2) Public administrations goal is to purchase quality services from providers to provide quality services to citizens, enterprises, and employees. Quality must be correlated to goals, allow formalizing requested service levels, and allow verifying attained levels transparently.
3) The tool, SLAs and quality indicators, allows providing operational goals with measurable results, monitoring the supply lifecycle and all ICT services activities, and monitoring quality over time.
Spago4Q at ePractice 2011 workshop "Open Source: Its place in a cross-border ...
Cahaya Garuda Residence
1.
2. Profile PT. Freeland Property didirikanolehsalahsatupimpinannya, James Sastrowijoyo yang lahirdi Bandung 1982, putrapertamadari 3 bersaudara. Sudahmemulaibisnissejakusia 13 tahun. Mulaidarijualanbukusekolah, sepatu, tas, dagangsayurmayurdipasarinduk, jualbeliberlian & emas, pakaianseragamkeperusahaansudahsayajalani. Dahulu, sayaanggapbahwauntukmenjadikayaharusBekerjaKeras.Tetapihasilnyacumaitu-itusaja, takada yang berubah… Sampaipadasuatuhari, sayabertemudenganseorangkaya yang kerjaannyahanyabermain-main denganistridananaknyatiapharitanpaharuskerja. Terbesitdalampikiransaya, apa yang dilakukanolehorangtersebut. Setelahmengumpulkankeberanian, akhirnyasayamemberanikandiriuntukbertanyaaparahasianya? beliaulangsungmenjawab, sayakayadenganmembelirumahdanmenyulaprumahuntukbekerjakepadasaya. Semenjakmendapatkanpetuahtersebut, pikiransayalangsungberkecamuk, sayaharusbisamembuatrumahbekerjauntuksayadandalampencariantersebut, tiba-tibasayamembacaiklantentang seminar Properti GRATIS yang diadakanoleh Tung DesemWaringin. Wah, pucukdicintaulamtiba, dengansemangat, sayamendaftaruntukmengikuti seminar tersebut. Sayamengikuti seminar gratis tersebutdenganserius, sayamenyiapkansemuacatatandanternyata seminar ituadalah preview seminar. TerimasihTuhan, seminar initelahmembukawawasansayadansayadapatmenemukanbenangmerahyaitubagaimanaberinvestasidiproperti yang benar. Karenatidaksabarnya, sayalangsungmempraktekkanilmudari seminar Gratisanini. Sayamencari-mencarirumahidamansaya. Ternyatahasilpencariansayaberhasildanlebih DAHSYATNYA lagisayaberhasilmenemukanteoribaruyaitubagaimanabeliRumahtanpakeluaruangdantiapbulannyasayamasihmendapatuangdarirumah yang sayabeli. Propertipertamasayasayabelitanpamengeluarkanuangsepeserpunbahkansayamendapatkanuangtiapbulannya Rp.20.000.000,-/ bulandansayasudahbebassecarafinansialdiusia 25 tahun. Dan sayamenjadiMilyadermudasetelahmenjualrumah yang sayabelitanpauangdengannilaijual Rp5,5 milyarwahrumahbeli gratis sayajualtinggiMendadaksayajadikayadalamwaktusingkat. Bayangkansayamenjadimilyaderdalamwaktu 8 BULAN. Semenjakitusayajadiketagihanuntukmembelirumahdansetiapsayamembelirumahsemakinbanyak pula uangdirekeningsaya.
3. Filosofisminimalismewakiligayahiduppraktis, dinamis, ringkas, efektifdanefisien, yang diterapkandalamsemuaaspekkehidupantermasukarsitekturbangunandan interior. Design minimalisakanmenjaditerasalega (dengansuasanamediatif) denganmengoptimalisasisirkuasiudarasegar yang sehatdengandidukunglingkungannyamemangmasihrelatifhijau, sejukdenganditambah air tanahnyajuga yang masihbaik. Tidakheranbanyak yang memfavoritkanCahaya Garuda Residence sebagaisalahsatukawasanhunianterbaikdiDepok. Gaya hidupmasyarakatdengan trend gaya yang lebihmementingkanunsurkebersihanmenjadikanpemicu model bangunanlebihmengarahkepadagayaminimalis yang lebihtepatnyaminimalis modern. Bangunandengan design modern minimalisinimampumenampilkanbangunan yang elegandanberkelaswalaupundenganpenyelesaianakhir yang sederhanadengangayaminimalisarsitekturtropis, yang dilengkapibebatuan, permainanunsurgarisdanbidang, sertapewarnaan yang cenderunglebihberani.
4. Pride With Naturally Residence DesainModern Minimalis One Gate Cluster System CCTV & Keamanan 24 Jam Akses Internet Playground