SlideShare a Scribd company logo
1 of 29
Download to read offline
FACULTY/PRESENTER DISCLOSURE
• Faculty:
• Relationships with commercial interests:
• The epitope mapping presented was done at Biopeptides
Corp. and the IP is owned by Biopeptides Corp.
DISCLOSURE OF COMMERCIAL SUPPORT
• Potential for conflict(s) of interest:
• Raymond Dattwyler and Biopeptides Corp have received NIH
grants
• BioRad has licensed technology developed by Biopeptides Corp
• Qiagen has licensed technology developed by Biopeptides Corp
LABORATORY DIAGNOSTICS OF LYME
DISEASE, PAST, PRESENT, FUTURE:
RAYMOND J. DATTWYLER, MD
PROFESSOR OF MICROBIOLOGY/IMMUNOLOGY AND MEDICINE
NEW YORK MEDICAL COLLEGE, VALHALLA, NY USA
PRESIDENT BIOPEPTIDES CORP
LYME DISEASE LABORATORY DIAGNOSIS
1980 1990 2000 2010
SEROLOGIC Assays
Antigen targets: whole cell Bb or Bb sonicates
• Problems:
• Whole bacteria contain many epitopes that are
common among other bacterial species – “non-specific
epitopes”-
• Cultured Borrelia can lose plasmids coding key antigens
-
• Some important antigens are not express in in vitro
CDCCRITERIA
TWO-TIERSEROLOGY
First Month of Infection:
First tier: IgG and/or IgM antibody to whole-cell sonicate by either EIA or IFA
Second-tier: IgG and IgM Western blotting if first tier positive or equivocal
2 of 3 IgM bands: 23-, 39-, and 41-kDa
5 of 10 IgG bands: 18-, 23-, 28-, 30-, 39-, 41-, 45-, 58-, 66-, and 93-kDa
After the first month :
First tier: IgG antibody to whole-cell sonicate by either EIA or IFA
Second-tier: IgG Western blotting if first tier positive or equivocal
5 of 10 IgG bands: 18-, 23-, 28-, 30-, 39-, 41-, 45-, 58-, 66-, and 93-kDa
WESTERN BLOT CRITERIA
1. The Criteria were developed using cultured Bb
2. At the time, these criteria were formulated, many of
these antigens were not defined.
3. In Vivo expressed antigen are poorly represented
7
SENSITIVITY OF STANDARD2-TIER
• Early acute disease: 30% to 40%
• Early convalescent disease: 70%
• Early neurological and carditis (Acute Disseminated): 85%
• Late disease: 98+%
2D GEL WESTERN HUMAN LATE DISSEMINATED INFECTION
Nowalk, A. J., R. D. Gilmore, Jr., and J. A. Carroll. 2006. Serologic proteome
analysis of Borrelia burgdorferi membrane-associated proteins. Infect. Immun.
74:3864–3873.
ANTIGENS ASSOCIATED WITH WB
10
PROTEIN Kd Early Intermediate Late
p93 93 + +
Hsp90 90 +
P66* 66 +
OppA2 58 +
ErpB 58 +
BBK32 47 +
FtsZ 45 +
FlaB* 41 +
BmpA 39 +
BBO323* 30 +
OspF 26 + +
OspC 21 +
LA7 20 + +
ErpP 18 + +
DbpA 18 + +
RevA 18 +
ANTIGEN CROSSREACTIVITY
• Crossreactivity is a significant issue in any serodiagnostic assay,
particularly when using preparations derived from whole organisms or
highly conserved proteins.
• Borrelia flagellin generates positive responses in >40% of healthy
individuals with no history of Lyme disease (Liang, FT, et al, J. Clin.
Microbiol. December 1999 vol. 37 no. 12 3990-3996.)
• A 60kDa antigen has seropositivity in >16% of healthy controls
(Liang, FT, et al, J. Clin. Microbiol. December 1999 vol. 37 no. 12
3990-3996.)
• BBO323 Homolgus with periplasmic substrate binding proteins of
Gram Negatives.
• Whole cell sonicate ELISAs can detect antibody at rates greater
than 90% in tropical countries that don’t have Lyme disease
(Burkitt TR, et al, J Infect Dis. (1997) 175 (2): 466-469.)
PROTEINS CONTAIN CROSS REACTIVE REGIONS SIMILAR TO
OTHER BACTERIA
B.BURGDORFERI P41 FLAGELLIN IS A GOOD EXAMPLE
• P66 is a prominent antigen included in
most conventional Lyme seroassays
• We found a significant amount of
antibody binding to 6 different
peptides in serum from healthy and
disease controls
• In concordance, we find that the p66
band on most western blots is
positive regardless of serum source
P66 a lesson in
crossreactivity.
OTHER ANTIGENS ALSO HAVE CROSS REACTIVE EPITOPES
• Peptides were generated from OspC epitope sequences
and screened Lyme and healthy control sera
BENEFITS OF PEPTIDE EPITOPES
• Preservation of specificity by selection epitopes unique to
Borrelia spp., and eliminating ‘cross-reactive’ epitopes
present in other bacterial species
• Conceptually, this improves both the specificity and
sensitivity of seroassays
C6
• The first FDA approved peptide based serodiagnostic assay
• A conserved peptide from the invariable region 6 of the VlsE protein
• Has performed well as a single antigen assay; however, has not performed well
enough to supplant the two-tier paradigm
• C6 does not bind well to IgM, it predominantly binds IgG
• The IR6 region of VlsE is more variable than was initially though, and peptide based
diagnostics are exquisitely sensitive to variances in AA sequence
• The VlsE antigen is not expressed in the tick (<1% of bacteria), therefore it needs to be
upregulated prior to generating immunity, limiting utility in very early responses
• Despite the drawbacks observed, it clearly demonstrates the utility of peptide based
serodiagnostics
EPITOPE MAPPING of the OppA2 protein
Signorino G, Arnaboldi PM, Petzke MM, Dattwyler RJ. Identification of OppA2 linear epitopes as
serodiagnostic markers for Lyme disease. Clin Vaccine Immunol.2014 May;21(5):704-11.
• For OppA2, many sequences were identified, for other proteins only one or two
epitopes were identified per protein
Table 1. Peptide sequences containing immunodominant epitopes of OppA2.
Peptide name
Amino acid sequence
OppA (11-25) IFFLTFLCCNNKERK
OppA (191-225) YGQNWTNPENMVTSGPFKLKERIPNEKIVFEKNNK
OppA (276-290) SDYYSSAVNAIYFYS
OppA (276-300) SDYYSSAVNAIYFYSFNTHIKPLD
OppA (286-300) IYFYSFNTHIKPLD
OppA (286-310) IYFYSFNTHIKPLDNVKIRKALTLA
OppA (356-375) LAEAGYPNGNGFPILKLKYN
OppA (381-400) KKICEFIQNQWKKNLNIDVE
OppA (491-505) APIYIYGNSYLFRND
• Each peptide was run with a
panel of 114 early Lyme, 44
healthy controls, 30 RA, 28 RPR+
• Cutoffs for positivity were
determined as >3SD from mean
of healthy control (positive) and
>2SD from mean of healthy
control (equivocal)
OppA2 ELISA
LESSONS FROM SEROASSAYS DEVELOPMENT
• Identification of new Peptide targets continue to improve
specificity and sensitivity compared to current first tier EIAs
• However, antigen selection must be carefully performed
• No ‘blanket approach’ for epitope identification is effective
• Individual epitopes from different antigens have different
attributes.
• OspC1 binds IgM better than IgG, DbpA4-DbpB6 only works
well as a dipeptide, many p66 epitopes are crossreactive,
p41 has a useful epitope
• It takes time for antibody formation
• IgG levels remain elevated for years after infection, seroassays
cannot distinguish new infection from previous exposures
• Antibody levels do not correlate treatment success
Seroassays have issues that cannot be
overcome
NEW APPROACHES TO LABORATORY DIAGNOSIS
THE FUTURE?
• Metabolomics
• Transcriptome analysis
• Monitoring T cell activity
T CELL RESPONSE
• Distinct kinetics of T cell responses
• Following resolution of infection:
• T cell effector function wanes
• Activated T cell numbers contract
• Cytokine release can be used as a indirect measure
of T cell activation
CYTOKINE RELEASE ASSAY
• The QuantiFERON technology platform
• Whole blood
• Incubate O/N, Harvest plasma
• IFN-γ ELISA
Nil Lyme Mito
TARGET ANTIGENS
• Sequences for each antigen were
evaluated against protein databases
using the NCBI Basic Local Alignment
Search Tool (BLAST).
• Overlapping peptide libraries were
generated for regions with:
• <50% identity with other proteins
and
• >80% identity among Borrellia spp.
• These data were generated using a
mixture of 33 peptides from OspC,
DbpB, p66, and FlaB
Antigens evaluated for T cell
reactivity:
• OspC
• DbpB
• p66
• FlaB
• CRASP2
• Bbk32
• BmpA
• OppA2
• LA-7
• FlilB
• Bdf2
• RecA
PATIENT CHARACTERISTICS
Subjects Median
Age
(range)
Gender
(F/M)
Median
Duration of
Symptoms
(range)
Single vs.
Multiple
EM
Symptomsb
Erythema
migrans+a
(n=29)
58 (19-74) 9/20 5d (2-30) 23/6
headache (n=23)
stiff neck (n=15)
myalgia (n=15)
fever (n=13)
fatigue (n=13)
arthalgia (n=10)
lymphadenopathy (n=1)
none (n=2)
a- >5 cm round lesion, often with partial central clearing
b- symptoms resolved following 10d treatment with Doxycycline
• Blood was collected at initial visit (n=29), 2 months post treatment (n=27), and 6
months post treatment (n=5)
INTERFERON-GAMMA SECRETION
• IFNγ was detected in 3.1% (6 of 192) healthy and
Anaplasmosis controls
Acute Convalescent
(2 mo.)
Convalaescent
(6 mo.)
Positivea
20/29
(69.0%)
IFNγ
(IU/ml)
1.46 ±
2.26
4/27
(15.3%)
1/5
(20.0%)
0.27 ±
0.59
0.13 ±
0.19
a- >3 SD (0.33 IU/ml) from the mean of IFNγ produced in
blood of healthy volunteers (n=187) and Anaplasmosis (n=5).
COMPARISON WITH SEROLOGY
QuantiFERON
ELISA
C6
ELISA
Western Blot
IFNγ (IU) IgM or IgG IgM or IgG
Acute
(n=29)
69.0%
(20/29)
58.6%
(17/29)
17.2%
(5/29)
• When combined the C6 and QuantiFERON ELISAs positively identified
82.8% (24/29) of acute Lyme disease patients
• Adding peptides from additional antigens can increase the sensitivity
of the assay.
SUMMARY
• IFNγ secretion can be used to detect infection with Borrelia burgdorferi
• Requires multiple peptides from different proteins
• IFNγ secretion is reduced following successful antibiotic therapy
• No patients complained of ongoing symptoms following doxycycline
treatment
• Additional studies are warranted to:
• more critically define cut-off values,
• evaluate the inclusion of other antigens
• evaluate localized vs. disseminated Lyme disease
• evaluate late Lyme disease
ACKNOWLEDGEMENTS
• NIH NIAID for their funding
• Biopeptides, Corp./NYMC
• Paul M. Arnaboldi, PhD
• Mariya Sambir, MS
• NYMC
• Mary Petzke, PhD
• Giacomo Signore, PhD
• Gary Wormser, MD
• Gundersen-Lutheran, Wisc.
• Steven Callister, PhD
• Dean Jobe, MS
29

More Related Content

What's hot

Topic review HIV eradication
Topic review HIV eradicationTopic review HIV eradication
Topic review HIV eradicationRongpong Plongla
 
Drug Allergy Testing How and is it important?
Drug Allergy Testing How and is it important?Drug Allergy Testing How and is it important?
Drug Allergy Testing How and is it important?Akron Children's Hospital
 
The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...
The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...
The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...UC San Diego AntiViral Research Center
 
Covid-19 Brief Review | A holistic review at pandemic
Covid-19 Brief Review | A holistic review at pandemic Covid-19 Brief Review | A holistic review at pandemic
Covid-19 Brief Review | A holistic review at pandemic Akhtar Hussain
 
Directly acting antivirals and Visceral Leishmaniasis: A case report
Directly acting antivirals and Visceral Leishmaniasis: A case reportDirectly acting antivirals and Visceral Leishmaniasis: A case report
Directly acting antivirals and Visceral Leishmaniasis: A case reportRxVichuZ
 
Immunoglobulin Replacement Therapy: Individualizing a Regimen
Immunoglobulin Replacement Therapy: Individualizing a RegimenImmunoglobulin Replacement Therapy: Individualizing a Regimen
Immunoglobulin Replacement Therapy: Individualizing a RegimenAllergy Partners of North Texas
 
DNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-ImmunizationDNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-ImmunizationNibedita Mitra
 
High Sensitivity HIV Testing and Translational Science around PrEP
High Sensitivity HIV Testing and Translational Science around PrEPHigh Sensitivity HIV Testing and Translational Science around PrEP
High Sensitivity HIV Testing and Translational Science around PrEPHopkinsCFAR
 
BRN Symposium 03/06/16 The gut microbiome in HIV infection
BRN Symposium 03/06/16 The gut microbiome in HIV infectionBRN Symposium 03/06/16 The gut microbiome in HIV infection
BRN Symposium 03/06/16 The gut microbiome in HIV infectionbrnmomentum
 
MouseAge slideshare
MouseAge slideshareMouseAge slideshare
MouseAge slideshareBartsMSBlog
 
Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...
Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...
Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...HopkinsCFAR
 
Can we cure HIV/AIDS?: A 2014 progress report
Can we cure HIV/AIDS?: A 2014 progress reportCan we cure HIV/AIDS?: A 2014 progress report
Can we cure HIV/AIDS?: A 2014 progress reportZeena Nackerdien
 

What's hot (20)

Mendelian susceptibility to mycobacterial disease
Mendelian susceptibility to mycobacterial diseaseMendelian susceptibility to mycobacterial disease
Mendelian susceptibility to mycobacterial disease
 
Topic review HIV eradication
Topic review HIV eradicationTopic review HIV eradication
Topic review HIV eradication
 
Drug Allergy Testing How and is it important?
Drug Allergy Testing How and is it important?Drug Allergy Testing How and is it important?
Drug Allergy Testing How and is it important?
 
The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...
The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...
The State of the Art in HIV Cure Research – Hope or Hype: What Does It Mean f...
 
Covid-19 Brief Review | A holistic review at pandemic
Covid-19 Brief Review | A holistic review at pandemic Covid-19 Brief Review | A holistic review at pandemic
Covid-19 Brief Review | A holistic review at pandemic
 
Intravenous immunoglobulin for patients with primary immunodeficiency
Intravenous immunoglobulin for patients with primary immunodeficiencyIntravenous immunoglobulin for patients with primary immunodeficiency
Intravenous immunoglobulin for patients with primary immunodeficiency
 
The Latest on HIV Cure Strategies
The Latest on HIV Cure StrategiesThe Latest on HIV Cure Strategies
The Latest on HIV Cure Strategies
 
Directly acting antivirals and Visceral Leishmaniasis: A case report
Directly acting antivirals and Visceral Leishmaniasis: A case reportDirectly acting antivirals and Visceral Leishmaniasis: A case report
Directly acting antivirals and Visceral Leishmaniasis: A case report
 
Frontiers in Immunoglobulin Therapy
Frontiers in Immunoglobulin Therapy Frontiers in Immunoglobulin Therapy
Frontiers in Immunoglobulin Therapy
 
Research to practice - 5 papers of interest
Research to practice - 5 papers of interestResearch to practice - 5 papers of interest
Research to practice - 5 papers of interest
 
Immunoglobulin Replacement Therapy: Individualizing a Regimen
Immunoglobulin Replacement Therapy: Individualizing a RegimenImmunoglobulin Replacement Therapy: Individualizing a Regimen
Immunoglobulin Replacement Therapy: Individualizing a Regimen
 
Chronic Infection and Immunodeficiency
Chronic Infection and Immunodeficiency Chronic Infection and Immunodeficiency
Chronic Infection and Immunodeficiency
 
DNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-ImmunizationDNB pediatrics OSCE-Immunization
DNB pediatrics OSCE-Immunization
 
What's new in c. diff
What's new in c. diffWhat's new in c. diff
What's new in c. diff
 
High Sensitivity HIV Testing and Translational Science around PrEP
High Sensitivity HIV Testing and Translational Science around PrEPHigh Sensitivity HIV Testing and Translational Science around PrEP
High Sensitivity HIV Testing and Translational Science around PrEP
 
Malaria Diagnostics
Malaria DiagnosticsMalaria Diagnostics
Malaria Diagnostics
 
BRN Symposium 03/06/16 The gut microbiome in HIV infection
BRN Symposium 03/06/16 The gut microbiome in HIV infectionBRN Symposium 03/06/16 The gut microbiome in HIV infection
BRN Symposium 03/06/16 The gut microbiome in HIV infection
 
MouseAge slideshare
MouseAge slideshareMouseAge slideshare
MouseAge slideshare
 
Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...
Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...
Françoise Barré-Sinoussi: "Toward an HIV Cure: Learning from viral control of...
 
Can we cure HIV/AIDS?: A 2014 progress report
Can we cure HIV/AIDS?: A 2014 progress reportCan we cure HIV/AIDS?: A 2014 progress report
Can we cure HIV/AIDS?: A 2014 progress report
 

Similar to English: Dr. Raymond J. Dattwyler

Connective Tissue Diseases
Connective Tissue DiseasesConnective Tissue Diseases
Connective Tissue Diseaseskatejohnpunag
 
Presentation of David Rimm in 1st International Antibody Validation Forum 2014
Presentation of David Rimm in 1st International Antibody Validation Forum 2014Presentation of David Rimm in 1st International Antibody Validation Forum 2014
Presentation of David Rimm in 1st International Antibody Validation Forum 2014St John's Laboratory Ltd
 
Cell-based Assays for Immunotherapy Drug Development
Cell-based Assays for Immunotherapy Drug DevelopmentCell-based Assays for Immunotherapy Drug Development
Cell-based Assays for Immunotherapy Drug DevelopmentDiscoverX Corporation
 
MDC Connects: Biomarker identification - Assessing Immune Function
MDC Connects: Biomarker identification - Assessing Immune FunctionMDC Connects: Biomarker identification - Assessing Immune Function
MDC Connects: Biomarker identification - Assessing Immune FunctionMedicines Discovery Catapult
 
State of Lupus Treatment: New Therapeutics
State of Lupus Treatment: New TherapeuticsState of Lupus Treatment: New Therapeutics
State of Lupus Treatment: New TherapeuticsLupusNY
 
Recent advances in GBS
Recent advances in GBSRecent advances in GBS
Recent advances in GBSNeurologyKota
 
Role of neutralizing antibodies in covid 19
Role of neutralizing antibodies in covid 19Role of neutralizing antibodies in covid 19
Role of neutralizing antibodies in covid 19PathKind Labs
 
Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2
Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2
Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2QIAGEN
 
mRCC presentation.pptx
mRCC presentation.pptxmRCC presentation.pptx
mRCC presentation.pptxFaraz Badar
 
Lab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBH
Lab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBHLab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBH
Lab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBH7867878678
 
Diagnosis & management of tb in RNTCP
Diagnosis & management of tb in RNTCPDiagnosis & management of tb in RNTCP
Diagnosis & management of tb in RNTCPnavinthakkar
 
Lab diagnosis of Dengue
Lab diagnosis of DengueLab diagnosis of Dengue
Lab diagnosis of DengueAnam Khurshid
 
Molecular techniques for pathology research - MDX .pdf
Molecular techniques for pathology research - MDX .pdfMolecular techniques for pathology research - MDX .pdf
Molecular techniques for pathology research - MDX .pdfsabyabby
 
Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016OSUCCC - James
 
Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...
Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...
Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...cmid
 
Emerging therapies in Lennox-Gastaut Syndrome
Emerging therapies in Lennox-Gastaut SyndromeEmerging therapies in Lennox-Gastaut Syndrome
Emerging therapies in Lennox-Gastaut SyndromeLGS Foundation
 
2017 molecular profiling_wim_vancriekinge
2017 molecular profiling_wim_vancriekinge2017 molecular profiling_wim_vancriekinge
2017 molecular profiling_wim_vancriekingeProf. Wim Van Criekinge
 

Similar to English: Dr. Raymond J. Dattwyler (20)

Connective Tissue Diseases
Connective Tissue DiseasesConnective Tissue Diseases
Connective Tissue Diseases
 
Presentation of David Rimm in 1st International Antibody Validation Forum 2014
Presentation of David Rimm in 1st International Antibody Validation Forum 2014Presentation of David Rimm in 1st International Antibody Validation Forum 2014
Presentation of David Rimm in 1st International Antibody Validation Forum 2014
 
biofire presentation.pptx
biofire presentation.pptxbiofire presentation.pptx
biofire presentation.pptx
 
Cell-based Assays for Immunotherapy Drug Development
Cell-based Assays for Immunotherapy Drug DevelopmentCell-based Assays for Immunotherapy Drug Development
Cell-based Assays for Immunotherapy Drug Development
 
MDC Connects: Biomarker identification - Assessing Immune Function
MDC Connects: Biomarker identification - Assessing Immune FunctionMDC Connects: Biomarker identification - Assessing Immune Function
MDC Connects: Biomarker identification - Assessing Immune Function
 
HIV with Meningitis
HIV with MeningitisHIV with Meningitis
HIV with Meningitis
 
State of Lupus Treatment: New Therapeutics
State of Lupus Treatment: New TherapeuticsState of Lupus Treatment: New Therapeutics
State of Lupus Treatment: New Therapeutics
 
Recent advances in GBS
Recent advances in GBSRecent advances in GBS
Recent advances in GBS
 
Role of neutralizing antibodies in covid 19
Role of neutralizing antibodies in covid 19Role of neutralizing antibodies in covid 19
Role of neutralizing antibodies in covid 19
 
Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2
Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2
Translational Genomics and Prostate Cancer: Meet the NGS Experts Series Part 2
 
mRCC presentation.pptx
mRCC presentation.pptxmRCC presentation.pptx
mRCC presentation.pptx
 
Lab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBH
Lab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBHLab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBH
Lab diagnosis of ctd By Dr Arif Iqbal MD Dermatology UCMS & GTBH
 
Diagnosis & management of tb in RNTCP
Diagnosis & management of tb in RNTCPDiagnosis & management of tb in RNTCP
Diagnosis & management of tb in RNTCP
 
Lab diagnosis of Dengue
Lab diagnosis of DengueLab diagnosis of Dengue
Lab diagnosis of Dengue
 
Molecular techniques for pathology research - MDX .pdf
Molecular techniques for pathology research - MDX .pdfMolecular techniques for pathology research - MDX .pdf
Molecular techniques for pathology research - MDX .pdf
 
Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016Melanoma ASCO Review Update 2016
Melanoma ASCO Review Update 2016
 
Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...
Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...
Sebastiani Gian Domenico Torino 13° Convegno Patologia Immune E Malattie Orfa...
 
Emerging therapies in Lennox-Gastaut Syndrome
Emerging therapies in Lennox-Gastaut SyndromeEmerging therapies in Lennox-Gastaut Syndrome
Emerging therapies in Lennox-Gastaut Syndrome
 
2017 molecular profiling_wim_vancriekinge
2017 molecular profiling_wim_vancriekinge2017 molecular profiling_wim_vancriekinge
2017 molecular profiling_wim_vancriekinge
 
Basics of SLE
Basics of SLEBasics of SLE
Basics of SLE
 

More from Conference to Develop a Federal Framework on Lyme Disease

More from Conference to Develop a Federal Framework on Lyme Disease (20)

Français: Dr. Ying Zhang
Français: Dr. Ying ZhangFrançais: Dr. Ying Zhang
Français: Dr. Ying Zhang
 
Français: Dr. Curtis Russell
Français: Dr. Curtis RussellFrançais: Dr. Curtis Russell
Français: Dr. Curtis Russell
 
English: Dr. Curtis Russell
English: Dr. Curtis RussellEnglish: Dr. Curtis Russell
English: Dr. Curtis Russell
 
Français: Dr. Nataliia (Natasha) Rudenko
Français: Dr. Nataliia (Natasha) RudenkoFrançais: Dr. Nataliia (Natasha) Rudenko
Français: Dr. Nataliia (Natasha) Rudenko
 
English: Dr. Nataliia (Natasha) Rudenko
English: Dr. Nataliia (Natasha) RudenkoEnglish: Dr. Nataliia (Natasha) Rudenko
English: Dr. Nataliia (Natasha) Rudenko
 
Français: Dr. David M. Patrick
Français: Dr. David M. PatrickFrançais: Dr. David M. Patrick
Français: Dr. David M. Patrick
 
English: Dr. David M. Patrick
English: Dr. David M. PatrickEnglish: Dr. David M. Patrick
English: Dr. David M. Patrick
 
Français: Dr. Nick H. Ogden
Français: Dr. Nick H. OgdenFrançais: Dr. Nick H. Ogden
Français: Dr. Nick H. Ogden
 
English: Dr. Nick H. Ogden
English: Dr. Nick H. OgdenEnglish: Dr. Nick H. Ogden
English: Dr. Nick H. Ogden
 
Français: Dr. Christina Nelson
Français: Dr. Christina NelsonFrançais: Dr. Christina Nelson
Français: Dr. Christina Nelson
 
English: Dr. Christina Nelson
English: Dr. Christina NelsonEnglish: Dr. Christina Nelson
English: Dr. Christina Nelson
 
Français: Dr. Kieran Moore
Français: Dr. Kieran MooreFrançais: Dr. Kieran Moore
Français: Dr. Kieran Moore
 
English: Dr. Kieran Moore
English: Dr. Kieran MooreEnglish: Dr. Kieran Moore
English: Dr. Kieran Moore
 
Français: Dr. Elizabeth Maloney
Français: Dr. Elizabeth MaloneyFrançais: Dr. Elizabeth Maloney
Français: Dr. Elizabeth Maloney
 
English. Dr. Elizabeth Maloney
English. Dr. Elizabeth MaloneyEnglish. Dr. Elizabeth Maloney
English. Dr. Elizabeth Maloney
 
Français: Dr. Vett Lloyd
Français: Dr. Vett LloydFrançais: Dr. Vett Lloyd
Français: Dr. Vett Lloyd
 
English: Dr. Vett Lloyd
English: Dr. Vett LloydEnglish: Dr. Vett Lloyd
English: Dr. Vett Lloyd
 
Français: Dr. Ralph Hawkins
Français: Dr. Ralph HawkinsFrançais: Dr. Ralph Hawkins
Français: Dr. Ralph Hawkins
 
English: Dr. Ralph Hawkins
English: Dr. Ralph HawkinsEnglish: Dr. Ralph Hawkins
English: Dr. Ralph Hawkins
 
Français: Dr. Todd F. Hatchette
Français: Dr. Todd F. HatchetteFrançais: Dr. Todd F. Hatchette
Français: Dr. Todd F. Hatchette
 

Recently uploaded

Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowSonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowRiya Pathan
 
Housewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment Booking
Housewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment BookingHousewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment Booking
Housewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment Bookingnarwatsonia7
 
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...Nehru place Escorts
 
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near MeHi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Menarwatsonia7
 
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service BangaloreCall Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalorenarwatsonia7
 
Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...
Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...
Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...narwatsonia7
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...CALL GIRLS
 
Call Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on Delivery
Call Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on DeliveryCall Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on Delivery
Call Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on Deliverynehamumbai
 
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort ServiceCall Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Serviceparulsinha
 
Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...
Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...
Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...Nehru place Escorts
 
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...narwatsonia7
 
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls JaipurCall Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipurparulsinha
 
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original PhotosCall Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photosnarwatsonia7
 
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.MiadAlsulami
 
Call Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service ChennaiCall Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service ChennaiNehru place Escorts
 
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls ServiceMiss joya
 
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls ServiceMiss joya
 
Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...
Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...
Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...Miss joya
 

Recently uploaded (20)

Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowSonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
 
Housewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment Booking
Housewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment BookingHousewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment Booking
Housewife Call Girls Hoskote | 7001305949 At Low Cost Cash Payment Booking
 
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
Russian Call Girls in Chennai Pallavi 9907093804 Independent Call Girls Servi...
 
Escort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCR
Escort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCREscort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCR
Escort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCR
 
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near MeHi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
 
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service BangaloreCall Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
Call Girl Bangalore Nandini 7001305949 Independent Escort Service Bangalore
 
Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...
Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...
Russian Call Girls in Bangalore Manisha 7001305949 Independent Escort Service...
 
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
Call Girls Service Surat Samaira ❤️🍑 8250192130 👄 Independent Escort Service ...
 
Call Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on Delivery
Call Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on DeliveryCall Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on Delivery
Call Girls Colaba Mumbai ❤️ 9920874524 👈 Cash on Delivery
 
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort ServiceCall Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
Call Girls Service In Shyam Nagar Whatsapp 8445551418 Independent Escort Service
 
Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...
Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...
Russian Call Girls Chennai Madhuri 9907093804 Independent Call Girls Service ...
 
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
Call Girls Service in Bommanahalli - 7001305949 with real photos and phone nu...
 
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls JaipurCall Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
 
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original PhotosCall Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
 
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Whitefield Just Call 7001305949 Top Class Call Girl Service Available
 
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
Artifacts in Nuclear Medicine with Identifying and resolving artifacts.
 
Call Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service ChennaiCall Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
Call Girls Chennai Megha 9907093804 Independent Call Girls Service Chennai
 
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Hadapsar ( Pune) Girls Service
 
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls ServiceCALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune)  Girls Service
CALL ON ➥9907093804 🔝 Call Girls Baramati ( Pune) Girls Service
 
Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...
Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...
Russian Call Girls in Pune Riya 9907093804 Short 1500 Night 6000 Best call gi...
 

English: Dr. Raymond J. Dattwyler

  • 1. FACULTY/PRESENTER DISCLOSURE • Faculty: • Relationships with commercial interests: • The epitope mapping presented was done at Biopeptides Corp. and the IP is owned by Biopeptides Corp.
  • 2. DISCLOSURE OF COMMERCIAL SUPPORT • Potential for conflict(s) of interest: • Raymond Dattwyler and Biopeptides Corp have received NIH grants • BioRad has licensed technology developed by Biopeptides Corp • Qiagen has licensed technology developed by Biopeptides Corp
  • 3. LABORATORY DIAGNOSTICS OF LYME DISEASE, PAST, PRESENT, FUTURE: RAYMOND J. DATTWYLER, MD PROFESSOR OF MICROBIOLOGY/IMMUNOLOGY AND MEDICINE NEW YORK MEDICAL COLLEGE, VALHALLA, NY USA PRESIDENT BIOPEPTIDES CORP
  • 4. LYME DISEASE LABORATORY DIAGNOSIS 1980 1990 2000 2010
  • 5. SEROLOGIC Assays Antigen targets: whole cell Bb or Bb sonicates • Problems: • Whole bacteria contain many epitopes that are common among other bacterial species – “non-specific epitopes”- • Cultured Borrelia can lose plasmids coding key antigens - • Some important antigens are not express in in vitro
  • 6. CDCCRITERIA TWO-TIERSEROLOGY First Month of Infection: First tier: IgG and/or IgM antibody to whole-cell sonicate by either EIA or IFA Second-tier: IgG and IgM Western blotting if first tier positive or equivocal 2 of 3 IgM bands: 23-, 39-, and 41-kDa 5 of 10 IgG bands: 18-, 23-, 28-, 30-, 39-, 41-, 45-, 58-, 66-, and 93-kDa After the first month : First tier: IgG antibody to whole-cell sonicate by either EIA or IFA Second-tier: IgG Western blotting if first tier positive or equivocal 5 of 10 IgG bands: 18-, 23-, 28-, 30-, 39-, 41-, 45-, 58-, 66-, and 93-kDa
  • 7. WESTERN BLOT CRITERIA 1. The Criteria were developed using cultured Bb 2. At the time, these criteria were formulated, many of these antigens were not defined. 3. In Vivo expressed antigen are poorly represented 7
  • 8. SENSITIVITY OF STANDARD2-TIER • Early acute disease: 30% to 40% • Early convalescent disease: 70% • Early neurological and carditis (Acute Disseminated): 85% • Late disease: 98+%
  • 9. 2D GEL WESTERN HUMAN LATE DISSEMINATED INFECTION Nowalk, A. J., R. D. Gilmore, Jr., and J. A. Carroll. 2006. Serologic proteome analysis of Borrelia burgdorferi membrane-associated proteins. Infect. Immun. 74:3864–3873.
  • 10. ANTIGENS ASSOCIATED WITH WB 10 PROTEIN Kd Early Intermediate Late p93 93 + + Hsp90 90 + P66* 66 + OppA2 58 + ErpB 58 + BBK32 47 + FtsZ 45 + FlaB* 41 + BmpA 39 + BBO323* 30 + OspF 26 + + OspC 21 + LA7 20 + + ErpP 18 + + DbpA 18 + + RevA 18 +
  • 11. ANTIGEN CROSSREACTIVITY • Crossreactivity is a significant issue in any serodiagnostic assay, particularly when using preparations derived from whole organisms or highly conserved proteins. • Borrelia flagellin generates positive responses in >40% of healthy individuals with no history of Lyme disease (Liang, FT, et al, J. Clin. Microbiol. December 1999 vol. 37 no. 12 3990-3996.) • A 60kDa antigen has seropositivity in >16% of healthy controls (Liang, FT, et al, J. Clin. Microbiol. December 1999 vol. 37 no. 12 3990-3996.) • BBO323 Homolgus with periplasmic substrate binding proteins of Gram Negatives. • Whole cell sonicate ELISAs can detect antibody at rates greater than 90% in tropical countries that don’t have Lyme disease (Burkitt TR, et al, J Infect Dis. (1997) 175 (2): 466-469.)
  • 12. PROTEINS CONTAIN CROSS REACTIVE REGIONS SIMILAR TO OTHER BACTERIA B.BURGDORFERI P41 FLAGELLIN IS A GOOD EXAMPLE
  • 13. • P66 is a prominent antigen included in most conventional Lyme seroassays • We found a significant amount of antibody binding to 6 different peptides in serum from healthy and disease controls • In concordance, we find that the p66 band on most western blots is positive regardless of serum source P66 a lesson in crossreactivity.
  • 14. OTHER ANTIGENS ALSO HAVE CROSS REACTIVE EPITOPES • Peptides were generated from OspC epitope sequences and screened Lyme and healthy control sera
  • 15. BENEFITS OF PEPTIDE EPITOPES • Preservation of specificity by selection epitopes unique to Borrelia spp., and eliminating ‘cross-reactive’ epitopes present in other bacterial species • Conceptually, this improves both the specificity and sensitivity of seroassays
  • 16. C6 • The first FDA approved peptide based serodiagnostic assay • A conserved peptide from the invariable region 6 of the VlsE protein • Has performed well as a single antigen assay; however, has not performed well enough to supplant the two-tier paradigm • C6 does not bind well to IgM, it predominantly binds IgG • The IR6 region of VlsE is more variable than was initially though, and peptide based diagnostics are exquisitely sensitive to variances in AA sequence • The VlsE antigen is not expressed in the tick (<1% of bacteria), therefore it needs to be upregulated prior to generating immunity, limiting utility in very early responses • Despite the drawbacks observed, it clearly demonstrates the utility of peptide based serodiagnostics
  • 17. EPITOPE MAPPING of the OppA2 protein Signorino G, Arnaboldi PM, Petzke MM, Dattwyler RJ. Identification of OppA2 linear epitopes as serodiagnostic markers for Lyme disease. Clin Vaccine Immunol.2014 May;21(5):704-11. • For OppA2, many sequences were identified, for other proteins only one or two epitopes were identified per protein Table 1. Peptide sequences containing immunodominant epitopes of OppA2. Peptide name Amino acid sequence OppA (11-25) IFFLTFLCCNNKERK OppA (191-225) YGQNWTNPENMVTSGPFKLKERIPNEKIVFEKNNK OppA (276-290) SDYYSSAVNAIYFYS OppA (276-300) SDYYSSAVNAIYFYSFNTHIKPLD OppA (286-300) IYFYSFNTHIKPLD OppA (286-310) IYFYSFNTHIKPLDNVKIRKALTLA OppA (356-375) LAEAGYPNGNGFPILKLKYN OppA (381-400) KKICEFIQNQWKKNLNIDVE OppA (491-505) APIYIYGNSYLFRND
  • 18. • Each peptide was run with a panel of 114 early Lyme, 44 healthy controls, 30 RA, 28 RPR+ • Cutoffs for positivity were determined as >3SD from mean of healthy control (positive) and >2SD from mean of healthy control (equivocal) OppA2 ELISA
  • 19. LESSONS FROM SEROASSAYS DEVELOPMENT • Identification of new Peptide targets continue to improve specificity and sensitivity compared to current first tier EIAs • However, antigen selection must be carefully performed • No ‘blanket approach’ for epitope identification is effective • Individual epitopes from different antigens have different attributes. • OspC1 binds IgM better than IgG, DbpA4-DbpB6 only works well as a dipeptide, many p66 epitopes are crossreactive, p41 has a useful epitope
  • 20. • It takes time for antibody formation • IgG levels remain elevated for years after infection, seroassays cannot distinguish new infection from previous exposures • Antibody levels do not correlate treatment success Seroassays have issues that cannot be overcome
  • 21. NEW APPROACHES TO LABORATORY DIAGNOSIS THE FUTURE? • Metabolomics • Transcriptome analysis • Monitoring T cell activity
  • 22. T CELL RESPONSE • Distinct kinetics of T cell responses • Following resolution of infection: • T cell effector function wanes • Activated T cell numbers contract • Cytokine release can be used as a indirect measure of T cell activation
  • 23. CYTOKINE RELEASE ASSAY • The QuantiFERON technology platform • Whole blood • Incubate O/N, Harvest plasma • IFN-γ ELISA Nil Lyme Mito
  • 24. TARGET ANTIGENS • Sequences for each antigen were evaluated against protein databases using the NCBI Basic Local Alignment Search Tool (BLAST). • Overlapping peptide libraries were generated for regions with: • <50% identity with other proteins and • >80% identity among Borrellia spp. • These data were generated using a mixture of 33 peptides from OspC, DbpB, p66, and FlaB Antigens evaluated for T cell reactivity: • OspC • DbpB • p66 • FlaB • CRASP2 • Bbk32 • BmpA • OppA2 • LA-7 • FlilB • Bdf2 • RecA
  • 25. PATIENT CHARACTERISTICS Subjects Median Age (range) Gender (F/M) Median Duration of Symptoms (range) Single vs. Multiple EM Symptomsb Erythema migrans+a (n=29) 58 (19-74) 9/20 5d (2-30) 23/6 headache (n=23) stiff neck (n=15) myalgia (n=15) fever (n=13) fatigue (n=13) arthalgia (n=10) lymphadenopathy (n=1) none (n=2) a- >5 cm round lesion, often with partial central clearing b- symptoms resolved following 10d treatment with Doxycycline • Blood was collected at initial visit (n=29), 2 months post treatment (n=27), and 6 months post treatment (n=5)
  • 26. INTERFERON-GAMMA SECRETION • IFNγ was detected in 3.1% (6 of 192) healthy and Anaplasmosis controls Acute Convalescent (2 mo.) Convalaescent (6 mo.) Positivea 20/29 (69.0%) IFNγ (IU/ml) 1.46 ± 2.26 4/27 (15.3%) 1/5 (20.0%) 0.27 ± 0.59 0.13 ± 0.19 a- >3 SD (0.33 IU/ml) from the mean of IFNγ produced in blood of healthy volunteers (n=187) and Anaplasmosis (n=5).
  • 27. COMPARISON WITH SEROLOGY QuantiFERON ELISA C6 ELISA Western Blot IFNγ (IU) IgM or IgG IgM or IgG Acute (n=29) 69.0% (20/29) 58.6% (17/29) 17.2% (5/29) • When combined the C6 and QuantiFERON ELISAs positively identified 82.8% (24/29) of acute Lyme disease patients • Adding peptides from additional antigens can increase the sensitivity of the assay.
  • 28. SUMMARY • IFNγ secretion can be used to detect infection with Borrelia burgdorferi • Requires multiple peptides from different proteins • IFNγ secretion is reduced following successful antibiotic therapy • No patients complained of ongoing symptoms following doxycycline treatment • Additional studies are warranted to: • more critically define cut-off values, • evaluate the inclusion of other antigens • evaluate localized vs. disseminated Lyme disease • evaluate late Lyme disease
  • 29. ACKNOWLEDGEMENTS • NIH NIAID for their funding • Biopeptides, Corp./NYMC • Paul M. Arnaboldi, PhD • Mariya Sambir, MS • NYMC • Mary Petzke, PhD • Giacomo Signore, PhD • Gary Wormser, MD • Gundersen-Lutheran, Wisc. • Steven Callister, PhD • Dean Jobe, MS 29