1. 72 november 2014 | gardenandhome.co.za
TEXTKARIENSLABBERTPRODUCTION,STYLINGANDPHOTOGRAPHSHENRIQUEWILDING
PRODUCTSARESUBJECTTOAVAILABILITYANDPRICESWERECHECKEDATTIMEOFGOINGTOPRINT.SEEPAGE2.
outdoor entertaining ideas
1. UNDERCOVER OPERATION
If you’re lacking a shady spot for entertaining then a Bedouin-style tent
is the ideal solution. “They’re a great way to extend your living area out
into the garden and you can furnish them anyway you want to,” says Alex
Cresswell-Turner of Trade Secret who imports them. “In the evening we
light a chandelier to create a magical Arabian Nights experience.” The
tents are waterproof and UV protected and come in a choice of colours
and patterns.
Savouring
Whether you’re planning on lounging
about or entertaining friends, make the
most of the balmy weather with these
savvy ideas for outdoor areas
season
the
Outdoor tent, from R18 500, cotton dhurrie rug,
R1 085/m², pink trellis scatter cushions, R395 each,
pink motif scatter cushions, R295 each, elm side
table, R2 495, reclaimed teak daybed, R6 995,
all Trade Secret. Tray table, R2 000, Moroccan
pouffes, R1 500 each, tea glasses, R45 each, teapot,
R550, all from Moroccan Warehouse.

2. gardenandhome.co.za | november 2014 73
g
Hay Hee lounge chair in Amy Green, R4 360,
and Bloom pots, from R2 351 each, both
from Crema Design.
2. Open sesame
As Karin Duwenshee and Esy von
Falkenhaym are keen entertainers, and
neither of them want to miss out on the
action when they have friends around,
they wanted some way to link the kitchen
and the deck of their Somerset West
home. Designers Evi and Jochem Elsner
from Home Concept came up with a
clever solution by transforming a kitchen
window overlooking the decked braai
area into a bar.
Stacking glass panels allow the
window to be opened completely while
a Caesarstone windowsill and stylish bar
stools provide the ideal place for guests
to sit and enjoy a drink while chatting
to the cook.
Rush matting basket, R1 295, glass hurricane
lamp, R1 995, glass carafe, R145, glass
tumblers, R115 each, ceramic pineapple,
R1 150, dinner plate, R175, Aquarelle blue
cutlery, R195 each, blue tea towel, R165, and
Simone barstools, R1 750 each, all from
Pezula Interiors.
3. Beam me up
Like most busy urbanites, the owner of
this Cape Town pied-à-terre yearned for
a quiet respite from the hustle and bustle
of the city.
“Our brief was to create a seamless
transition between inside and out,” says
Dawid Augustyn, managing director of
Establishment, who designed the house
and deck area. To make the most of the
views, the team raised the timber deck
to the same level as the long narrow
swimming pool and living areas. For
after-dark appeal Bloom Lights, available
from Crema Design, were used for
multi-purpose accent lighting, whether
it’s for a cocktail party with friends or
late-night reading on a deckchair. 

3. 74 november 2014 | gardenandhome.co.za
5. Pretty functional
When sculptor and architect Jean Louw from 2AD Space
Architects and her husband Wilhelm, also an architect,
decided to create a sunken entertaining nook at their
Somerset West home, they envisioned an uncluttered space.
Built-in seating painted grey presented a maintenance-free,
long-lasting option. Seat and scatter cushions add the
necessary comfort.
SOURCES 2AD Space Architects 2adspace.co.za Caesarstone caesarstone.co.za Crema Design crema.co.za Dear Zania
Interiors dearzania.co.za Establishment establishment.co.za Halogen International halogen.co.za Home Concept home-concept.cc
Mavromac mavromac.co.za MBA madebyarchitects.co.za Moroccan Warehouse 021 461 8318 Pezula Interiors pezulainteriors.co.za
St Leger & Viney stleger.co.za Supreme Upholstery supremeupholstery.co.za Trade Secret trade-secret.co.za Weylandts weylandts.co.za
Cube Fatsaks, R1 390 (excl. fabric), made by Supreme
Upholstery; covered in Home Stripe Outdoor in Black &
White (910), R645/m, from Halogen International.
Seven-shape Fatsak, R2 190 (excl. fabric), made by Supreme
Upholstery; covered in Bounce, colour Turquoise, R1 148/m,
from Mavromac.
Linen scatters, R895 each, grey and lime linen throws, R995 each,
round basket, R495, white plate, R129, and green bowls, R99 each,
all Weylandts. Geometric scatter fabric, Keel in Blue, R425/m,
stripe scatter fabric, Sail in Blue/White, R374/m, both
from St Leger & Viney. Well Slotted bench, R4 900, MBA.
4. Water’s edge
If you’re not keen on a large swimming pool, why not opt
for a double-duty water feature/plunge pool instead? In
this Cape Winelands home this pool-cum-water feature,
designed by Zania Grobelaar from Dear Zania Interiors,
echoes the finishes used in the house with a wall of
dry-pack slate and an L-beam steel structure. A balau
deck envelops the pool allowing ample space to sit and
dangle your feet in the water.