SlideShare a Scribd company logo
1 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
Faculty of Information Science & Technology
LAB REPORT
HBC 1019 - Biochemistry I
Practical 9
Protein Structure and Function
Name : Osama Barayan
ID : 1091105869
Page 1 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
Practical 9: Protein Structure and Function
Introduction
In this practical you will learn about protein structure prediction tool. You will used PDB
website to get the information about the protein structure, and used Rasmol to expore the 3D
structure of the protein.
1. Protein 3D structure visualization
There are number of useful free visualization tools available on the Internet. For this
exercise you will use a tool called Rasmol.
Install Rasmol on your computer according to the instructions on the Rasmol site:
(http://www.bernstein-plus-sons.com/software/rasmol/INSTALL.html).
a. Find other molecular visualization tools that are available from the internet.
Give two examples of the visualization tools.
VMD and MOLMOL
Obtaining Structural Information
Many programs have been written to predict secondary structures based only on the primary
structure (amino acid sequence) of a protein. Here is a list of such programs that are available
online:
 PredictProtein (http://www.predictprotein.org). You can request this site to predict
secondary structure online
 JPred (http://www.compbio.dundee.ac.uk/~www-jpred/). If you use the JPred server,
be certain to check the box under #4 to avoid comparison to known PDB structure
files.
b. For this exercise, you will use the sequence of rabbit muscle triose phosphate
isomerase that is given here and submit to two servers that provided above. Compare
the results you receive from different servers.
Can you identify segment where the predictions are not consistent between
servers?
The result are consistent between the servers.
>1R2R: A TRIOSEPHOSPHATE ISOMERASE from rabbit muscle
APSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTA
YIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLG
HSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGITEKVV
FEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRG
WLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLK
PEFVDIINAKQ
Page 2 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
c. The structure of rabbit muscle triose phosphate isomerase has been determined by X-
ray crystallography.
Go to the Protein Data Bank web server (http://www.rcsb.org/pdb) and search for
1R2R (the PDB ID for this protein). Once you reach the Structure Explorer page for
1R2R, click on the link for Sequence Details. Scroll down the page to the section
entitled “Sequence and Secondary Structure.” The results shown here for the
secondary structure are based on an analysis of the actual (not predicted) three-
dimensional structure, using the principles developed by Kabsh and Sander [see
http://www.rcsb.org/pdb/help-results.html#sequence_details and Biopolymers 22,
2577–2637 (1983)].
The secondary structure assignments are H = helix; B = residue in isolated beta
bridge; E = extended beta strand; G = 310 helix; I = pi helix; T = hydrogen bonded
turn; S = bend.
Compare your predicted secondary structure results from Part (b) with the
results presented on the PDB site.
Result in part b said helix is 41.9% but in PDB site said 44%.
2. Using Rasmol
Rasmol enable you to explore protein’s 3-D structure.
a. Go back to PDB site for 1R2R and search for the icon download PDB file. Save the
PDB file. Open the Rasmol program, and use the drop-down menu File. .Open to
open 1R2R.pdb. You will initially see a wireframe model that simply displays all the
bonds in the structure as lines. Perform the following steps to get a more informative
view:
Select Display. .Cartoons from the drop-down menu.
Select Colours. .Structure
Now you should be able to see the alpha helix and beta sheet structures in rabbit
muscle triose phosphate isomerase. How many chains are shown in the structure?
What is the dominant structural feature of this protein? Take time to experiment
with the other drop-down menu options on Rasmol.
Chain =4. Dominant structural =alpha helix.
b. All the bonds in the PDB structure file are shown as thin wires, colored according to
Corey-Pauling-Kultun (CPK) coloring rules (oxygen is red, nitrogen is blue, hydrogen
is white, and carbon is gray).
There is seven drop-down menus in Rasmol: File, Edit, Display, Colors, Options,
Export, and Help. Spend a few minutes trying each command in each of the menus.
Perform the following operations:
i. Display. .Backbone. This shows the protein backbone; the bonds actually
Page 3 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
connect alpha carbons.
iii. Display. .Cartoon. This shows an image of the protein that clearly displays
helices and sheets. Leave your image in cartoon format and move to the Colours
menu.
Page 4 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
iv. Colours. .Structure. This shows alpha helices in magenta, beta sheets in yellow,
and turns in pale blue.
v. Options. .Labels. This command labels all selected atoms.
vi. Export. .GIF. This function enables you to export a still image of the structural
view you just created.
vii. HELP. .User Manual. This is really a critical tool for using Rasmol. In order for
this to work, the help file (Rasmol.hlp in Windows) must be stored in the same
directory as the Rasmol program.
c. Each line in a PDB file is called a “record,” and the first six characters on that line tell
what kind of “record” it is. In your browser, search for SEQRES. As explained in the
PDB Format Description, SEQRES records contain the amino acid or nucleic acid
sequence of residues in each chain of the macromolecule. Hence you can see the
sequence of your protein there. For example, the first few lines of the SEQRES
section are given in Table I (below). Each line contains 13 amino acid residues listed
by their three-letter abbreviations. So residue #27 in chain A is PHE (phenylalanine).
The 12th
character (counting spaces) in each record is a chain identifier. If a protein
contains more than one polypeptide chain, the chains are identified with a letter.
Table I
SEQRES 1
A
248 MET ALA ARG LYS TYR PHE VAL ALA ALA ASN TRP LYS CYS
SEQRES 2
A
248 ASN GLY THR LEU GLU SER ILE LYS SER LEU THR ASN SER
SEQRES 3 248 PHE ASN ASN LEU ASP PHE ASP PRO SER LYS LEU ASP VAL
Page 5 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
A
SEQRES 4
A
248 VAL VAL PHE PRO VAL SER VAL HIS TYR ASP HIS THR ARG
SEQRES 5
A
248 LYS LEU LEU GLN SER LYS PHE SER THR GLY ILE GLN ASN
Anything in a PDB file that is not either protein or nucleic acid is considered a
heterogen atom and is referred to with the prefix “het.” So HETNAM is the label for a
record that contains the name of a nonprotein, non-nucleic acid group. Search the
HTML version of the 1R2R file for “HETNAM.”
What are the heterogen groups in this structure?
DIMETHYL SULFOXIDE, MAGNESIUM ION, and 2-AMINO-2-
HYDROXYMETHYL-PROPANE-1,3-DIOL
d. In addition to drop-down menus, Rasmol also has a “command line” window that
enables you to select specific atoms or parts of a structure (amino acid residues, for
example) and change the way they appear. Bring up the command line window and
note the effects of entering the following commands:
i. select hetero and not water (selects nonprotein parts of the structure excluding
water)
ii. spacefill (a van der Waals radius representation)
iii. color cpk (standard chemistry color scheme)
What heteroatoms do you see in this structure?
DMS 235, MG 256, and TRS258
Are any substrates or inhibitors represented in this structure?
No substrate or inhibitor represented in this structure.
Now try more commands:
iv. select protein
v. cartoon off
vi. select sheet
vii. wireframe 30
viii. spacefill 100 (these combined commands yield a ball-and-stick structure)
Can you see the sheet structure now? If not, type the command “cartoon.”
What do you see?
Page 6 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
3. Now you have been familiarizing with Rasmol, you need to do the same procedure using
PDB ID: 1o5x to explore its structure, focusing on identifying secondary structures and
looking at the active sites.
a. Download the PDB structure file from PDB site.
What is the title of this record?
1O5X
b. Repeat the steps in 2d. Identify heterogens group for this protein. List down all of the
heterogens or ligands.
2-PHOSPHOGLYCERIC ACID, 3-HYDROXYPYRUVIC ACID and PHOSPHITE
ION
c. Display the active site residues, there are three residues that interact with the 2-
phosphoglycerate: glutamate 165, lysine 12, and histidine 95. Select these residues by
entering the command “select lys12, his95, glu165” in the Rasmol command line
window. Then use the drop-down menu in the structure window to show the residues
in a ball-and-stick format (Display. .Ball & Stick). Finally, enter the command “color
CPK” so that you can distinguish the atoms of the structure.
Page 7 of 8
HBC 1019 Biochemistry 1 Trimester 1, 2012/2013
4. What does CATH and SCOP stands for? What are their functions?
CATH stand for Class, Architecture, Topology, Homologous superfamily. SCOP stand
for Structural Classification Of Protein. Both is used to classified protein.
CONCLUSION
The protein structure can be study by using the PDB and Rasmol. By studying the structure
person can get understand how that protein functions.
Page 8 of 8

More Related Content

Similar to Practical 9 protein structure and function (3)

2009 CSBB LAB 新生訓練
2009 CSBB LAB 新生訓練 2009 CSBB LAB 新生訓練
2009 CSBB LAB 新生訓練 Abner Huang
 
Essential Biology Respiration (Core & AHL/Option C)
Essential Biology Respiration (Core & AHL/Option C)Essential Biology Respiration (Core & AHL/Option C)
Essential Biology Respiration (Core & AHL/Option C)Stephen Taylor
 
1PhylogeneticAnalysisHomeworkassignmentThisa.docx
1PhylogeneticAnalysisHomeworkassignmentThisa.docx1PhylogeneticAnalysisHomeworkassignmentThisa.docx
1PhylogeneticAnalysisHomeworkassignmentThisa.docxfelicidaddinwoodie
 
Essential Biology 03.2 Carbohydrates, Lipids and Proteins
Essential Biology 03.2 Carbohydrates, Lipids and ProteinsEssential Biology 03.2 Carbohydrates, Lipids and Proteins
Essential Biology 03.2 Carbohydrates, Lipids and ProteinsStephen Taylor
 
Molecular Structures 2009
Molecular Structures 2009Molecular Structures 2009
Molecular Structures 2009lyonja
 
Essential Biology: Making ATP Workbook (HL/ SL OpC)
Essential Biology: Making ATP Workbook (HL/ SL OpC)Essential Biology: Making ATP Workbook (HL/ SL OpC)
Essential Biology: Making ATP Workbook (HL/ SL OpC)Stephen Taylor
 
CINF 13: Pistachio - Search and Faceting of Large Reaction Databases
CINF 13: Pistachio - Search and Faceting of Large Reaction DatabasesCINF 13: Pistachio - Search and Faceting of Large Reaction Databases
CINF 13: Pistachio - Search and Faceting of Large Reaction DatabasesNextMove Software
 
Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5Osama Barayan
 
PROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINE
PROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINEPROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINE
PROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINEijsc
 
Protein Structure Prediction Using Support Vector Machine
Protein Structure Prediction Using Support Vector Machine  Protein Structure Prediction Using Support Vector Machine
Protein Structure Prediction Using Support Vector Machine ijsc
 
Bioinfomatics Presentation
Bioinfomatics PresentationBioinfomatics Presentation
Bioinfomatics PresentationZhenhong Bao
 
Drug TanzeumDiseasesDiabetesGene and Gene Productglucago.docx
Drug TanzeumDiseasesDiabetesGene and Gene Productglucago.docxDrug TanzeumDiseasesDiabetesGene and Gene Productglucago.docx
Drug TanzeumDiseasesDiabetesGene and Gene Productglucago.docxjacksnathalie
 
20090511 Manchester Biochemistry
20090511 Manchester Biochemistry20090511 Manchester Biochemistry
20090511 Manchester BiochemistryMichel Dumontier
 

Similar to Practical 9 protein structure and function (3) (20)

Auto dock tutorial
Auto dock tutorialAuto dock tutorial
Auto dock tutorial
 
protein data bank
protein data bankprotein data bank
protein data bank
 
2009 CSBB LAB 新生訓練
2009 CSBB LAB 新生訓練 2009 CSBB LAB 新生訓練
2009 CSBB LAB 新生訓練
 
Essential Biology Respiration (Core & AHL/Option C)
Essential Biology Respiration (Core & AHL/Option C)Essential Biology Respiration (Core & AHL/Option C)
Essential Biology Respiration (Core & AHL/Option C)
 
1PhylogeneticAnalysisHomeworkassignmentThisa.docx
1PhylogeneticAnalysisHomeworkassignmentThisa.docx1PhylogeneticAnalysisHomeworkassignmentThisa.docx
1PhylogeneticAnalysisHomeworkassignmentThisa.docx
 
Bioinformatica 01-12-2011-t7-protein
Bioinformatica 01-12-2011-t7-proteinBioinformatica 01-12-2011-t7-protein
Bioinformatica 01-12-2011-t7-protein
 
Essential Biology 03.2 Carbohydrates, Lipids and Proteins
Essential Biology 03.2 Carbohydrates, Lipids and ProteinsEssential Biology 03.2 Carbohydrates, Lipids and Proteins
Essential Biology 03.2 Carbohydrates, Lipids and Proteins
 
Molecular Structures 2009
Molecular Structures 2009Molecular Structures 2009
Molecular Structures 2009
 
Essential Biology: Making ATP Workbook (HL/ SL OpC)
Essential Biology: Making ATP Workbook (HL/ SL OpC)Essential Biology: Making ATP Workbook (HL/ SL OpC)
Essential Biology: Making ATP Workbook (HL/ SL OpC)
 
Lab8biochem
Lab8biochemLab8biochem
Lab8biochem
 
CINF 13: Pistachio - Search and Faceting of Large Reaction Databases
CINF 13: Pistachio - Search and Faceting of Large Reaction DatabasesCINF 13: Pistachio - Search and Faceting of Large Reaction Databases
CINF 13: Pistachio - Search and Faceting of Large Reaction Databases
 
Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5Practical 7 dna, rna and the flow of genetic information5
Practical 7 dna, rna and the flow of genetic information5
 
protein.pptx
protein.pptxprotein.pptx
protein.pptx
 
Protein structure prediction primary structure analysis.pptx
Protein structure prediction primary structure analysis.pptxProtein structure prediction primary structure analysis.pptx
Protein structure prediction primary structure analysis.pptx
 
PROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINE
PROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINEPROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINE
PROTEIN STRUCTURE PREDICTION USING SUPPORT VECTOR MACHINE
 
Protein Structure Prediction Using Support Vector Machine
Protein Structure Prediction Using Support Vector Machine  Protein Structure Prediction Using Support Vector Machine
Protein Structure Prediction Using Support Vector Machine
 
Bioinfomatics Presentation
Bioinfomatics PresentationBioinfomatics Presentation
Bioinfomatics Presentation
 
Protein Data Bank
Protein Data BankProtein Data Bank
Protein Data Bank
 
Drug TanzeumDiseasesDiabetesGene and Gene Productglucago.docx
Drug TanzeumDiseasesDiabetesGene and Gene Productglucago.docxDrug TanzeumDiseasesDiabetesGene and Gene Productglucago.docx
Drug TanzeumDiseasesDiabetesGene and Gene Productglucago.docx
 
20090511 Manchester Biochemistry
20090511 Manchester Biochemistry20090511 Manchester Biochemistry
20090511 Manchester Biochemistry
 

More from Osama Barayan

More from Osama Barayan (9)

Estimating the-time-needed-for-mitosis
Estimating the-time-needed-for-mitosisEstimating the-time-needed-for-mitosis
Estimating the-time-needed-for-mitosis
 
Tutorial mitosis
Tutorial mitosisTutorial mitosis
Tutorial mitosis
 
Practical 6 elisa
Practical 6 elisaPractical 6 elisa
Practical 6 elisa
 
Practical 5 sds page
Practical 5 sds pagePractical 5 sds page
Practical 5 sds page
 
Practical 4 sec
Practical 4 secPractical 4 sec
Practical 4 sec
 
Practical 3 got
Practical 3 gotPractical 3 got
Practical 3 got
 
Practical 2 tlc
Practical 2 tlcPractical 2 tlc
Practical 2 tlc
 
Hbc1019 tut4
Hbc1019 tut4Hbc1019 tut4
Hbc1019 tut4
 
Biochemistry I
Biochemistry IBiochemistry I
Biochemistry I
 

Recently uploaded

IAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsIAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsEnterprise Knowledge
 
A Domino Admins Adventures (Engage 2024)
A Domino Admins Adventures (Engage 2024)A Domino Admins Adventures (Engage 2024)
A Domino Admins Adventures (Engage 2024)Gabriella Davis
 
[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdfhans926745
 
Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024The Digital Insurer
 
The Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptxThe Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptxMalak Abu Hammad
 
GenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationGenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationMichael W. Hawkins
 
Presentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreterPresentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreternaman860154
 
A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024Results
 
Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024The Digital Insurer
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...Neo4j
 
Advantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessAdvantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessPixlogix Infotech
 
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024The Digital Insurer
 
Understanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdfUnderstanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdfUK Journal
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Miguel Araújo
 
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...Drew Madelung
 
How to convert PDF to text with Nanonets
How to convert PDF to text with NanonetsHow to convert PDF to text with Nanonets
How to convert PDF to text with Nanonetsnaman860154
 
Boost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivityBoost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivityPrincipled Technologies
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfsudhanshuwaghmare1
 
Driving Behavioral Change for Information Management through Data-Driven Gree...
Driving Behavioral Change for Information Management through Data-Driven Gree...Driving Behavioral Change for Information Management through Data-Driven Gree...
Driving Behavioral Change for Information Management through Data-Driven Gree...Enterprise Knowledge
 
A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?Igalia
 

Recently uploaded (20)

IAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI SolutionsIAC 2024 - IA Fast Track to Search Focused AI Solutions
IAC 2024 - IA Fast Track to Search Focused AI Solutions
 
A Domino Admins Adventures (Engage 2024)
A Domino Admins Adventures (Engage 2024)A Domino Admins Adventures (Engage 2024)
A Domino Admins Adventures (Engage 2024)
 
[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf[2024]Digital Global Overview Report 2024 Meltwater.pdf
[2024]Digital Global Overview Report 2024 Meltwater.pdf
 
Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024Finology Group – Insurtech Innovation Award 2024
Finology Group – Insurtech Innovation Award 2024
 
The Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptxThe Codex of Business Writing Software for Real-World Solutions 2.pptx
The Codex of Business Writing Software for Real-World Solutions 2.pptx
 
GenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day PresentationGenCyber Cyber Security Day Presentation
GenCyber Cyber Security Day Presentation
 
Presentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreterPresentation on how to chat with PDF using ChatGPT code interpreter
Presentation on how to chat with PDF using ChatGPT code interpreter
 
A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024A Call to Action for Generative AI in 2024
A Call to Action for Generative AI in 2024
 
Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024Tata AIG General Insurance Company - Insurer Innovation Award 2024
Tata AIG General Insurance Company - Insurer Innovation Award 2024
 
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...Workshop - Best of Both Worlds_ Combine  KG and Vector search for  enhanced R...
Workshop - Best of Both Worlds_ Combine KG and Vector search for enhanced R...
 
Advantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your BusinessAdvantages of Hiring UIUX Design Service Providers for Your Business
Advantages of Hiring UIUX Design Service Providers for Your Business
 
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
Bajaj Allianz Life Insurance Company - Insurer Innovation Award 2024
 
Understanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdfUnderstanding Discord NSFW Servers A Guide for Responsible Users.pdf
Understanding Discord NSFW Servers A Guide for Responsible Users.pdf
 
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
Mastering MySQL Database Architecture: Deep Dive into MySQL Shell and MySQL R...
 
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
Strategies for Unlocking Knowledge Management in Microsoft 365 in the Copilot...
 
How to convert PDF to text with Nanonets
How to convert PDF to text with NanonetsHow to convert PDF to text with Nanonets
How to convert PDF to text with Nanonets
 
Boost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivityBoost PC performance: How more available memory can improve productivity
Boost PC performance: How more available memory can improve productivity
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdf
 
Driving Behavioral Change for Information Management through Data-Driven Gree...
Driving Behavioral Change for Information Management through Data-Driven Gree...Driving Behavioral Change for Information Management through Data-Driven Gree...
Driving Behavioral Change for Information Management through Data-Driven Gree...
 
A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?A Year of the Servo Reboot: Where Are We Now?
A Year of the Servo Reboot: Where Are We Now?
 

Practical 9 protein structure and function (3)

  • 1. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 Faculty of Information Science & Technology LAB REPORT HBC 1019 - Biochemistry I Practical 9 Protein Structure and Function Name : Osama Barayan ID : 1091105869 Page 1 of 8
  • 2. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 Practical 9: Protein Structure and Function Introduction In this practical you will learn about protein structure prediction tool. You will used PDB website to get the information about the protein structure, and used Rasmol to expore the 3D structure of the protein. 1. Protein 3D structure visualization There are number of useful free visualization tools available on the Internet. For this exercise you will use a tool called Rasmol. Install Rasmol on your computer according to the instructions on the Rasmol site: (http://www.bernstein-plus-sons.com/software/rasmol/INSTALL.html). a. Find other molecular visualization tools that are available from the internet. Give two examples of the visualization tools. VMD and MOLMOL Obtaining Structural Information Many programs have been written to predict secondary structures based only on the primary structure (amino acid sequence) of a protein. Here is a list of such programs that are available online:  PredictProtein (http://www.predictprotein.org). You can request this site to predict secondary structure online  JPred (http://www.compbio.dundee.ac.uk/~www-jpred/). If you use the JPred server, be certain to check the box under #4 to avoid comparison to known PDB structure files. b. For this exercise, you will use the sequence of rabbit muscle triose phosphate isomerase that is given here and submit to two servers that provided above. Compare the results you receive from different servers. Can you identify segment where the predictions are not consistent between servers? The result are consistent between the servers. >1R2R: A TRIOSEPHOSPHATE ISOMERASE from rabbit muscle APSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTA YIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLG HSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGITEKVV FEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRG WLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLK PEFVDIINAKQ Page 2 of 8
  • 3. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 c. The structure of rabbit muscle triose phosphate isomerase has been determined by X- ray crystallography. Go to the Protein Data Bank web server (http://www.rcsb.org/pdb) and search for 1R2R (the PDB ID for this protein). Once you reach the Structure Explorer page for 1R2R, click on the link for Sequence Details. Scroll down the page to the section entitled “Sequence and Secondary Structure.” The results shown here for the secondary structure are based on an analysis of the actual (not predicted) three- dimensional structure, using the principles developed by Kabsh and Sander [see http://www.rcsb.org/pdb/help-results.html#sequence_details and Biopolymers 22, 2577–2637 (1983)]. The secondary structure assignments are H = helix; B = residue in isolated beta bridge; E = extended beta strand; G = 310 helix; I = pi helix; T = hydrogen bonded turn; S = bend. Compare your predicted secondary structure results from Part (b) with the results presented on the PDB site. Result in part b said helix is 41.9% but in PDB site said 44%. 2. Using Rasmol Rasmol enable you to explore protein’s 3-D structure. a. Go back to PDB site for 1R2R and search for the icon download PDB file. Save the PDB file. Open the Rasmol program, and use the drop-down menu File. .Open to open 1R2R.pdb. You will initially see a wireframe model that simply displays all the bonds in the structure as lines. Perform the following steps to get a more informative view: Select Display. .Cartoons from the drop-down menu. Select Colours. .Structure Now you should be able to see the alpha helix and beta sheet structures in rabbit muscle triose phosphate isomerase. How many chains are shown in the structure? What is the dominant structural feature of this protein? Take time to experiment with the other drop-down menu options on Rasmol. Chain =4. Dominant structural =alpha helix. b. All the bonds in the PDB structure file are shown as thin wires, colored according to Corey-Pauling-Kultun (CPK) coloring rules (oxygen is red, nitrogen is blue, hydrogen is white, and carbon is gray). There is seven drop-down menus in Rasmol: File, Edit, Display, Colors, Options, Export, and Help. Spend a few minutes trying each command in each of the menus. Perform the following operations: i. Display. .Backbone. This shows the protein backbone; the bonds actually Page 3 of 8
  • 4. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 connect alpha carbons. iii. Display. .Cartoon. This shows an image of the protein that clearly displays helices and sheets. Leave your image in cartoon format and move to the Colours menu. Page 4 of 8
  • 5. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 iv. Colours. .Structure. This shows alpha helices in magenta, beta sheets in yellow, and turns in pale blue. v. Options. .Labels. This command labels all selected atoms. vi. Export. .GIF. This function enables you to export a still image of the structural view you just created. vii. HELP. .User Manual. This is really a critical tool for using Rasmol. In order for this to work, the help file (Rasmol.hlp in Windows) must be stored in the same directory as the Rasmol program. c. Each line in a PDB file is called a “record,” and the first six characters on that line tell what kind of “record” it is. In your browser, search for SEQRES. As explained in the PDB Format Description, SEQRES records contain the amino acid or nucleic acid sequence of residues in each chain of the macromolecule. Hence you can see the sequence of your protein there. For example, the first few lines of the SEQRES section are given in Table I (below). Each line contains 13 amino acid residues listed by their three-letter abbreviations. So residue #27 in chain A is PHE (phenylalanine). The 12th character (counting spaces) in each record is a chain identifier. If a protein contains more than one polypeptide chain, the chains are identified with a letter. Table I SEQRES 1 A 248 MET ALA ARG LYS TYR PHE VAL ALA ALA ASN TRP LYS CYS SEQRES 2 A 248 ASN GLY THR LEU GLU SER ILE LYS SER LEU THR ASN SER SEQRES 3 248 PHE ASN ASN LEU ASP PHE ASP PRO SER LYS LEU ASP VAL Page 5 of 8
  • 6. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 A SEQRES 4 A 248 VAL VAL PHE PRO VAL SER VAL HIS TYR ASP HIS THR ARG SEQRES 5 A 248 LYS LEU LEU GLN SER LYS PHE SER THR GLY ILE GLN ASN Anything in a PDB file that is not either protein or nucleic acid is considered a heterogen atom and is referred to with the prefix “het.” So HETNAM is the label for a record that contains the name of a nonprotein, non-nucleic acid group. Search the HTML version of the 1R2R file for “HETNAM.” What are the heterogen groups in this structure? DIMETHYL SULFOXIDE, MAGNESIUM ION, and 2-AMINO-2- HYDROXYMETHYL-PROPANE-1,3-DIOL d. In addition to drop-down menus, Rasmol also has a “command line” window that enables you to select specific atoms or parts of a structure (amino acid residues, for example) and change the way they appear. Bring up the command line window and note the effects of entering the following commands: i. select hetero and not water (selects nonprotein parts of the structure excluding water) ii. spacefill (a van der Waals radius representation) iii. color cpk (standard chemistry color scheme) What heteroatoms do you see in this structure? DMS 235, MG 256, and TRS258 Are any substrates or inhibitors represented in this structure? No substrate or inhibitor represented in this structure. Now try more commands: iv. select protein v. cartoon off vi. select sheet vii. wireframe 30 viii. spacefill 100 (these combined commands yield a ball-and-stick structure) Can you see the sheet structure now? If not, type the command “cartoon.” What do you see? Page 6 of 8
  • 7. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 3. Now you have been familiarizing with Rasmol, you need to do the same procedure using PDB ID: 1o5x to explore its structure, focusing on identifying secondary structures and looking at the active sites. a. Download the PDB structure file from PDB site. What is the title of this record? 1O5X b. Repeat the steps in 2d. Identify heterogens group for this protein. List down all of the heterogens or ligands. 2-PHOSPHOGLYCERIC ACID, 3-HYDROXYPYRUVIC ACID and PHOSPHITE ION c. Display the active site residues, there are three residues that interact with the 2- phosphoglycerate: glutamate 165, lysine 12, and histidine 95. Select these residues by entering the command “select lys12, his95, glu165” in the Rasmol command line window. Then use the drop-down menu in the structure window to show the residues in a ball-and-stick format (Display. .Ball & Stick). Finally, enter the command “color CPK” so that you can distinguish the atoms of the structure. Page 7 of 8
  • 8. HBC 1019 Biochemistry 1 Trimester 1, 2012/2013 4. What does CATH and SCOP stands for? What are their functions? CATH stand for Class, Architecture, Topology, Homologous superfamily. SCOP stand for Structural Classification Of Protein. Both is used to classified protein. CONCLUSION The protein structure can be study by using the PDB and Rasmol. By studying the structure person can get understand how that protein functions. Page 8 of 8