SlideShare a Scribd company logo
1 of 13
Motivating Learning in
teens.
Sue Naylor
March 2015
Teens can suffer lack motivation and
engagement in the language learning
classroom. This workshop explores the notion
of a learner centred classroom and gives tips on
how to promote learner self-confidence and
increase motivation with learner centred
classroom activities and ICT use.
Teens
• Low self-esteem and confidence.
• High levels of social anxiety.
• Preoccupied with identity development.
• All kinds of…..changes.
Hostility towards the language classroom.
The need to feel valued.
The need to feel accepted.
We’ve all been there….
Develop initial relationships
Talk to your partner for 2 minutes
Say “hello” -Introduce yourselves – answer the questions:
• Do you have a teenage (Junior or senior level class) class?
• Where do you teach them?
• What is the classroom / school like?
• What is your teenage class like ?
• What do you think is the biggest challenge teaching in
teaching teenagers?
Etc.
Who in this class?
Sue
• Interesting fact:
• Teaches classes throughout the Barcelona
area.
Who in this class?
Seating
Arrange pupils into learning groups
• Avoid arguments about student seats
• Minimise behaviour issues in the classroom
• Ensure peer-peer learning occurs
• Remember names of pupils and use often in
the class
• Facilitate activities where students use each
others names
Provide boundaries
Think - Pair – Share
Kagan (1994)
Fisher, R. Teaching children to learn 2005 p.96
Stages:
• 1. Students Listen while the teacher (or
another) poses the question or problem.
• 2. Students are then given time to think
• 3. Students then collaborate
• 4. Students share their work with the rest of
the group.
Stages
Think – pair - share
• Teacher input
• Student created collaborative material (story
/ script / presentation).
• Teacher led error correction.
• Students review work and create material to
share or display
• Final error correction focus (whole group)
Online tools
Collaboration can….
• Enable peer assisted learning.
• Reduce anxiety
• Increase in self confidence and self esteem
• Increase motivation
• Create positive attitudes towards language
learning.
Questions

More Related Content

What's hot

Language arts patterns of practice
Language arts patterns of practiceLanguage arts patterns of practice
Language arts patterns of practicejanyah202belike
 
Teaching ELs
Teaching ELs Teaching ELs
Teaching ELs ayers01
 
Speak Up: Encouraging Students to Speak in the Classroom
Speak Up: Encouraging Students to Speak in the ClassroomSpeak Up: Encouraging Students to Speak in the Classroom
Speak Up: Encouraging Students to Speak in the ClassroomJulie Hanks
 
Flipped learning in english
Flipped learning in englishFlipped learning in english
Flipped learning in englishAprilianty Wid
 
CPE Presentation FINAL Julia Cirillo
CPE Presentation FINAL Julia CirilloCPE Presentation FINAL Julia Cirillo
CPE Presentation FINAL Julia CirilloJulia Cirillo
 
Student Engagement and Learning Needs: helping your students learn in the cla...
Student Engagement and Learning Needs: helping your students learn in the cla...Student Engagement and Learning Needs: helping your students learn in the cla...
Student Engagement and Learning Needs: helping your students learn in the cla...Emma Kennedy
 
PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear"
 PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear" PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear"
PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear"designtn
 
Reading workshop series day 4
Reading workshop series day 4Reading workshop series day 4
Reading workshop series day 4Jennifer Evans
 
The Self Organised Learning Environment (SOLEs) - Does it work in the languag...
The Self Organised Learning Environment (SOLEs) - Does it work in the languag...The Self Organised Learning Environment (SOLEs) - Does it work in the languag...
The Self Organised Learning Environment (SOLEs) - Does it work in the languag...eaquals
 
Filling vessels or kindling fires – what is teaching, and how does it impact ...
Filling vessels or kindling fires – what is teaching, and how does it impact ...Filling vessels or kindling fires – what is teaching, and how does it impact ...
Filling vessels or kindling fires – what is teaching, and how does it impact ...eaquals
 
Robertson b 16217197_assignment_1_presentation1
Robertson b 16217197_assignment_1_presentation1Robertson b 16217197_assignment_1_presentation1
Robertson b 16217197_assignment_1_presentation1Brooker155
 
Robertson b 16217197_assignment1_presentation
Robertson b 16217197_assignment1_presentationRobertson b 16217197_assignment1_presentation
Robertson b 16217197_assignment1_presentationBrooker155
 
Kamloops.indigenous lit circles
Kamloops.indigenous lit circlesKamloops.indigenous lit circles
Kamloops.indigenous lit circlesFaye Brownlie
 

What's hot (20)

Language arts patterns of practice
Language arts patterns of practiceLanguage arts patterns of practice
Language arts patterns of practice
 
Teaching ELs
Teaching ELs Teaching ELs
Teaching ELs
 
Speak Up: Encouraging Students to Speak in the Classroom
Speak Up: Encouraging Students to Speak in the ClassroomSpeak Up: Encouraging Students to Speak in the Classroom
Speak Up: Encouraging Students to Speak in the Classroom
 
Flipped learning in english
Flipped learning in englishFlipped learning in english
Flipped learning in english
 
Mixed abilities classes
Mixed abilities classesMixed abilities classes
Mixed abilities classes
 
GAMES IN ENGLISH TEACHING AT ELEMENTARY LEVELS
GAMES IN ENGLISH TEACHING AT ELEMENTARY LEVELSGAMES IN ENGLISH TEACHING AT ELEMENTARY LEVELS
GAMES IN ENGLISH TEACHING AT ELEMENTARY LEVELS
 
CPE Presentation FINAL Julia Cirillo
CPE Presentation FINAL Julia CirilloCPE Presentation FINAL Julia Cirillo
CPE Presentation FINAL Julia Cirillo
 
Student Engagement and Learning Needs: helping your students learn in the cla...
Student Engagement and Learning Needs: helping your students learn in the cla...Student Engagement and Learning Needs: helping your students learn in the cla...
Student Engagement and Learning Needs: helping your students learn in the cla...
 
PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear"
 PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear" PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear"
PUMS,Nariyanur,Mechari,Mettur TK,SALEM (DT) "Stage fear"
 
Reading workshop series day 4
Reading workshop series day 4Reading workshop series day 4
Reading workshop series day 4
 
CLASSROOM TALK
CLASSROOM TALKCLASSROOM TALK
CLASSROOM TALK
 
The Self Organised Learning Environment (SOLEs) - Does it work in the languag...
The Self Organised Learning Environment (SOLEs) - Does it work in the languag...The Self Organised Learning Environment (SOLEs) - Does it work in the languag...
The Self Organised Learning Environment (SOLEs) - Does it work in the languag...
 
Filling vessels or kindling fires – what is teaching, and how does it impact ...
Filling vessels or kindling fires – what is teaching, and how does it impact ...Filling vessels or kindling fires – what is teaching, and how does it impact ...
Filling vessels or kindling fires – what is teaching, and how does it impact ...
 
Inclusion: Methods and strategies
Inclusion: Methods and strategiesInclusion: Methods and strategies
Inclusion: Methods and strategies
 
Robertson b 16217197_assignment_1_presentation1
Robertson b 16217197_assignment_1_presentation1Robertson b 16217197_assignment_1_presentation1
Robertson b 16217197_assignment_1_presentation1
 
Robertson b 16217197_assignment1_presentation
Robertson b 16217197_assignment1_presentationRobertson b 16217197_assignment1_presentation
Robertson b 16217197_assignment1_presentation
 
Lesson plan opposite writing
Lesson plan opposite writingLesson plan opposite writing
Lesson plan opposite writing
 
Kamloops.indigenous lit circles
Kamloops.indigenous lit circlesKamloops.indigenous lit circles
Kamloops.indigenous lit circles
 
English reading 1
English  reading 1 English  reading 1
English reading 1
 
Building language interest, confidence, motivation and skills 2
Building language interest, confidence, motivation and skills 2Building language interest, confidence, motivation and skills 2
Building language interest, confidence, motivation and skills 2
 

Viewers also liked

Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...
Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...
Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...ExamSoft
 
Motivating learning in low level teens
Motivating learning in low level teensMotivating learning in low level teens
Motivating learning in low level teenssuezann33
 
6th Grade Common Core Vocabulary for Visual Art
6th Grade Common Core Vocabulary for Visual Art6th Grade Common Core Vocabulary for Visual Art
6th Grade Common Core Vocabulary for Visual ArtArtfulArtsyAmy
 
Python meetup 2
Python meetup 2Python meetup 2
Python meetup 2Vic Yang
 
Google Education: Teaching and Learning Innovation
Google Education: Teaching and Learning InnovationGoogle Education: Teaching and Learning Innovation
Google Education: Teaching and Learning InnovationLucy Gray
 
STEM Education Reform: Technology Learning Center v5.3a
STEM Education Reform: Technology Learning Center v5.3aSTEM Education Reform: Technology Learning Center v5.3a
STEM Education Reform: Technology Learning Center v5.3aBob Lurker
 
Introduction to Python programming
Introduction to Python programmingIntroduction to Python programming
Introduction to Python programmingDamian T. Gordon
 
Steam Art Education
Steam Art EducationSteam Art Education
Steam Art EducationNancy Walkup
 
E learning,How to develop eLearning from start to end.
E learning,How to develop eLearning from start to end.E learning,How to develop eLearning from start to end.
E learning,How to develop eLearning from start to end.Satish Verma
 
7 Steps To Creating An Effective E Learning Program
7 Steps To Creating An Effective E Learning Program7 Steps To Creating An Effective E Learning Program
7 Steps To Creating An Effective E Learning ProgramThe Blockchain Academy
 
E learning business plan development
E learning business plan developmentE learning business plan development
E learning business plan developmentEric Kluijfhout
 
E-Learning Business Proposal
E-Learning Business ProposalE-Learning Business Proposal
E-Learning Business Proposalhaussmannmatthew
 
Mathematics quiz bee.pptx geometry
Mathematics quiz bee.pptx geometry Mathematics quiz bee.pptx geometry
Mathematics quiz bee.pptx geometry Emma Balbastro
 
12 Motivating Quotes to Help You Nail Your Presentation
12 Motivating Quotes to Help You Nail Your Presentation12 Motivating Quotes to Help You Nail Your Presentation
12 Motivating Quotes to Help You Nail Your PresentationSlideShop.com
 
Tried and Tested Tips for Customer Satisfaction
Tried and Tested Tips for Customer SatisfactionTried and Tested Tips for Customer Satisfaction
Tried and Tested Tips for Customer SatisfactionSlideShop.com
 
Excellence & Equity in Maths, STEM and Higher Education
Excellence & Equity in Maths, STEM and Higher EducationExcellence & Equity in Maths, STEM and Higher Education
Excellence & Equity in Maths, STEM and Higher EducationMATSITI
 

Viewers also liked (20)

Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...
Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...
Tech-Driven Education Reform: A Model for Simultaneously Improving Student Re...
 
Motivating learning in low level teens
Motivating learning in low level teensMotivating learning in low level teens
Motivating learning in low level teens
 
6th Grade Common Core Vocabulary for Visual Art
6th Grade Common Core Vocabulary for Visual Art6th Grade Common Core Vocabulary for Visual Art
6th Grade Common Core Vocabulary for Visual Art
 
Python meetup 2
Python meetup 2Python meetup 2
Python meetup 2
 
Math is Storytelling
Math is StorytellingMath is Storytelling
Math is Storytelling
 
Google Education: Teaching and Learning Innovation
Google Education: Teaching and Learning InnovationGoogle Education: Teaching and Learning Innovation
Google Education: Teaching and Learning Innovation
 
STEM Education Reform: Technology Learning Center v5.3a
STEM Education Reform: Technology Learning Center v5.3aSTEM Education Reform: Technology Learning Center v5.3a
STEM Education Reform: Technology Learning Center v5.3a
 
Introduction to Python programming
Introduction to Python programmingIntroduction to Python programming
Introduction to Python programming
 
Steam Art Education
Steam Art EducationSteam Art Education
Steam Art Education
 
E learning,How to develop eLearning from start to end.
E learning,How to develop eLearning from start to end.E learning,How to develop eLearning from start to end.
E learning,How to develop eLearning from start to end.
 
7 Steps To Creating An Effective E Learning Program
7 Steps To Creating An Effective E Learning Program7 Steps To Creating An Effective E Learning Program
7 Steps To Creating An Effective E Learning Program
 
E learning business plan development
E learning business plan developmentE learning business plan development
E learning business plan development
 
E-Learning Business Proposal
E-Learning Business ProposalE-Learning Business Proposal
E-Learning Business Proposal
 
Mathematics quiz bee.pptx geometry
Mathematics quiz bee.pptx geometry Mathematics quiz bee.pptx geometry
Mathematics quiz bee.pptx geometry
 
12 Motivating Quotes to Help You Nail Your Presentation
12 Motivating Quotes to Help You Nail Your Presentation12 Motivating Quotes to Help You Nail Your Presentation
12 Motivating Quotes to Help You Nail Your Presentation
 
Maths quiz
Maths quizMaths quiz
Maths quiz
 
Tried and Tested Tips for Customer Satisfaction
Tried and Tested Tips for Customer SatisfactionTried and Tested Tips for Customer Satisfaction
Tried and Tested Tips for Customer Satisfaction
 
Excellence & Equity in Maths, STEM and Higher Education
Excellence & Equity in Maths, STEM and Higher EducationExcellence & Equity in Maths, STEM and Higher Education
Excellence & Equity in Maths, STEM and Higher Education
 
Wikispaces Tutorial
Wikispaces TutorialWikispaces Tutorial
Wikispaces Tutorial
 
Types of Irrigation
Types of IrrigationTypes of Irrigation
Types of Irrigation
 

Similar to Motivating learning with teens march 2015

Ppt learning strategies
Ppt learning strategiesPpt learning strategies
Ppt learning strategiesAnita Malhotra
 
1st session (current approches to learning and teaching).ppt
1st session (current approches to learning and teaching).ppt1st session (current approches to learning and teaching).ppt
1st session (current approches to learning and teaching).pptHithadhooSchool
 
TeacherTraining.pptx
TeacherTraining.pptxTeacherTraining.pptx
TeacherTraining.pptxMisterRidley
 
Akhavan comprehension matters ideas slideshare
Akhavan  comprehension matters ideas slideshareAkhavan  comprehension matters ideas slideshare
Akhavan comprehension matters ideas slideshareNancy Akhavan
 
8 principles of effective teaching and assessment
8 principles of effective teaching and assessment8 principles of effective teaching and assessment
8 principles of effective teaching and assessmentHylton Upshon
 
Prince Geoge Collaboration
Prince Geoge CollaborationPrince Geoge Collaboration
Prince Geoge CollaborationFaye Brownlie
 
Pairwork
PairworkPairwork
Pairworkmarina
 
Active Learning Methods in Teaching.pdf
Active Learning Methods in Teaching.pdfActive Learning Methods in Teaching.pdf
Active Learning Methods in Teaching.pdfThanavathi C
 
Reflecting on large class teaching at UJ
Reflecting on large class teaching at UJReflecting on large class teaching at UJ
Reflecting on large class teaching at UJCarina van Rooyen
 
teaching-speaking.pptaaaappyvfdthhvddgghh
teaching-speaking.pptaaaappyvfdthhvddgghhteaching-speaking.pptaaaappyvfdthhvddgghh
teaching-speaking.pptaaaappyvfdthhvddgghhzuspaelmayouri
 
TEFL (Direct Method, PPP, CLL)
TEFL (Direct Method, PPP, CLL)TEFL (Direct Method, PPP, CLL)
TEFL (Direct Method, PPP, CLL)Widya Alfiani
 
Activities in teaching speaking
Activities in teaching speakingActivities in teaching speaking
Activities in teaching speakingDraizelle Sexon
 
motivation in learning a second language
motivation in learning a second languagemotivation in learning a second language
motivation in learning a second languageYuzz Uzxa
 
Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)
Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)
Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)Dwitya Aribawa
 
Cooperative learning theory
Cooperative learning theoryCooperative learning theory
Cooperative learning theoryIrina K
 

Similar to Motivating learning with teens march 2015 (20)

Ppt learning strategies
Ppt learning strategiesPpt learning strategies
Ppt learning strategies
 
1st session (current approches to learning and teaching).ppt
1st session (current approches to learning and teaching).ppt1st session (current approches to learning and teaching).ppt
1st session (current approches to learning and teaching).ppt
 
TeacherTraining.pptx
TeacherTraining.pptxTeacherTraining.pptx
TeacherTraining.pptx
 
Akhavan comprehension matters ideas slideshare
Akhavan  comprehension matters ideas slideshareAkhavan  comprehension matters ideas slideshare
Akhavan comprehension matters ideas slideshare
 
8 principles of effective teaching and assessment
8 principles of effective teaching and assessment8 principles of effective teaching and assessment
8 principles of effective teaching and assessment
 
Prince Geoge Collaboration
Prince Geoge CollaborationPrince Geoge Collaboration
Prince Geoge Collaboration
 
Flipped Classroom.pptx
Flipped Classroom.pptxFlipped Classroom.pptx
Flipped Classroom.pptx
 
Pairwork
PairworkPairwork
Pairwork
 
Cooperative learning
Cooperative learningCooperative learning
Cooperative learning
 
Active Learning Methods in Teaching.pdf
Active Learning Methods in Teaching.pdfActive Learning Methods in Teaching.pdf
Active Learning Methods in Teaching.pdf
 
Reflecting on large class teaching at UJ
Reflecting on large class teaching at UJReflecting on large class teaching at UJ
Reflecting on large class teaching at UJ
 
teaching-speaking.pptaaaappyvfdthhvddgghh
teaching-speaking.pptaaaappyvfdthhvddgghhteaching-speaking.pptaaaappyvfdthhvddgghh
teaching-speaking.pptaaaappyvfdthhvddgghh
 
INTERACTIVE & INNOVATIVE TEACHING
INTERACTIVE & INNOVATIVE TEACHINGINTERACTIVE & INNOVATIVE TEACHING
INTERACTIVE & INNOVATIVE TEACHING
 
TEFL (Direct Method, PPP, CLL)
TEFL (Direct Method, PPP, CLL)TEFL (Direct Method, PPP, CLL)
TEFL (Direct Method, PPP, CLL)
 
Activities in teaching speaking
Activities in teaching speakingActivities in teaching speaking
Activities in teaching speaking
 
ICT @ PS10
ICT @ PS10ICT @ PS10
ICT @ PS10
 
motivation in learning a second language
motivation in learning a second languagemotivation in learning a second language
motivation in learning a second language
 
Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)
Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)
Faculty of Economics Trisakti University - Problem Based Learning (7 Jump Step)
 
Cooperative learning theory
Cooperative learning theoryCooperative learning theory
Cooperative learning theory
 
Smart class 1 training program-teachers2
 Smart class 1 training program-teachers2 Smart class 1 training program-teachers2
Smart class 1 training program-teachers2
 

More from suezann33

Romeo and juliet
Romeo and julietRomeo and juliet
Romeo and julietsuezann33
 
Processes quiz (present simple passive)
Processes quiz (present simple passive)Processes quiz (present simple passive)
Processes quiz (present simple passive)suezann33
 
Motivating teenagers september 2015
Motivating teenagers september 2015Motivating teenagers september 2015
Motivating teenagers september 2015suezann33
 
Setting up an online space
Setting up an online spaceSetting up an online space
Setting up an online spacesuezann33
 
Survey results
Survey resultsSurvey results
Survey resultssuezann33
 
Speaking practice FCE part 2
Speaking practice FCE part 2Speaking practice FCE part 2
Speaking practice FCE part 2suezann33
 
H______ story
H______ storyH______ story
H______ storysuezann33
 
Balcony scene
Balcony sceneBalcony scene
Balcony scenesuezann33
 
Romeo and juliet
Romeo and julietRomeo and juliet
Romeo and julietsuezann33
 
Wikis that work
Wikis that work Wikis that work
Wikis that work suezann33
 

More from suezann33 (12)

Romeo and juliet
Romeo and julietRomeo and juliet
Romeo and juliet
 
Revision
RevisionRevision
Revision
 
Processes quiz (present simple passive)
Processes quiz (present simple passive)Processes quiz (present simple passive)
Processes quiz (present simple passive)
 
Motivating teenagers september 2015
Motivating teenagers september 2015Motivating teenagers september 2015
Motivating teenagers september 2015
 
Setting up an online space
Setting up an online spaceSetting up an online space
Setting up an online space
 
Survey results
Survey resultsSurvey results
Survey results
 
Speaking practice FCE part 2
Speaking practice FCE part 2Speaking practice FCE part 2
Speaking practice FCE part 2
 
H______ story
H______ storyH______ story
H______ story
 
The snowman
The snowmanThe snowman
The snowman
 
Balcony scene
Balcony sceneBalcony scene
Balcony scene
 
Romeo and juliet
Romeo and julietRomeo and juliet
Romeo and juliet
 
Wikis that work
Wikis that work Wikis that work
Wikis that work
 

Recently uploaded

Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Educationpboyjonauth
 
Alper Gobel In Media Res Media Component
Alper Gobel In Media Res Media ComponentAlper Gobel In Media Res Media Component
Alper Gobel In Media Res Media ComponentInMediaRes1
 
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️9953056974 Low Rate Call Girls In Saket, Delhi NCR
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)eniolaolutunde
 
How to Configure Email Server in Odoo 17
How to Configure Email Server in Odoo 17How to Configure Email Server in Odoo 17
How to Configure Email Server in Odoo 17Celine George
 
Science 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsScience 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsKarinaGenton
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformChameera Dedduwage
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsanshu789521
 
Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxNirmalaLoungPoorunde1
 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon AUnboundStockton
 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfsanyamsingh5019
 
Class 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdfClass 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdfakmcokerachita
 
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfEnzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfSumit Tiwari
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityGeoBlogs
 
mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docxPoojaSen20
 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxheathfieldcps1
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxmanuelaromero2013
 
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdfssuser54595a
 

Recently uploaded (20)

Introduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher EducationIntroduction to ArtificiaI Intelligence in Higher Education
Introduction to ArtificiaI Intelligence in Higher Education
 
Alper Gobel In Media Res Media Component
Alper Gobel In Media Res Media ComponentAlper Gobel In Media Res Media Component
Alper Gobel In Media Res Media Component
 
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
call girls in Kamla Market (DELHI) 🔝 >༒9953330565🔝 genuine Escort Service 🔝✔️✔️
 
Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)Software Engineering Methodologies (overview)
Software Engineering Methodologies (overview)
 
How to Configure Email Server in Odoo 17
How to Configure Email Server in Odoo 17How to Configure Email Server in Odoo 17
How to Configure Email Server in Odoo 17
 
Science 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its CharacteristicsScience 7 - LAND and SEA BREEZE and its Characteristics
Science 7 - LAND and SEA BREEZE and its Characteristics
 
Model Call Girl in Bikash Puri Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Bikash Puri  Delhi reach out to us at 🔝9953056974🔝Model Call Girl in Bikash Puri  Delhi reach out to us at 🔝9953056974🔝
Model Call Girl in Bikash Puri Delhi reach out to us at 🔝9953056974🔝
 
A Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy ReformA Critique of the Proposed National Education Policy Reform
A Critique of the Proposed National Education Policy Reform
 
Presiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha electionsPresiding Officer Training module 2024 lok sabha elections
Presiding Officer Training module 2024 lok sabha elections
 
Employee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptxEmployee wellbeing at the workplace.pptx
Employee wellbeing at the workplace.pptx
 
Crayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon ACrayon Activity Handout For the Crayon A
Crayon Activity Handout For the Crayon A
 
Sanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdfSanyam Choudhary Chemistry practical.pdf
Sanyam Choudhary Chemistry practical.pdf
 
Class 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdfClass 11 Legal Studies Ch-1 Concept of State .pdf
Class 11 Legal Studies Ch-1 Concept of State .pdf
 
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdfEnzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
Enzyme, Pharmaceutical Aids, Miscellaneous Last Part of Chapter no 5th.pdf
 
Paris 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activityParis 2024 Olympic Geographies - an activity
Paris 2024 Olympic Geographies - an activity
 
9953330565 Low Rate Call Girls In Rohini Delhi NCR
9953330565 Low Rate Call Girls In Rohini  Delhi NCR9953330565 Low Rate Call Girls In Rohini  Delhi NCR
9953330565 Low Rate Call Girls In Rohini Delhi NCR
 
mini mental status format.docx
mini    mental       status     format.docxmini    mental       status     format.docx
mini mental status format.docx
 
The basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptxThe basics of sentences session 2pptx copy.pptx
The basics of sentences session 2pptx copy.pptx
 
How to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptxHow to Make a Pirate ship Primary Education.pptx
How to Make a Pirate ship Primary Education.pptx
 
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
18-04-UA_REPORT_MEDIALITERAСY_INDEX-DM_23-1-final-eng.pdf
 

Motivating learning with teens march 2015

  • 2. Teens can suffer lack motivation and engagement in the language learning classroom. This workshop explores the notion of a learner centred classroom and gives tips on how to promote learner self-confidence and increase motivation with learner centred classroom activities and ICT use.
  • 3. Teens • Low self-esteem and confidence. • High levels of social anxiety. • Preoccupied with identity development. • All kinds of…..changes. Hostility towards the language classroom. The need to feel valued. The need to feel accepted.
  • 4. We’ve all been there….
  • 5. Develop initial relationships Talk to your partner for 2 minutes Say “hello” -Introduce yourselves – answer the questions: • Do you have a teenage (Junior or senior level class) class? • Where do you teach them? • What is the classroom / school like? • What is your teenage class like ? • What do you think is the biggest challenge teaching in teaching teenagers? Etc. Who in this class?
  • 6. Sue • Interesting fact: • Teaches classes throughout the Barcelona area. Who in this class?
  • 7. Seating Arrange pupils into learning groups • Avoid arguments about student seats • Minimise behaviour issues in the classroom • Ensure peer-peer learning occurs • Remember names of pupils and use often in the class • Facilitate activities where students use each others names
  • 9. Think - Pair – Share Kagan (1994) Fisher, R. Teaching children to learn 2005 p.96 Stages: • 1. Students Listen while the teacher (or another) poses the question or problem. • 2. Students are then given time to think • 3. Students then collaborate • 4. Students share their work with the rest of the group.
  • 10. Stages Think – pair - share • Teacher input • Student created collaborative material (story / script / presentation). • Teacher led error correction. • Students review work and create material to share or display • Final error correction focus (whole group)
  • 12. Collaboration can…. • Enable peer assisted learning. • Reduce anxiety • Increase in self confidence and self esteem • Increase motivation • Create positive attitudes towards language learning.