SlideShare a Scribd company logo
1 of 5
ECWAY TECHNOLOGIES
IEEE PROJECTS & SOFTWARE DEVELOPMENTS
OUR OFFICES @ CHENNAI / TRICHY / KARUR / ERODE / MADURAI / SALEM / COIMBATORE
BANGALORE / HYDRABAD
CELL: +91 98949 17187, +91 875487 1111 / 2111 / 3111 / 4111 / 5111 / 6111 / 8111
Visit: www.ecwayprojects.com Mail to: ecwaytechnologies@gmail.com

2013 IEEE PROJECT JAVA TITLES
DOMAIN: MOBILE COMPUTING
Distributed Cooperative Caching in Social Wireless Networks
Power Allocation for Statistical QoS Provisioning in Opportunistic Multi-Relay DF Cognitive Networks
Pulse Switching Toward a Packet-Less Protocol Paradigm for Event Sensing
EMAP Expedite Message Authentication Protocol for Vehicular Ad Hoc Networks
Dynamic Coverage of Mobile Sensor Networks
A Scalable Server Architecture for Mobile Presence Services in Social Network Applications
Mobile Relay Configuration in Data-Intensive Wireless Sensor Networks
A Resource Allocation Scheme for Scalable Video Multicast in WiMAX Relay Networks
Quality-Differentiated Video Multicast in Multirate Wireless Networks
SinkTrail A Proactive Data Reporting Protocol for Wireless Sensor Networks
Target Tracking and Mobile Sensor Navigation in Wireless Sensor Networks
Toward Privacy Preserving and Collusion Resistance in a Location Proof Updating System
On the Real-Time Hardware Implementation Feasibility of Joint Radio Resource Management Policies for
Heterogeneous Wireless Networks
Toward a Statistical Framework for Source Anonymity in Sensor Networks
On Centralized and Localized Approximation Algorithms for Interference-Aware Broadcast Scheduling
Model-Based Analysis of Wireless System Architectures for Real-Time Applications
Capacity of Hybrid Wireless Mesh Networks with Random APs
Delay-Optimal Broadcast for Multihop Wireless Networks Using Self-Interference Cancellation
Vampire Attacks: Draining Life from Wireless Ad Hoc Sensor Networks
Group-Based Medium Access Control for IEEE 802.11n Wireless LANs
Cross-Layer Design of Congestion Control and Power Control in Fast-Fading Wireless Networks
Analysis of Distance-Based Location Management in Wireless Communication Networks
Fast Channel Zapping with Destination-Oriented Multicast for IP Video Delivery
Exploiting Ubiquitous Data Collection for Mobile Users in Wireless Sensor Networks
Jamming Games in the MIMO Wiretap Channel With an Active Eavesdropper

DOMAIN: WIRELESS NETWORK PROJECTS
A Data Fusion Technique for Wireless Ranging Performance Improvement
Channel Allocation and Routing in Hybrid Multichannel Multiradio Wireless Mesh Networks
Fast Transmission to Remote Cooperative Groups a New Key Management Paradigm
Modeling and Optimizing the Performance- Security Tradeoff on D-NCS Using the Coevolutionary Paradigm
Privacy-Preserving Distributed Profile Matching in Proximity-Based Mobile Social Networks
Efficient Two-Server Password-Only Authenticated Key Exchange
Channel Assignment for Throughput Optimization in Multichannel Multiradio Wireless Mesh Networks Using
Network Coding
DOMAIN: NETWORK SECURITY PROJECTS
EAACK—A Secure Intrusion-Detection System for MANETs
NICE Network Intrusion Detection and Countermeasure Selection in Virtual Network Systems
Entrusting Private Computation and Data to Untrusted Networks
Security Analysis of a Single Sign-On Mechanism for Distributed Computer Networks

DOMAIN: DATA MINING (Data Engineering)
PMSE A Personalized Mobile Search Engine
Fully Anonymous Profile Matching in Mobile Social Networks
A Fast Clustering-Based Feature Subset Selection Algorithm for High-Dimensional Data
A Survey of XML Tree Patterns
Automatic Semantic Content Extraction in Videos Using a Fuzzy Ontology and Rule-Based Model
Distributed Processing of Probabilistic Top-k Queries in Wireless Sensor Networks
Distributed Web Systems Performance Forecasting Using Turning Bands Method
Maximum Likelihood Estimation from Uncertain Data in the Belief Function Framework
Ranking on Data Manifold with Sink Points
Region-Based Foldings in Process Discovery
Relationships between Diversity of Classification Ensembles and Single-Class Performance Measures
T-Drive Enhancing Driving Directions with Taxi Drivers’ Intelligence
AML: Efficient Approximate Membership Localization within a Web-Based Join Framework
Efficient Algorithms for Mining High Utility Itemsets from Transactional Databases
Optimizing Multi-Top-k Queries over Uncertain Data Streams
A System to Filter Unwanted Messages from OSN User Walls
DOMAIN: CLOUD COMPUTING
Toward Secure Multi-keyword Top-k Retrieval over Encrypted Cloud Data
Privacy-Preserving Public Auditing for Secure Cloud Storage
Optimizing Cloud Resources for Delivering IPTV Services through Virtualization
Mona: Secure Multi-Owner Data Sharing for Dynamic Groups in the Cloud
Optimal Multiserver Configuration for Profit Maximization in Cloud Computing
Dynamic Resource Allocation Using Virtual Machines for Cloud Computing Environment
CAM: Cloud-Assisted Privacy Preserving Mobile Health Monitoring
AMES-Cloud: A Framework of Adaptive Mobile Video Streaming and Efficient Social Video Sharing in the
Clouds
CloudMoV Cloud-Based Mobile Social TV

DOMAIN: PARALLEL & DISTRIBUTED COMPUTING
Network Traffic Classification Using Correlation Information
Scalable and Secure Sharing of Personal Health Records in Cloud Computing Using Attribute-Based
Encryption
Adaptive Network Coding for Broadband Wireless Access Networks
Detection and Localization of Multiple Spoofing Attackers in Wireless Networks
Online Real-Time Task Scheduling in Heterogeneous Multicore System-on-a-Chip
Covering Points of Interest with Mobile Sensors
High Performance Resource Allocation Strategies for Computational Economies
Strategies for Energy-Efficient Resource Management of Hybrid Programming Models
Multimedia Fusion With Mean-Covariance Analysis
2013 ieee java project titles

More Related Content

Viewers also liked

Ute. la diversidad en el aula
Ute. la diversidad en el aulaUte. la diversidad en el aula
Ute. la diversidad en el aulaLeticia Delia
 
Clustering large probabilistic graphs
Clustering large probabilistic graphsClustering large probabilistic graphs
Clustering large probabilistic graphsEcway2004
 
Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015FinLight Research
 
YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015Diana Benner
 
RUBRICA ESTUDIANTES
RUBRICA ESTUDIANTESRUBRICA ESTUDIANTES
RUBRICA ESTUDIANTESmcllanosm
 
Millennials haiku deck
Millennials haiku deckMillennials haiku deck
Millennials haiku deck11aeh4
 
2013 ieee matlab project titles
2013 ieee matlab project titles2013 ieee matlab project titles
2013 ieee matlab project titlesEcwaytechnoz
 
2013 ieee .net project titles
2013 ieee .net project titles2013 ieee .net project titles
2013 ieee .net project titlesEcwaytechnoz
 
Onwednesdayswewearpinkfinal
OnwednesdayswewearpinkfinalOnwednesdayswewearpinkfinal
Onwednesdayswewearpinkfinaltiffanymelo
 
Finlight Research - Market Perspectives - May 2015
Finlight Research - Market Perspectives - May 2015Finlight Research - Market Perspectives - May 2015
Finlight Research - Market Perspectives - May 2015FinLight Research
 
2013 ieee embedded projects
2013 ieee embedded projects2013 ieee embedded projects
2013 ieee embedded projectsEcwaytechnoz
 
Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....Jonathan Pascual
 
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravkaKraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravkaŠk Ivan Dvoržak
 
sols_print_enrolment_record
sols_print_enrolment_recordsols_print_enrolment_record
sols_print_enrolment_recordChen Zhao
 
Covering points of interest with mobile sensors
Covering points of interest with mobile sensorsCovering points of interest with mobile sensors
Covering points of interest with mobile sensorsEcway2004
 
Roles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century EducationRoles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century Educationdorothey tumulak
 

Viewers also liked (20)

Ute. la diversidad en el aula
Ute. la diversidad en el aulaUte. la diversidad en el aula
Ute. la diversidad en el aula
 
Untitled Presentation
Untitled PresentationUntitled Presentation
Untitled Presentation
 
Clustering large probabilistic graphs
Clustering large probabilistic graphsClustering large probabilistic graphs
Clustering large probabilistic graphs
 
Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015Finlight Research - Market Perspectives - Jun 2015
Finlight Research - Market Perspectives - Jun 2015
 
Sino si Duterte
Sino si DuterteSino si Duterte
Sino si Duterte
 
YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015YouTube Tools To The Rescue - Tots & Technology 2015
YouTube Tools To The Rescue - Tots & Technology 2015
 
RUBRICA ESTUDIANTES
RUBRICA ESTUDIANTESRUBRICA ESTUDIANTES
RUBRICA ESTUDIANTES
 
Millennials haiku deck
Millennials haiku deckMillennials haiku deck
Millennials haiku deck
 
2013 ieee matlab project titles
2013 ieee matlab project titles2013 ieee matlab project titles
2013 ieee matlab project titles
 
2013 ieee .net project titles
2013 ieee .net project titles2013 ieee .net project titles
2013 ieee .net project titles
 
Onwednesdayswewearpinkfinal
OnwednesdayswewearpinkfinalOnwednesdayswewearpinkfinal
Onwednesdayswewearpinkfinal
 
Finlight Research - Market Perspectives - May 2015
Finlight Research - Market Perspectives - May 2015Finlight Research - Market Perspectives - May 2015
Finlight Research - Market Perspectives - May 2015
 
2013 ieee embedded projects
2013 ieee embedded projects2013 ieee embedded projects
2013 ieee embedded projects
 
Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....Pascual Prayerletter March 2015....
Pascual Prayerletter March 2015....
 
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravkaKraljevi generacija hrvatskog šaha -  2003. - mala, ali važna ispravka
Kraljevi generacija hrvatskog šaha - 2003. - mala, ali važna ispravka
 
Russia
RussiaRussia
Russia
 
sols_print_enrolment_record
sols_print_enrolment_recordsols_print_enrolment_record
sols_print_enrolment_record
 
Covering points of interest with mobile sensors
Covering points of interest with mobile sensorsCovering points of interest with mobile sensors
Covering points of interest with mobile sensors
 
Business Intelligence
Business IntelligenceBusiness Intelligence
Business Intelligence
 
Roles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century EducationRoles and Functions of Educational Technology in the 21st century Education
Roles and Functions of Educational Technology in the 21st century Education
 

Similar to 2013 ieee java project titles

2013 ieee .net project titles
2013 ieee .net project titles2013 ieee .net project titles
2013 ieee .net project titlesEcway2004
 
2014 ieee java project titles
2014 ieee java project titles2014 ieee java project titles
2014 ieee java project titlesEcway2004
 
2014 ieee java project titles
2014 ieee java project titles2014 ieee java project titles
2014 ieee java project titlesEcwaytechnoz
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titlesEcwaytech
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titlesEcway2004
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titlesEcwaytechnoz
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titlesEcwaytechnoz
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titlesEcwayt
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titlesEcway2004
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titlesEcwaytechnoz
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titlesEcwayt
 
2014 ieee .net project titles
2014 ieee .net project titles2014 ieee .net project titles
2014 ieee .net project titlesEcway2004
 
2014 ieee .net project titles
2014 ieee .net project titles2014 ieee .net project titles
2014 ieee .net project titlesEcwaytechnoz
 
2013 ieee project java titles
2013 ieee project java titles2013 ieee project java titles
2013 ieee project java titlesEcwaytechnoz
 
2014 ieee project java titles
2014 ieee project java titles2014 ieee project java titles
2014 ieee project java titlesEcwaytechnoz
 
2013 ieee project java titles
2013 ieee project java titles2013 ieee project java titles
2013 ieee project java titlesEcwayt
 
2014 ieee project java titles
2014 ieee project java titles2014 ieee project java titles
2014 ieee project java titlesEcway2004
 
2013 ieee project java titles
2013 ieee project java titles2013 ieee project java titles
2013 ieee project java titlesEcwayt
 
2014 ieee project java titles
2014 ieee project java titles2014 ieee project java titles
2014 ieee project java titlesEcwaytechnoz
 

Similar to 2013 ieee java project titles (20)

2013 ieee .net project titles
2013 ieee .net project titles2013 ieee .net project titles
2013 ieee .net project titles
 
2013 2014 bulk ieee projects
2013 2014 bulk ieee projects2013 2014 bulk ieee projects
2013 2014 bulk ieee projects
 
2014 ieee java project titles
2014 ieee java project titles2014 ieee java project titles
2014 ieee java project titles
 
2014 ieee java project titles
2014 ieee java project titles2014 ieee java project titles
2014 ieee java project titles
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titles
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titles
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titles
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titles
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titles
 
2014 ieee project dotnet titles
2014 ieee project dotnet titles2014 ieee project dotnet titles
2014 ieee project dotnet titles
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titles
 
2013 ieee project dotnet titles
2013 ieee project dotnet titles2013 ieee project dotnet titles
2013 ieee project dotnet titles
 
2014 ieee .net project titles
2014 ieee .net project titles2014 ieee .net project titles
2014 ieee .net project titles
 
2014 ieee .net project titles
2014 ieee .net project titles2014 ieee .net project titles
2014 ieee .net project titles
 
2013 ieee project java titles
2013 ieee project java titles2013 ieee project java titles
2013 ieee project java titles
 
2014 ieee project java titles
2014 ieee project java titles2014 ieee project java titles
2014 ieee project java titles
 
2013 ieee project java titles
2013 ieee project java titles2013 ieee project java titles
2013 ieee project java titles
 
2014 ieee project java titles
2014 ieee project java titles2014 ieee project java titles
2014 ieee project java titles
 
2013 ieee project java titles
2013 ieee project java titles2013 ieee project java titles
2013 ieee project java titles
 
2014 ieee project java titles
2014 ieee project java titles2014 ieee project java titles
2014 ieee project java titles
 

More from Ecwaytechnoz

Wheelztracker.pptx
Wheelztracker.pptxWheelztracker.pptx
Wheelztracker.pptxEcwaytechnoz
 
Coloring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networksColoring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networksEcwaytechnoz
 
Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...Ecwaytechnoz
 
Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...Ecwaytechnoz
 
Clustering large probabilistic graphs
Clustering large probabilistic graphsClustering large probabilistic graphs
Clustering large probabilistic graphsEcwaytechnoz
 
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim  t-drive enhancing driving directions with taxi drivers’ intelligenceCloudsim  t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligenceEcwaytechnoz
 
Cloudsim ranking on data manifold with sink points
Cloudsim  ranking on data manifold with sink pointsCloudsim  ranking on data manifold with sink points
Cloudsim ranking on data manifold with sink pointsEcwaytechnoz
 
Cloudsim quality-differentiated video multicast in multirate wireless networks
Cloudsim  quality-differentiated video multicast in multirate wireless networksCloudsim  quality-differentiated video multicast in multirate wireless networks
Cloudsim quality-differentiated video multicast in multirate wireless networksEcwaytechnoz
 
Cloudsim power allocation for statistical qo s provisioning in opportunistic...
Cloudsim  power allocation for statistical qo s provisioning in opportunistic...Cloudsim  power allocation for statistical qo s provisioning in opportunistic...
Cloudsim power allocation for statistical qo s provisioning in opportunistic...Ecwaytechnoz
 
Cloudsim distributed web systems performance forecasting using turning bands...
Cloudsim  distributed web systems performance forecasting using turning bands...Cloudsim  distributed web systems performance forecasting using turning bands...
Cloudsim distributed web systems performance forecasting using turning bands...Ecwaytechnoz
 
Cloudsim distributed processing of probabilistic top-k queries in wireless s...
Cloudsim  distributed processing of probabilistic top-k queries in wireless s...Cloudsim  distributed processing of probabilistic top-k queries in wireless s...
Cloudsim distributed processing of probabilistic top-k queries in wireless s...Ecwaytechnoz
 
Chopper based dc motor speed control
Chopper based dc motor speed controlChopper based dc motor speed control
Chopper based dc motor speed controlEcwaytechnoz
 
Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...Ecwaytechnoz
 
Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...Ecwaytechnoz
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoringEcwaytechnoz
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoringEcwaytechnoz
 
Capacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a psCapacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a psEcwaytechnoz
 
Bomb detection robot with wireless camera
Bomb detection robot with wireless cameraBomb detection robot with wireless camera
Bomb detection robot with wireless cameraEcwaytechnoz
 
Bed side patients monitoring system with emergency alert
Bed side patients monitoring system with  emergency alertBed side patients monitoring system with  emergency alert
Bed side patients monitoring system with emergency alertEcwaytechnoz
 

More from Ecwaytechnoz (20)

Wheelztracker.pptx
Wheelztracker.pptxWheelztracker.pptx
Wheelztracker.pptx
 
Coloring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networksColoring based inter-wban scheduling for mobile wireless body area networks
Coloring based inter-wban scheduling for mobile wireless body area networks
 
Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...Code modulation based encryption & decryption technique for secure communicat...
Code modulation based encryption & decryption technique for secure communicat...
 
Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...Clustering sentence level text using a novel fuzzy relational clustering algo...
Clustering sentence level text using a novel fuzzy relational clustering algo...
 
Clustering large probabilistic graphs
Clustering large probabilistic graphsClustering large probabilistic graphs
Clustering large probabilistic graphs
 
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim  t-drive enhancing driving directions with taxi drivers’ intelligenceCloudsim  t-drive enhancing driving directions with taxi drivers’ intelligence
Cloudsim t-drive enhancing driving directions with taxi drivers’ intelligence
 
Cloudsim ranking on data manifold with sink points
Cloudsim  ranking on data manifold with sink pointsCloudsim  ranking on data manifold with sink points
Cloudsim ranking on data manifold with sink points
 
Cloudsim quality-differentiated video multicast in multirate wireless networks
Cloudsim  quality-differentiated video multicast in multirate wireless networksCloudsim  quality-differentiated video multicast in multirate wireless networks
Cloudsim quality-differentiated video multicast in multirate wireless networks
 
Cloudsim power allocation for statistical qo s provisioning in opportunistic...
Cloudsim  power allocation for statistical qo s provisioning in opportunistic...Cloudsim  power allocation for statistical qo s provisioning in opportunistic...
Cloudsim power allocation for statistical qo s provisioning in opportunistic...
 
Cloudsim distributed web systems performance forecasting using turning bands...
Cloudsim  distributed web systems performance forecasting using turning bands...Cloudsim  distributed web systems performance forecasting using turning bands...
Cloudsim distributed web systems performance forecasting using turning bands...
 
Cloudsim distributed processing of probabilistic top-k queries in wireless s...
Cloudsim  distributed processing of probabilistic top-k queries in wireless s...Cloudsim  distributed processing of probabilistic top-k queries in wireless s...
Cloudsim distributed processing of probabilistic top-k queries in wireless s...
 
Civil 2013 titles
Civil 2013 titlesCivil 2013 titles
Civil 2013 titles
 
Chopper based dc motor speed control
Chopper based dc motor speed controlChopper based dc motor speed control
Chopper based dc motor speed control
 
Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...Channel assignment for throughput optimization in multichannel multiradio wir...
Channel assignment for throughput optimization in multichannel multiradio wir...
 
Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...Channel allocation and routing in hybrid multichannel multiradio wireless mes...
Channel allocation and routing in hybrid multichannel multiradio wireless mes...
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoring
 
Casual stereoscopic photo authoring
Casual stereoscopic photo authoringCasual stereoscopic photo authoring
Casual stereoscopic photo authoring
 
Capacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a psCapacity of hybrid wireless mesh networks with random a ps
Capacity of hybrid wireless mesh networks with random a ps
 
Bomb detection robot with wireless camera
Bomb detection robot with wireless cameraBomb detection robot with wireless camera
Bomb detection robot with wireless camera
 
Bed side patients monitoring system with emergency alert
Bed side patients monitoring system with  emergency alertBed side patients monitoring system with  emergency alert
Bed side patients monitoring system with emergency alert
 

Recently uploaded

Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024BookNet Canada
 
"LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks...
"LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks..."LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks...
"LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks...Fwdays
 
Science&tech:THE INFORMATION AGE STS.pdf
Science&tech:THE INFORMATION AGE STS.pdfScience&tech:THE INFORMATION AGE STS.pdf
Science&tech:THE INFORMATION AGE STS.pdfjimielynbastida
 
Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024Scott Keck-Warren
 
Snow Chain-Integrated Tire for a Safe Drive on Winter Roads
Snow Chain-Integrated Tire for a Safe Drive on Winter RoadsSnow Chain-Integrated Tire for a Safe Drive on Winter Roads
Snow Chain-Integrated Tire for a Safe Drive on Winter RoadsHyundai Motor Group
 
Pigging Solutions Piggable Sweeping Elbows
Pigging Solutions Piggable Sweeping ElbowsPigging Solutions Piggable Sweeping Elbows
Pigging Solutions Piggable Sweeping ElbowsPigging Solutions
 
Are Multi-Cloud and Serverless Good or Bad?
Are Multi-Cloud and Serverless Good or Bad?Are Multi-Cloud and Serverless Good or Bad?
Are Multi-Cloud and Serverless Good or Bad?Mattias Andersson
 
CloudStudio User manual (basic edition):
CloudStudio User manual (basic edition):CloudStudio User manual (basic edition):
CloudStudio User manual (basic edition):comworks
 
Connect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck PresentationConnect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck PresentationSlibray Presentation
 
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 3652toLead Limited
 
Key Features Of Token Development (1).pptx
Key  Features Of Token  Development (1).pptxKey  Features Of Token  Development (1).pptx
Key Features Of Token Development (1).pptxLBM Solutions
 
Unlocking the Potential of the Cloud for IBM Power Systems
Unlocking the Potential of the Cloud for IBM Power SystemsUnlocking the Potential of the Cloud for IBM Power Systems
Unlocking the Potential of the Cloud for IBM Power SystemsPrecisely
 
SQL Database Design For Developers at php[tek] 2024
SQL Database Design For Developers at php[tek] 2024SQL Database Design For Developers at php[tek] 2024
SQL Database Design For Developers at php[tek] 2024Scott Keck-Warren
 
Understanding the Laravel MVC Architecture
Understanding the Laravel MVC ArchitectureUnderstanding the Laravel MVC Architecture
Understanding the Laravel MVC ArchitecturePixlogix Infotech
 
Streamlining Python Development: A Guide to a Modern Project Setup
Streamlining Python Development: A Guide to a Modern Project SetupStreamlining Python Development: A Guide to a Modern Project Setup
Streamlining Python Development: A Guide to a Modern Project SetupFlorian Wilhelm
 
Enhancing Worker Digital Experience: A Hands-on Workshop for Partners
Enhancing Worker Digital Experience: A Hands-on Workshop for PartnersEnhancing Worker Digital Experience: A Hands-on Workshop for Partners
Enhancing Worker Digital Experience: A Hands-on Workshop for PartnersThousandEyes
 
Kotlin Multiplatform & Compose Multiplatform - Starter kit for pragmatics
Kotlin Multiplatform & Compose Multiplatform - Starter kit for pragmaticsKotlin Multiplatform & Compose Multiplatform - Starter kit for pragmatics
Kotlin Multiplatform & Compose Multiplatform - Starter kit for pragmaticsAndrey Dotsenko
 
Build your next Gen AI Breakthrough - April 2024
Build your next Gen AI Breakthrough - April 2024Build your next Gen AI Breakthrough - April 2024
Build your next Gen AI Breakthrough - April 2024Neo4j
 

Recently uploaded (20)

Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024
Transcript: New from BookNet Canada for 2024: BNC BiblioShare - Tech Forum 2024
 
"LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks...
"LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks..."LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks...
"LLMs for Python Engineers: Advanced Data Analysis and Semantic Kernel",Oleks...
 
Science&tech:THE INFORMATION AGE STS.pdf
Science&tech:THE INFORMATION AGE STS.pdfScience&tech:THE INFORMATION AGE STS.pdf
Science&tech:THE INFORMATION AGE STS.pdf
 
Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024Advanced Test Driven-Development @ php[tek] 2024
Advanced Test Driven-Development @ php[tek] 2024
 
Snow Chain-Integrated Tire for a Safe Drive on Winter Roads
Snow Chain-Integrated Tire for a Safe Drive on Winter RoadsSnow Chain-Integrated Tire for a Safe Drive on Winter Roads
Snow Chain-Integrated Tire for a Safe Drive on Winter Roads
 
Pigging Solutions Piggable Sweeping Elbows
Pigging Solutions Piggable Sweeping ElbowsPigging Solutions Piggable Sweeping Elbows
Pigging Solutions Piggable Sweeping Elbows
 
Vulnerability_Management_GRC_by Sohang Sengupta.pptx
Vulnerability_Management_GRC_by Sohang Sengupta.pptxVulnerability_Management_GRC_by Sohang Sengupta.pptx
Vulnerability_Management_GRC_by Sohang Sengupta.pptx
 
Are Multi-Cloud and Serverless Good or Bad?
Are Multi-Cloud and Serverless Good or Bad?Are Multi-Cloud and Serverless Good or Bad?
Are Multi-Cloud and Serverless Good or Bad?
 
E-Vehicle_Hacking_by_Parul Sharma_null_owasp.pptx
E-Vehicle_Hacking_by_Parul Sharma_null_owasp.pptxE-Vehicle_Hacking_by_Parul Sharma_null_owasp.pptx
E-Vehicle_Hacking_by_Parul Sharma_null_owasp.pptx
 
CloudStudio User manual (basic edition):
CloudStudio User manual (basic edition):CloudStudio User manual (basic edition):
CloudStudio User manual (basic edition):
 
Connect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck PresentationConnect Wave/ connectwave Pitch Deck Presentation
Connect Wave/ connectwave Pitch Deck Presentation
 
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
Tech-Forward - Achieving Business Readiness For Copilot in Microsoft 365
 
Key Features Of Token Development (1).pptx
Key  Features Of Token  Development (1).pptxKey  Features Of Token  Development (1).pptx
Key Features Of Token Development (1).pptx
 
Unlocking the Potential of the Cloud for IBM Power Systems
Unlocking the Potential of the Cloud for IBM Power SystemsUnlocking the Potential of the Cloud for IBM Power Systems
Unlocking the Potential of the Cloud for IBM Power Systems
 
SQL Database Design For Developers at php[tek] 2024
SQL Database Design For Developers at php[tek] 2024SQL Database Design For Developers at php[tek] 2024
SQL Database Design For Developers at php[tek] 2024
 
Understanding the Laravel MVC Architecture
Understanding the Laravel MVC ArchitectureUnderstanding the Laravel MVC Architecture
Understanding the Laravel MVC Architecture
 
Streamlining Python Development: A Guide to a Modern Project Setup
Streamlining Python Development: A Guide to a Modern Project SetupStreamlining Python Development: A Guide to a Modern Project Setup
Streamlining Python Development: A Guide to a Modern Project Setup
 
Enhancing Worker Digital Experience: A Hands-on Workshop for Partners
Enhancing Worker Digital Experience: A Hands-on Workshop for PartnersEnhancing Worker Digital Experience: A Hands-on Workshop for Partners
Enhancing Worker Digital Experience: A Hands-on Workshop for Partners
 
Kotlin Multiplatform & Compose Multiplatform - Starter kit for pragmatics
Kotlin Multiplatform & Compose Multiplatform - Starter kit for pragmaticsKotlin Multiplatform & Compose Multiplatform - Starter kit for pragmatics
Kotlin Multiplatform & Compose Multiplatform - Starter kit for pragmatics
 
Build your next Gen AI Breakthrough - April 2024
Build your next Gen AI Breakthrough - April 2024Build your next Gen AI Breakthrough - April 2024
Build your next Gen AI Breakthrough - April 2024
 

2013 ieee java project titles

  • 1. ECWAY TECHNOLOGIES IEEE PROJECTS & SOFTWARE DEVELOPMENTS OUR OFFICES @ CHENNAI / TRICHY / KARUR / ERODE / MADURAI / SALEM / COIMBATORE BANGALORE / HYDRABAD CELL: +91 98949 17187, +91 875487 1111 / 2111 / 3111 / 4111 / 5111 / 6111 / 8111 Visit: www.ecwayprojects.com Mail to: ecwaytechnologies@gmail.com 2013 IEEE PROJECT JAVA TITLES DOMAIN: MOBILE COMPUTING Distributed Cooperative Caching in Social Wireless Networks Power Allocation for Statistical QoS Provisioning in Opportunistic Multi-Relay DF Cognitive Networks Pulse Switching Toward a Packet-Less Protocol Paradigm for Event Sensing EMAP Expedite Message Authentication Protocol for Vehicular Ad Hoc Networks Dynamic Coverage of Mobile Sensor Networks A Scalable Server Architecture for Mobile Presence Services in Social Network Applications Mobile Relay Configuration in Data-Intensive Wireless Sensor Networks A Resource Allocation Scheme for Scalable Video Multicast in WiMAX Relay Networks Quality-Differentiated Video Multicast in Multirate Wireless Networks SinkTrail A Proactive Data Reporting Protocol for Wireless Sensor Networks Target Tracking and Mobile Sensor Navigation in Wireless Sensor Networks Toward Privacy Preserving and Collusion Resistance in a Location Proof Updating System On the Real-Time Hardware Implementation Feasibility of Joint Radio Resource Management Policies for
  • 2. Heterogeneous Wireless Networks Toward a Statistical Framework for Source Anonymity in Sensor Networks On Centralized and Localized Approximation Algorithms for Interference-Aware Broadcast Scheduling Model-Based Analysis of Wireless System Architectures for Real-Time Applications Capacity of Hybrid Wireless Mesh Networks with Random APs Delay-Optimal Broadcast for Multihop Wireless Networks Using Self-Interference Cancellation Vampire Attacks: Draining Life from Wireless Ad Hoc Sensor Networks Group-Based Medium Access Control for IEEE 802.11n Wireless LANs Cross-Layer Design of Congestion Control and Power Control in Fast-Fading Wireless Networks Analysis of Distance-Based Location Management in Wireless Communication Networks Fast Channel Zapping with Destination-Oriented Multicast for IP Video Delivery Exploiting Ubiquitous Data Collection for Mobile Users in Wireless Sensor Networks Jamming Games in the MIMO Wiretap Channel With an Active Eavesdropper DOMAIN: WIRELESS NETWORK PROJECTS A Data Fusion Technique for Wireless Ranging Performance Improvement Channel Allocation and Routing in Hybrid Multichannel Multiradio Wireless Mesh Networks Fast Transmission to Remote Cooperative Groups a New Key Management Paradigm Modeling and Optimizing the Performance- Security Tradeoff on D-NCS Using the Coevolutionary Paradigm Privacy-Preserving Distributed Profile Matching in Proximity-Based Mobile Social Networks Efficient Two-Server Password-Only Authenticated Key Exchange Channel Assignment for Throughput Optimization in Multichannel Multiradio Wireless Mesh Networks Using Network Coding
  • 3. DOMAIN: NETWORK SECURITY PROJECTS EAACK—A Secure Intrusion-Detection System for MANETs NICE Network Intrusion Detection and Countermeasure Selection in Virtual Network Systems Entrusting Private Computation and Data to Untrusted Networks Security Analysis of a Single Sign-On Mechanism for Distributed Computer Networks DOMAIN: DATA MINING (Data Engineering) PMSE A Personalized Mobile Search Engine Fully Anonymous Profile Matching in Mobile Social Networks A Fast Clustering-Based Feature Subset Selection Algorithm for High-Dimensional Data A Survey of XML Tree Patterns Automatic Semantic Content Extraction in Videos Using a Fuzzy Ontology and Rule-Based Model Distributed Processing of Probabilistic Top-k Queries in Wireless Sensor Networks Distributed Web Systems Performance Forecasting Using Turning Bands Method Maximum Likelihood Estimation from Uncertain Data in the Belief Function Framework Ranking on Data Manifold with Sink Points Region-Based Foldings in Process Discovery Relationships between Diversity of Classification Ensembles and Single-Class Performance Measures T-Drive Enhancing Driving Directions with Taxi Drivers’ Intelligence AML: Efficient Approximate Membership Localization within a Web-Based Join Framework Efficient Algorithms for Mining High Utility Itemsets from Transactional Databases Optimizing Multi-Top-k Queries over Uncertain Data Streams A System to Filter Unwanted Messages from OSN User Walls
  • 4. DOMAIN: CLOUD COMPUTING Toward Secure Multi-keyword Top-k Retrieval over Encrypted Cloud Data Privacy-Preserving Public Auditing for Secure Cloud Storage Optimizing Cloud Resources for Delivering IPTV Services through Virtualization Mona: Secure Multi-Owner Data Sharing for Dynamic Groups in the Cloud Optimal Multiserver Configuration for Profit Maximization in Cloud Computing Dynamic Resource Allocation Using Virtual Machines for Cloud Computing Environment CAM: Cloud-Assisted Privacy Preserving Mobile Health Monitoring AMES-Cloud: A Framework of Adaptive Mobile Video Streaming and Efficient Social Video Sharing in the Clouds CloudMoV Cloud-Based Mobile Social TV DOMAIN: PARALLEL & DISTRIBUTED COMPUTING Network Traffic Classification Using Correlation Information Scalable and Secure Sharing of Personal Health Records in Cloud Computing Using Attribute-Based Encryption Adaptive Network Coding for Broadband Wireless Access Networks Detection and Localization of Multiple Spoofing Attackers in Wireless Networks Online Real-Time Task Scheduling in Heterogeneous Multicore System-on-a-Chip Covering Points of Interest with Mobile Sensors High Performance Resource Allocation Strategies for Computational Economies Strategies for Energy-Efficient Resource Management of Hybrid Programming Models Multimedia Fusion With Mean-Covariance Analysis