SlideShare a Scribd company logo
1 of 109
Hadoop for Bioinformatics
                       Deepak Singh
                    Amazon Web Services




Hadoop World, NYC
Via Reavel under a CC-BY-NC-ND license
By ~Prescott under a CC-BY-NC license
data sets
many data sets
PFAM                                PDB




       GENBANK                 ENSEMBL




                 Many Others
manageable
Image: Matt Wood
Human
                   genom
                   e




Image: Matt Wood
Image: Matt Wood
~100 TB/Week
Image: Matt Wood
~100 TB/Week
                       >2 PB/Year
Image: Matt Wood
years
days
hours
gigabytes
terabytes
petabytes
really fast
typical informatics workflow
Via Christolakis under a CC-BY-NC-ND license
Via Argonne National Labs under a CC-BY-SA license
killer app




Via Argonne National Labs under a CC-BY-SA license
Via asklar under a CC-BY license
Image: Chris Dagdigian
rethink algorithms
rethink computing
rethink data management
rethink data sharing
operational mindset
scalability
we are data geeks not data center geeks
two key trends
develop applications
distribute applications
use applications
some work
filters
some work
   ^
High Throughput Sequence Analysis
Mike Schatz, University of Maryland
• Read Mapping
• Mapping & SNP Discovery
• De novo Genome Assembly
Short Read Mapping
Asian Individual Genome: 3.3 Billion 35bp, 104
GB (Wang et al., 2008)

African Individual Genome: 4.0 Billion 35bp, 144
GB (Bentley et al., 2008)
Alignment > 10000 CPU hrs
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)



          Expensive to scale
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)



          Expensive to scale
Seed & Extend
Good alignments must have significant
exact alignment

Minimal exact alignment length = l/(k+1)



          Expensive to scale

  Need parallelization framework
CloudBurst




Catalog k-mers     Collect seeds   End-to-end alignment
http://cloudburst-bio.sourceforge.net; Bioinformatics 2009 25: 1363-1369
CloudBurst efficiently reports every k-difference
           alignment of every read
many applications only need the best alignment
Bowtie: Ultrafast short read aligner




Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human
genome. Genome Biol 10 (3): R25.
SOAPSnp: Consensus alignment and SNP calling




Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human
genome. Genome Biol 10 (3): R25.
Crossbow: Rapid whole genome SNP analysis



                                                                                                       Ben Langmead




Langmead B, Trapnell C, Pop M, Salzberg SL. Ultrafast and memory-efficient alignment of short DNA sequences to the human
genome. Genome Biol 10 (3): R25.
Preprocessed reads
Preprocessed reads



   Map: Bowtie
Preprocessed reads



     Map: Bowtie



Sort: Bin and partition
Preprocessed reads



     Map: Bowtie



Sort: Bin and partition


  Reduce: SoapSNP
Crossbow condenses over 1,000 hours
of resequencing computation into a few
hours without requiring the user to own
or operate a computer cluster
Comparing Genomes
Estimating relative evolutionary rates
           from sequence comparisons:
                Identification of probable orthologs
                              Admissible comparisons:       A or B vs. D
                                                            C vs. E
                              Inadmissible comparisons:    A or B vs. E
                                                           C vs. D




 A B C                      D    E                         species tree
                                                          gene tree
S. cerevisiae               C. elegans
Estimating relative evolutionary rates
           from sequence comparisons:
                          1. Orthologs found using the Reciprocal
                          smallest distance algorithm
                          2. Build alignment between two orthologs
                          >Sequence C
                          MSGRTILASTIAKPFQEEVTKAVKQLNFT-----PKLVGLLSNEDPAAKMYANWTGKTCESLGFKYEL-…
                          >Sequence E
                          MSGRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYDL…




                          3. Estimate distance given a substitution
                          matrix
                                                        Phe Ala Pro Leu Thr
                                                      Phe
                                                      Ala µπ
                                                      Pro µπ µπ µπ
                                                      Leu µπ µπ µπ µπ




 A B C              D    E                                                     species tree
                                                                              gene tree
S. cerevisiae       C. elegans
RSD algorithm summary
 Genome I                                            Genome J


                          Ib                                     Jc

  Align sequences &
  Calculate distances          L     Orthologs:
                                                     Align sequences &
                                                     Calculate distances          H
                                   ib - jc D = 0.1
    c
        vs.       D=1.2                                    vs.            D=0.2
              a                                        b              a
        vs.       D=0.1                                    vs.            D=0.3
    c         b                                        b              b
        vs.       D=0.9                                    vs.            D=0.1
    c         c                                        b              c
Prof. Dennis Wall
Harvard Medical School
Roundup is a database of orthologs
and their evolutionary distances.
To get started, click browse. Alternatively, you can
read our documentation here.
Good luck, researchers!
massive computational demand
1000 genomes = 5,994,000 processes =
         23,976,000 hours
2737 years
periodic task
must scale up
not scalability gurus
hadoop streaming
compared 50+ genomes
what’s next?
de novo assembly
machine learning and statistics
protein structure prediction
docking
trajectory analysis
key driving factors?
the ecosystem
Pig
Cascading
Hive
RHIPE
domain specific libraries and tools
http://aws.amazon.com/publicdatasets/
http://aws.amazon.com/education/
Thank you!




     deesingh@amazon.com; Twitter:@mndoci
Presentation ideas from @mza, @simon and @lessig

More Related Content

Viewers also liked

VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...Universal Weather and Aviation, Inc.
 
Eurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results PresentationEurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results PresentationCompany Spotlight
 
Investigación Operativa 1
Investigación Operativa 1Investigación Operativa 1
Investigación Operativa 1oscarugaz
 
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...Shashi Kant
 
Vision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrialsVision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrialsnorbelisgoyo
 
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2YamahaXS400
 
Transfer factor3g bienestar es verde
Transfer factor3g   bienestar es verdeTransfer factor3g   bienestar es verde
Transfer factor3g bienestar es verdeTransferFactor3G
 
An Integral Model of Human Resilience in Technological Systems (6.15)
An Integral Model of Human Resilience in Technological Systems (6.15)An Integral Model of Human Resilience in Technological Systems (6.15)
An Integral Model of Human Resilience in Technological Systems (6.15)Johnny Thomas, MSEE, MBA
 
Presentació Patufet
Presentació PatufetPresentació Patufet
Presentació Patufetgovern balear
 
Bioinformatics Final Report
Bioinformatics Final ReportBioinformatics Final Report
Bioinformatics Final ReportShruthi Choudary
 
Anxyolitics& hypnotics
Anxyolitics& hypnoticsAnxyolitics& hypnotics
Anxyolitics& hypnoticsraj kumar
 

Viewers also liked (19)

Banner
BannerBanner
Banner
 
ABAEvents - Presentación comercial
ABAEvents - Presentación comercialABAEvents - Presentación comercial
ABAEvents - Presentación comercial
 
Design fax 951 | Les gros mots du design | ShowDesign
Design fax 951 | Les gros mots du design | ShowDesignDesign fax 951 | Les gros mots du design | ShowDesign
Design fax 951 | Les gros mots du design | ShowDesign
 
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
VIDP Ground Handling Agent in New Delhi, India - Indira Gandhi International ...
 
Auditores
AuditoresAuditores
Auditores
 
Eurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results PresentationEurazeo 2012 Annual Results Presentation
Eurazeo 2012 Annual Results Presentation
 
Job Search-RD2B February 2016
Job Search-RD2B February 2016Job Search-RD2B February 2016
Job Search-RD2B February 2016
 
Investigación Operativa 1
Investigación Operativa 1Investigación Operativa 1
Investigación Operativa 1
 
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
Ind. Eng. Chem. Res. 2009, 48, 4866–4871_Synthesis of Ultrahigh Molecular Wei...
 
Envases galotto chile
Envases galotto chileEnvases galotto chile
Envases galotto chile
 
Brochure Torre UNIKA Virrey
Brochure Torre UNIKA VirreyBrochure Torre UNIKA Virrey
Brochure Torre UNIKA Virrey
 
Vision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrialsVision sistematica de las relaciones industrials
Vision sistematica de las relaciones industrials
 
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
YAMAHA XS 400 1982 - service manual_chapter3_engine_overhaul_part2
 
Transfer factor3g bienestar es verde
Transfer factor3g   bienestar es verdeTransfer factor3g   bienestar es verde
Transfer factor3g bienestar es verde
 
An Integral Model of Human Resilience in Technological Systems (6.15)
An Integral Model of Human Resilience in Technological Systems (6.15)An Integral Model of Human Resilience in Technological Systems (6.15)
An Integral Model of Human Resilience in Technological Systems (6.15)
 
Presentació Patufet
Presentació PatufetPresentació Patufet
Presentació Patufet
 
Nichia product catalogue
Nichia product catalogueNichia product catalogue
Nichia product catalogue
 
Bioinformatics Final Report
Bioinformatics Final ReportBioinformatics Final Report
Bioinformatics Final Report
 
Anxyolitics& hypnotics
Anxyolitics& hypnoticsAnxyolitics& hypnotics
Anxyolitics& hypnotics
 

Similar to Hadoop for Bioinformatics

2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizona2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizonac.titus.brown
 
SyMAP Master's Thesis Presentation
SyMAP Master's Thesis PresentationSyMAP Master's Thesis Presentation
SyMAP Master's Thesis Presentationaustinps
 
2014 anu-canberra-streaming
2014 anu-canberra-streaming2014 anu-canberra-streaming
2014 anu-canberra-streamingc.titus.brown
 
R Analytics in the Cloud
R Analytics in the CloudR Analytics in the Cloud
R Analytics in the CloudDataMine Lab
 
Talk ABRF 2015 (Gunnar Rätsch)
Talk ABRF 2015 (Gunnar Rätsch)Talk ABRF 2015 (Gunnar Rätsch)
Talk ABRF 2015 (Gunnar Rätsch)Gunnar Rätsch
 
The wheat genome sequence: a foundation for accelerating improvment of bread ...
The wheat genome sequence: a foundation for accelerating improvment of bread ...The wheat genome sequence: a foundation for accelerating improvment of bread ...
The wheat genome sequence: a foundation for accelerating improvment of bread ...Borlaug Global Rust Initiative
 
2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptx2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptxc.titus.brown
 
20131019 生物物理若手 Journal Club
20131019 生物物理若手 Journal Club20131019 生物物理若手 Journal Club
20131019 生物物理若手 Journal ClubMed_KU
 
2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issuesDongyan Zhao
 
Genome rearrangment
Genome rearrangmentGenome rearrangment
Genome rearrangmentDiya Khan
 
Igor Segota: PhD thesis presentation
Igor Segota: PhD thesis presentationIgor Segota: PhD thesis presentation
Igor Segota: PhD thesis presentationIgorSegota3
 
Structure based computer aided drug design
Structure based computer aided drug designStructure based computer aided drug design
Structure based computer aided drug designThanh Truong
 
DESeq Paper Journal club
DESeq Paper Journal club DESeq Paper Journal club
DESeq Paper Journal club avrilcoghlan
 
DNA cell cycle by flow cytometry
DNA cell cycle by flow cytometryDNA cell cycle by flow cytometry
DNA cell cycle by flow cytometryRichard Hastings
 
RNA-seq: general concept, goal and experimental design - part 1
RNA-seq: general concept, goal and experimental design - part 1RNA-seq: general concept, goal and experimental design - part 1
RNA-seq: general concept, goal and experimental design - part 1BITS
 
ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"nozyh
 

Similar to Hadoop for Bioinformatics (20)

2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizona2012 talk to CSE department at U. Arizona
2012 talk to CSE department at U. Arizona
 
SyMAP Master's Thesis Presentation
SyMAP Master's Thesis PresentationSyMAP Master's Thesis Presentation
SyMAP Master's Thesis Presentation
 
2014 anu-canberra-streaming
2014 anu-canberra-streaming2014 anu-canberra-streaming
2014 anu-canberra-streaming
 
R Analytics in the Cloud
R Analytics in the CloudR Analytics in the Cloud
R Analytics in the Cloud
 
2013 duke-talk
2013 duke-talk2013 duke-talk
2013 duke-talk
 
Talk ABRF 2015 (Gunnar Rätsch)
Talk ABRF 2015 (Gunnar Rätsch)Talk ABRF 2015 (Gunnar Rätsch)
Talk ABRF 2015 (Gunnar Rätsch)
 
The wheat genome sequence: a foundation for accelerating improvment of bread ...
The wheat genome sequence: a foundation for accelerating improvment of bread ...The wheat genome sequence: a foundation for accelerating improvment of bread ...
The wheat genome sequence: a foundation for accelerating improvment of bread ...
 
2015 osu-metagenome
2015 osu-metagenome2015 osu-metagenome
2015 osu-metagenome
 
2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptx2013 stamps-assembly-methods.pptx
2013 stamps-assembly-methods.pptx
 
20131019 生物物理若手 Journal Club
20131019 生物物理若手 Journal Club20131019 生物物理若手 Journal Club
20131019 生物物理若手 Journal Club
 
2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues2015.04.08-Next-generation-sequencing-issues
2015.04.08-Next-generation-sequencing-issues
 
2012 oslo-talk
2012 oslo-talk2012 oslo-talk
2012 oslo-talk
 
Genome rearrangment
Genome rearrangmentGenome rearrangment
Genome rearrangment
 
Igor Segota: PhD thesis presentation
Igor Segota: PhD thesis presentationIgor Segota: PhD thesis presentation
Igor Segota: PhD thesis presentation
 
2015 illinois-talk
2015 illinois-talk2015 illinois-talk
2015 illinois-talk
 
Structure based computer aided drug design
Structure based computer aided drug designStructure based computer aided drug design
Structure based computer aided drug design
 
DESeq Paper Journal club
DESeq Paper Journal club DESeq Paper Journal club
DESeq Paper Journal club
 
DNA cell cycle by flow cytometry
DNA cell cycle by flow cytometryDNA cell cycle by flow cytometry
DNA cell cycle by flow cytometry
 
RNA-seq: general concept, goal and experimental design - part 1
RNA-seq: general concept, goal and experimental design - part 1RNA-seq: general concept, goal and experimental design - part 1
RNA-seq: general concept, goal and experimental design - part 1
 
ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"ACL読み会2014@PFI "Less Grammar, More Features"
ACL読み会2014@PFI "Less Grammar, More Features"
 

More from Deepak Singh

Intel Theater Presentation - SC11
Intel Theater Presentation - SC11Intel Theater Presentation - SC11
Intel Theater Presentation - SC11Deepak Singh
 
Talk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource DirectorsTalk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource DirectorsDeepak Singh
 
Platforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the BrinkPlatforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the BrinkDeepak Singh
 
High Performance Cloud Computing
High Performance Cloud ComputingHigh Performance Cloud Computing
High Performance Cloud ComputingDeepak Singh
 
High Performance Cloud Computing
High Performance Cloud ComputingHigh Performance Cloud Computing
High Performance Cloud ComputingDeepak Singh
 
Systems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop KeynoteSystems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop KeynoteDeepak Singh
 
Talk at NCRR P41 Director's Meeting
Talk at NCRR P41 Director's MeetingTalk at NCRR P41 Director's Meeting
Talk at NCRR P41 Director's MeetingDeepak Singh
 
Platforms for data science
Platforms for data sciencePlatforms for data science
Platforms for data scienceDeepak Singh
 
Discovery 2015 Workshop
Discovery 2015 WorkshopDiscovery 2015 Workshop
Discovery 2015 WorkshopDeepak Singh
 
Bio-IT World 2010 - Keynote talk
Bio-IT World 2010 - Keynote talkBio-IT World 2010 - Keynote talk
Bio-IT World 2010 - Keynote talkDeepak Singh
 
Talk at Microsoft Cloud Futures 2010
Talk at Microsoft Cloud Futures 2010Talk at Microsoft Cloud Futures 2010
Talk at Microsoft Cloud Futures 2010Deepak Singh
 
NHGRI Cloud Computing talk
NHGRI Cloud Computing talkNHGRI Cloud Computing talk
NHGRI Cloud Computing talkDeepak Singh
 
Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010Deepak Singh
 
Masterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale scienceMasterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale scienceDeepak Singh
 
Talk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshopTalk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshopDeepak Singh
 
Big Data & the networked future of Science (at Ignite Seattle 7)
Big Data & the networked future of Science (at Ignite Seattle 7)Big Data & the networked future of Science (at Ignite Seattle 7)
Big Data & the networked future of Science (at Ignite Seattle 7)Deepak Singh
 
Science Big, Science Connected
Science Big, Science ConnectedScience Big, Science Connected
Science Big, Science ConnectedDeepak Singh
 
Bioscreencast: Capturing the life sciences frame by frame
Bioscreencast: Capturing the life sciences frame by frameBioscreencast: Capturing the life sciences frame by frame
Bioscreencast: Capturing the life sciences frame by frameDeepak Singh
 

More from Deepak Singh (20)

Intel Theater Presentation - SC11
Intel Theater Presentation - SC11Intel Theater Presentation - SC11
Intel Theater Presentation - SC11
 
Talk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource DirectorsTalk at West Coast Association of Shared Resource Directors
Talk at West Coast Association of Shared Resource Directors
 
Platforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the BrinkPlatforms for Data Science - Computing on the Brink
Platforms for Data Science - Computing on the Brink
 
High Performance Cloud Computing
High Performance Cloud ComputingHigh Performance Cloud Computing
High Performance Cloud Computing
 
#arseniclife
#arseniclife#arseniclife
#arseniclife
 
High Performance Cloud Computing
High Performance Cloud ComputingHigh Performance Cloud Computing
High Performance Cloud Computing
 
Systems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop KeynoteSystems Bioinformatics Workshop Keynote
Systems Bioinformatics Workshop Keynote
 
Talk at NCRR P41 Director's Meeting
Talk at NCRR P41 Director's MeetingTalk at NCRR P41 Director's Meeting
Talk at NCRR P41 Director's Meeting
 
Platforms for data science
Platforms for data sciencePlatforms for data science
Platforms for data science
 
Discovery 2015 Workshop
Discovery 2015 WorkshopDiscovery 2015 Workshop
Discovery 2015 Workshop
 
Bio-IT World 2010 - Keynote talk
Bio-IT World 2010 - Keynote talkBio-IT World 2010 - Keynote talk
Bio-IT World 2010 - Keynote talk
 
Talk at Microsoft Cloud Futures 2010
Talk at Microsoft Cloud Futures 2010Talk at Microsoft Cloud Futures 2010
Talk at Microsoft Cloud Futures 2010
 
NHGRI Cloud Computing talk
NHGRI Cloud Computing talkNHGRI Cloud Computing talk
NHGRI Cloud Computing talk
 
Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010Plenary Talk at ACAT 2010
Plenary Talk at ACAT 2010
 
Masterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale scienceMasterworks talk on Big Data and the implications of petascale science
Masterworks talk on Big Data and the implications of petascale science
 
Talk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshopTalk given at "Cloud Computing for Systems Biology" workshop
Talk given at "Cloud Computing for Systems Biology" workshop
 
Big Data & the networked future of Science (at Ignite Seattle 7)
Big Data & the networked future of Science (at Ignite Seattle 7)Big Data & the networked future of Science (at Ignite Seattle 7)
Big Data & the networked future of Science (at Ignite Seattle 7)
 
Science Big, Science Connected
Science Big, Science ConnectedScience Big, Science Connected
Science Big, Science Connected
 
Bioscreencast: Capturing the life sciences frame by frame
Bioscreencast: Capturing the life sciences frame by frameBioscreencast: Capturing the life sciences frame by frame
Bioscreencast: Capturing the life sciences frame by frame
 
Searching Science
Searching ScienceSearching Science
Searching Science
 

Recently uploaded

presentation ICT roal in 21st century education
presentation ICT roal in 21st century educationpresentation ICT roal in 21st century education
presentation ICT roal in 21st century educationjfdjdjcjdnsjd
 
A Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source MilvusA Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source MilvusZilliz
 
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...Jeffrey Haguewood
 
Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024The Digital Insurer
 
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law DevelopmentsTrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law DevelopmentsTrustArc
 
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...apidays
 
Navi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot Model
Navi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot ModelNavi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot Model
Navi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot ModelDeepika Singh
 
Architecting Cloud Native Applications
Architecting Cloud Native ApplicationsArchitecting Cloud Native Applications
Architecting Cloud Native ApplicationsWSO2
 
FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024The Digital Insurer
 
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...DianaGray10
 
ICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesrafiqahmad00786416
 
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...apidays
 
"I see eyes in my soup": How Delivery Hero implemented the safety system for ...
"I see eyes in my soup": How Delivery Hero implemented the safety system for ..."I see eyes in my soup": How Delivery Hero implemented the safety system for ...
"I see eyes in my soup": How Delivery Hero implemented the safety system for ...Zilliz
 
MS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectorsMS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectorsNanddeep Nachan
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfsudhanshuwaghmare1
 
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemkeProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemkeProduct Anonymous
 
Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...
Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...
Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...apidays
 
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data DiscoveryTrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data DiscoveryTrustArc
 
Apidays Singapore 2024 - Modernizing Securities Finance by Madhu Subbu
Apidays Singapore 2024 - Modernizing Securities Finance by Madhu SubbuApidays Singapore 2024 - Modernizing Securities Finance by Madhu Subbu
Apidays Singapore 2024 - Modernizing Securities Finance by Madhu Subbuapidays
 

Recently uploaded (20)

presentation ICT roal in 21st century education
presentation ICT roal in 21st century educationpresentation ICT roal in 21st century education
presentation ICT roal in 21st century education
 
A Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source MilvusA Beginners Guide to Building a RAG App Using Open Source Milvus
A Beginners Guide to Building a RAG App Using Open Source Milvus
 
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
Web Form Automation for Bonterra Impact Management (fka Social Solutions Apri...
 
Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024Manulife - Insurer Transformation Award 2024
Manulife - Insurer Transformation Award 2024
 
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law DevelopmentsTrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
TrustArc Webinar - Stay Ahead of US State Data Privacy Law Developments
 
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
Apidays New York 2024 - The Good, the Bad and the Governed by David O'Neill, ...
 
Navi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot Model
Navi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot ModelNavi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot Model
Navi Mumbai Call Girls 🥰 8617370543 Service Offer VIP Hot Model
 
Architecting Cloud Native Applications
Architecting Cloud Native ApplicationsArchitecting Cloud Native Applications
Architecting Cloud Native Applications
 
FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024FWD Group - Insurer Innovation Award 2024
FWD Group - Insurer Innovation Award 2024
 
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
Connector Corner: Accelerate revenue generation using UiPath API-centric busi...
 
ICT role in 21st century education and its challenges
ICT role in 21st century education and its challengesICT role in 21st century education and its challenges
ICT role in 21st century education and its challenges
 
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
+971581248768>> SAFE AND ORIGINAL ABORTION PILLS FOR SALE IN DUBAI AND ABUDHA...
 
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
Apidays Singapore 2024 - Scalable LLM APIs for AI and Generative AI Applicati...
 
"I see eyes in my soup": How Delivery Hero implemented the safety system for ...
"I see eyes in my soup": How Delivery Hero implemented the safety system for ..."I see eyes in my soup": How Delivery Hero implemented the safety system for ...
"I see eyes in my soup": How Delivery Hero implemented the safety system for ...
 
MS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectorsMS Copilot expands with MS Graph connectors
MS Copilot expands with MS Graph connectors
 
Boost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdfBoost Fertility New Invention Ups Success Rates.pdf
Boost Fertility New Invention Ups Success Rates.pdf
 
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemkeProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
ProductAnonymous-April2024-WinProductDiscovery-MelissaKlemke
 
Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...
Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...
Apidays Singapore 2024 - Building Digital Trust in a Digital Economy by Veron...
 
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data DiscoveryTrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
TrustArc Webinar - Unlock the Power of AI-Driven Data Discovery
 
Apidays Singapore 2024 - Modernizing Securities Finance by Madhu Subbu
Apidays Singapore 2024 - Modernizing Securities Finance by Madhu SubbuApidays Singapore 2024 - Modernizing Securities Finance by Madhu Subbu
Apidays Singapore 2024 - Modernizing Securities Finance by Madhu Subbu
 

Hadoop for Bioinformatics