SlideShare a Scribd company logo
1 of 21
Download to read offline
Global Health Security:
Challenges and Progress in Pakistan
October 2018
Dr Assad Hafeez
Director General (Health)
 Emergence/re-emergence of infectious diseases and increased pace of spread
 Globalization – public health event in one location can be a threat to others
 Serious and unusual disease events are increasing and inevitable
 Threat of deliberate use of biological and chemical agents
 Laboratory and industrial accidents
 Impact on health, economy, security
Global Health Security: Why are we concerned?
Global Health Security: Why International Health Regulations matter?
 1830-1847: Efforts begins with cholera epidemics in Europe
 1851: First International Sanitary Conference, Paris
 1951: First International Sanitary Regulations adopted by WHA
 1969: Revised and renamed as International Health Regulations
 1995: Resolution WHA 48.7 called for revision of IHR
 1995 – 2005: 10 years of negotiations involving public health specialist, legal
experts, diplomats & political dignitaries
 2005: IHR - an international agreement that is legally binding on State
Parties/WHO Member States
 15 June 2007: Entry into force
Evolution of International Health Regulations
 Broader Scope - from 3 diseases to all public health threats
- from control of borders to containment at source
- from preset measures to adapted response
 Prevent, protect, and provide a public health response to the
international threat and spread of diseases
 Avoid unnecessary disruption of international travel & trade
 Applicable to health risks - irrespective of origin/ source
 Follow evolution of diseases and factors affecting their
emergence and transmission
Scope and Purpose of IHR 2005
 Global event management
– Global information system
– Coordination of international response
 Core capacity requirements
– Prevent: 7 core capacities
– Detect: 4 core capacities
– Respond: 4 core capacities
– Others: 3 core capacities
 Inter-sectoral approach
 State sovereignty & international spread of diseases
Key Areas of IHR Implementation
IHR Global Event Management
Inter-Sectoral Coordination for IHR
Security
Joint External Evaluation (JEE)
OBJECTIVES
1. Assess the implementation of
IHR capacities
2. Review all related documents
3. Develop a report describing the
progress and gaps
4. Recommend priority actions to
update and finalize the national
plan to achieve and maintain
IHR capacities
JEE History
 2014: WHA recommended to move from exclusive self evaluation to
combined self evaluation, peer review and volunteer external evaluation
 2015: Concept note discussed in WHO Regional Committee
 2015: Revised M&E Framework in the 69th WHA
 WHO developed a JEE tool
 2015: Pakistan volunteered as first country in EMR and
fourth globally for JEE
 2016: JEE conducted
 2017-18: National Action Plan on Health Security developed
 2018: First meeting of the National IHR Taskforce
A: PREVENT
1. National legislation, policy and
financing
2. IHR coordination,
communication and advocacy
3. Antimicrobial resistance
4. Zoonotic diseases
5. Food safety
6. Biosafety and
biosecurity
7. Immunization
IHR Core Capacities (measured through JEE)
B: DETECT
1. National laboratory system
2. Real-time surveillance
3. Reporting
4. Workforce development
C: RESPOND
1. Preparedness
2. Emergency response operations
3. Linking public health and
security authorities
4. Medical countermeasure and
personal deployment
5. Risk communication
IHR Core Capacities (measured through JEE)
D: OTHERS
1. Point of entry
2. Chemical events
3. Radiation emergencies
Reports on provinces and
federating areas
IHR Index for Pakistan
 Based on JEE (19 capacities and 48 indicators): 116/240 = 48.3%
 Reported Globally (13 core capacities) = 53%
Target: +80% (2030)
Target 2023: 60%
It is estimated that
41 million more people will be better protected from health
emergencies, in case Pakistan achieves IHR index of 60% by 2023
Global Target 2023: 1 Billion more people protected from health emergencies
Core Capacity wise Status
IHR Core
Capacity
Progress/Remarks
National
legislation policy
and financing
- "Pakistan Public Health Surveillance and Response Act 2010" available
- KP enacted public health act
- Federal/national act being finalized by NIH
Coordination
and NFP
Communications
- National Focal Point designated for IHR and GHSA
- Provincial focal points also notified
- A multi-sectoral and multi disciplinary task-force for IHR notified (One
health approach)
- IHR-NFP TORs developed
- NPHI development in progress
Core Capacity wise Status
IHR Core
Capacity
Progress/Remarks
Surveillance &
Response
- Disease specific multiple vertical programme engaged in surveillance
- Division of Field Epidemiology Disease Surveillance notified at NIH
- Communicable Disease data compiled at NIH for Alerts & Advisories
- Diseases Surveillance and Response Units established
- Disease prioritization exercise – List of diseases for surveillance
- Technical Working Group notified
- IDSRS framework developed – phase I to be launched
Preparedness - National Health Emergency Preparedness & Response Network (NHEPRN)
- NHEPRN in collaboration with WHO developed “preparedness and
contingency plan for the Communicable Disease”
- NIH to finalize pandemic preparedness plan and its implementation
Core Capacity wise Status
IHR Core
Capacity
Progress/Remarks
Risk
Communication
- Current coordination mechanism through "Health Clusters”
- Provincial focal person notified
Human
Resource
Capacity
- Around 125 Field Epidemiologist since 2007
- 90 under training (60 per year from 2016 onwards)
- Frontline launched (Shorter version)
Laboratory - NIH as referral laboratory and Multiple Lab based surveillance initiative
- BSL-3 functional
- National Laboratory Working Group (NLWG) notified
- Laboratory policy developed
- Provincial PH Labs being established
- Capacity building on cross cutting issues (BRM, LQMS, Info systems)
Core Capacity wise Status
IHR Core
Capacity
Progress/Remarks
AMR - Focal point notified
- Multi-sectoral/ multi disciplinary committee notified
- National AMR strategic framework and action paln developed
- Setting up sentinel surveillance using GLASS protocol
Biosafety &
biosecurity
- Assessment conducted
- National Biosafety/Biosecurity Policy endorsed
- Multiple trainings on BRM
EOC - Six EOC established (01 Federal, 4 provinces and 01 in FATA)
- Presently used only for polio
Immunization - Federal and provincial programmes in place
- GHSA grant with CDC for strengthening routine immunization
Core Capacity wise Status
IHR Core
Capacity
Progress/Remarks
Zoonotic
diseases
- Inclusion of animal and livestock sector professionals on different
forums including AMR, Laboratory system, Biosafety and Biosecurity,
Surveillance
- One health hub at NIH
- MoU with PARC & Global Change Impact study centre
Others - Food safety assessment mission conducted
- POEs assessment
- Trainings and capacity building
Key Challenges
 Functional multi-sectoral coordination between federal & provincial levels
through a joint IHR Task force;
 Implementation of 5 year costed National Action Plan on Health Security
for 19 technical areas against key priorities - Financing
 Establishment of surveillance & laboratory systems with a ‘One Health
Approach’ to include human and animal health sector
 Development of uniform regulatory standards in all areas of food security
 Comprehensive national cross-sectional approach towards Antimicrobial
Resistance (AMR)
Role of Security Agencies
 Active involvement of security agencies is a must, as health emergencies
have more serious implications (death, disease and disability - 3Ds with
No Borders along with Security & Economic loss) than actual warfare
 Deliberate use of biological, chemical and radiological agents should be
prevented, detected and responded at an early stage
 Developing IHR capacities both in civil sector and security agencies should
augment each others efforts
 Some capacities (radiation and chemical warfare) are largely the domain
of the security agencies (a need for an agreed role of civil sector)
 Poor IHR capacities in a country have a serious negative impact on
military defence preparedness
Thank you

More Related Content

Similar to GHSA and Progress in Pakistan 2018.pdf

national and states health care programs
national and states health care programs national and states health care programs
national and states health care programs Manish Kaushik
 
Thematic Platform for Emergency and Disaster Risk Management Health and the ...
Thematic Platform for Emergency and Disaster Risk Management Health and the ...Thematic Platform for Emergency and Disaster Risk Management Health and the ...
Thematic Platform for Emergency and Disaster Risk Management Health and the ...Global Risk Forum GRFDavos
 
One health approach in Public Health.pptx
One health approach in Public Health.pptxOne health approach in Public Health.pptx
One health approach in Public Health.pptxBalakrishnanRamanan1
 
finalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdffinalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdfjyothi132223
 
Final newer vaccines akhilesh ppt
Final newer vaccines akhilesh pptFinal newer vaccines akhilesh ppt
Final newer vaccines akhilesh pptIMS-BHU VARANASI
 
International health regulaiton (IHR-2005) Afghanistan Dr. Islam Saeed
International health regulaiton (IHR-2005) Afghanistan Dr. Islam SaeedInternational health regulaiton (IHR-2005) Afghanistan Dr. Islam Saeed
International health regulaiton (IHR-2005) Afghanistan Dr. Islam SaeedIslam Saeed
 
Tracking Universal Health Coverage: First Global Monitoring Report
Tracking Universal Health Coverage: First Global Monitoring ReportTracking Universal Health Coverage: First Global Monitoring Report
Tracking Universal Health Coverage: First Global Monitoring ReportThe Rockefeller Foundation
 
Pharmacovigilance program of India (PvPI)
Pharmacovigilance program of India (PvPI)Pharmacovigilance program of India (PvPI)
Pharmacovigilance program of India (PvPI)SnehaKhandale1
 
Ppt of national health programes on infectious diseases
Ppt of national health programes on infectious diseasesPpt of national health programes on infectious diseases
Ppt of national health programes on infectious diseasesJItendra Bhalavi
 
World health organisation
World health organisation World health organisation
World health organisation sandeep bansal
 
Caring for those who care slideshare.pptx
Caring for those who care slideshare.pptxCaring for those who care slideshare.pptx
Caring for those who care slideshare.pptxDr Sylvia George
 
CGIAR One Health Initiative and ICT4Health
CGIAR One Health Initiative and ICT4HealthCGIAR One Health Initiative and ICT4Health
CGIAR One Health Initiative and ICT4HealthILRI
 

Similar to GHSA and Progress in Pakistan 2018.pdf (20)

International health new
International health newInternational health new
International health new
 
Investing for a safe and healthy Serbia
Investing for a safe and healthy SerbiaInvesting for a safe and healthy Serbia
Investing for a safe and healthy Serbia
 
national and states health care programs
national and states health care programs national and states health care programs
national and states health care programs
 
Thematic Platform for Emergency and Disaster Risk Management Health and the ...
Thematic Platform for Emergency and Disaster Risk Management Health and the ...Thematic Platform for Emergency and Disaster Risk Management Health and the ...
Thematic Platform for Emergency and Disaster Risk Management Health and the ...
 
Investing for a safe and healthy Kazakhstan
Investing for a safe and healthy KazakhstanInvesting for a safe and healthy Kazakhstan
Investing for a safe and healthy Kazakhstan
 
One health approach in Public Health.pptx
One health approach in Public Health.pptxOne health approach in Public Health.pptx
One health approach in Public Health.pptx
 
finalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdffinalnewervaccinesakhileshppt-210521062533(3).pdf
finalnewervaccinesakhileshppt-210521062533(3).pdf
 
Final newer vaccines akhilesh ppt
Final newer vaccines akhilesh pptFinal newer vaccines akhilesh ppt
Final newer vaccines akhilesh ppt
 
International health regulaiton (IHR-2005) Afghanistan Dr. Islam Saeed
International health regulaiton (IHR-2005) Afghanistan Dr. Islam SaeedInternational health regulaiton (IHR-2005) Afghanistan Dr. Islam Saeed
International health regulaiton (IHR-2005) Afghanistan Dr. Islam Saeed
 
Tracking Universal Health Coverage: First Global Monitoring Report
Tracking Universal Health Coverage: First Global Monitoring ReportTracking Universal Health Coverage: First Global Monitoring Report
Tracking Universal Health Coverage: First Global Monitoring Report
 
Ich
IchIch
Ich
 
Pharmacovigilance program of India (PvPI)
Pharmacovigilance program of India (PvPI)Pharmacovigilance program of India (PvPI)
Pharmacovigilance program of India (PvPI)
 
Review of the draft provisional agenda of the 152nd session of the WHO Execut...
Review of the draft provisional agenda of the 152nd session of the WHO Execut...Review of the draft provisional agenda of the 152nd session of the WHO Execut...
Review of the draft provisional agenda of the 152nd session of the WHO Execut...
 
COVID-19 Health System Response Monitor: Thailand
COVID-19 Health System Response Monitor: ThailandCOVID-19 Health System Response Monitor: Thailand
COVID-19 Health System Response Monitor: Thailand
 
INTERNATIONAL AGENCIES.docx
INTERNATIONAL AGENCIES.docxINTERNATIONAL AGENCIES.docx
INTERNATIONAL AGENCIES.docx
 
Ppt of national health programes on infectious diseases
Ppt of national health programes on infectious diseasesPpt of national health programes on infectious diseases
Ppt of national health programes on infectious diseases
 
World health organisation
World health organisation World health organisation
World health organisation
 
Investing for a safe and healthy Ukraine
Investing for a safe and healthy UkraineInvesting for a safe and healthy Ukraine
Investing for a safe and healthy Ukraine
 
Caring for those who care slideshare.pptx
Caring for those who care slideshare.pptxCaring for those who care slideshare.pptx
Caring for those who care slideshare.pptx
 
CGIAR One Health Initiative and ICT4Health
CGIAR One Health Initiative and ICT4HealthCGIAR One Health Initiative and ICT4Health
CGIAR One Health Initiative and ICT4Health
 

Recently uploaded

VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...Miss joya
 
Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...narwatsonia7
 
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Miss joya
 
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowSonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowRiya Pathan
 
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls JaipurCall Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipurparulsinha
 
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near MeHi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Menarwatsonia7
 
Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...
Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...
Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...narwatsonia7
 
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...narwatsonia7
 
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original PhotosCall Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photosnarwatsonia7
 
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service JaipurHigh Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipurparulsinha
 
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service CoimbatoreCall Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatorenarwatsonia7
 
Kolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Kolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowKolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Kolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowNehru place Escorts
 
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls ServiceKesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Servicemakika9823
 
Call Girls ITPL Just Call 7001305949 Top Class Call Girl Service Available
Call Girls ITPL Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls ITPL Just Call 7001305949 Top Class Call Girl Service Available
Call Girls ITPL Just Call 7001305949 Top Class Call Girl Service Availablenarwatsonia7
 
Call Girl Surat Madhuri 7001305949 Independent Escort Service Surat
Call Girl Surat Madhuri 7001305949 Independent Escort Service SuratCall Girl Surat Madhuri 7001305949 Independent Escort Service Surat
Call Girl Surat Madhuri 7001305949 Independent Escort Service Suratnarwatsonia7
 
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment BookingCall Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Bookingnarwatsonia7
 

Recently uploaded (20)

VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
VIP Call Girls Pune Vrinda 9907093804 Short 1500 Night 6000 Best call girls S...
 
Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Electronic City Just Call 7001305949 Top Class Call Girl Service A...
 
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
Low Rate Call Girls Pune Esha 9907093804 Short 1500 Night 6000 Best call girl...
 
Escort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCR
Escort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCREscort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCR
Escort Service Call Girls In Sarita Vihar,, 99530°56974 Delhi NCR
 
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
Russian Call Girls in Delhi Tanvi ➡️ 9711199012 💋📞 Independent Escort Service...
 
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowSonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Sonagachi Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
 
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls JaipurCall Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
Call Girls Service Jaipur Grishma WhatsApp ❤8445551418 VIP Call Girls Jaipur
 
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Servicesauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
sauth delhi call girls in Bhajanpura 🔝 9953056974 🔝 escort Service
 
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near MeHi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
Hi,Fi Call Girl In Mysore Road - 7001305949 | 24x7 Service Available Near Me
 
Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...
Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...
Russian Call Girls Chickpet - 7001305949 Booking and charges genuine rate for...
 
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
Call Girls Kanakapura Road Just Call 7001305949 Top Class Call Girl Service A...
 
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original PhotosCall Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
Call Girl Service Bidadi - For 7001305949 Cheap & Best with original Photos
 
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service JaipurHigh Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
High Profile Call Girls Jaipur Vani 8445551418 Independent Escort Service Jaipur
 
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service CoimbatoreCall Girl Coimbatore Prisha☎️  8250192130 Independent Escort Service Coimbatore
Call Girl Coimbatore Prisha☎️ 8250192130 Independent Escort Service Coimbatore
 
Kolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Kolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call NowKolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
Kolkata Call Girls Services 9907093804 @24x7 High Class Babes Here Call Now
 
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
Call Girls Hebbal Just Call 7001305949 Top Class Call Girl Service Available
 
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls ServiceKesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
Kesar Bagh Call Girl Price 9548273370 , Lucknow Call Girls Service
 
Call Girls ITPL Just Call 7001305949 Top Class Call Girl Service Available
Call Girls ITPL Just Call 7001305949 Top Class Call Girl Service AvailableCall Girls ITPL Just Call 7001305949 Top Class Call Girl Service Available
Call Girls ITPL Just Call 7001305949 Top Class Call Girl Service Available
 
Call Girl Surat Madhuri 7001305949 Independent Escort Service Surat
Call Girl Surat Madhuri 7001305949 Independent Escort Service SuratCall Girl Surat Madhuri 7001305949 Independent Escort Service Surat
Call Girl Surat Madhuri 7001305949 Independent Escort Service Surat
 
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment BookingCall Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
Call Girl Koramangala | 7001305949 At Low Cost Cash Payment Booking
 

GHSA and Progress in Pakistan 2018.pdf

  • 1. Global Health Security: Challenges and Progress in Pakistan October 2018 Dr Assad Hafeez Director General (Health)
  • 2.  Emergence/re-emergence of infectious diseases and increased pace of spread  Globalization – public health event in one location can be a threat to others  Serious and unusual disease events are increasing and inevitable  Threat of deliberate use of biological and chemical agents  Laboratory and industrial accidents  Impact on health, economy, security Global Health Security: Why are we concerned?
  • 3. Global Health Security: Why International Health Regulations matter?
  • 4.  1830-1847: Efforts begins with cholera epidemics in Europe  1851: First International Sanitary Conference, Paris  1951: First International Sanitary Regulations adopted by WHA  1969: Revised and renamed as International Health Regulations  1995: Resolution WHA 48.7 called for revision of IHR  1995 – 2005: 10 years of negotiations involving public health specialist, legal experts, diplomats & political dignitaries  2005: IHR - an international agreement that is legally binding on State Parties/WHO Member States  15 June 2007: Entry into force Evolution of International Health Regulations
  • 5.  Broader Scope - from 3 diseases to all public health threats - from control of borders to containment at source - from preset measures to adapted response  Prevent, protect, and provide a public health response to the international threat and spread of diseases  Avoid unnecessary disruption of international travel & trade  Applicable to health risks - irrespective of origin/ source  Follow evolution of diseases and factors affecting their emergence and transmission Scope and Purpose of IHR 2005
  • 6.  Global event management – Global information system – Coordination of international response  Core capacity requirements – Prevent: 7 core capacities – Detect: 4 core capacities – Respond: 4 core capacities – Others: 3 core capacities  Inter-sectoral approach  State sovereignty & international spread of diseases Key Areas of IHR Implementation
  • 7. IHR Global Event Management
  • 9. Joint External Evaluation (JEE) OBJECTIVES 1. Assess the implementation of IHR capacities 2. Review all related documents 3. Develop a report describing the progress and gaps 4. Recommend priority actions to update and finalize the national plan to achieve and maintain IHR capacities
  • 10. JEE History  2014: WHA recommended to move from exclusive self evaluation to combined self evaluation, peer review and volunteer external evaluation  2015: Concept note discussed in WHO Regional Committee  2015: Revised M&E Framework in the 69th WHA  WHO developed a JEE tool  2015: Pakistan volunteered as first country in EMR and fourth globally for JEE  2016: JEE conducted  2017-18: National Action Plan on Health Security developed  2018: First meeting of the National IHR Taskforce
  • 11. A: PREVENT 1. National legislation, policy and financing 2. IHR coordination, communication and advocacy 3. Antimicrobial resistance 4. Zoonotic diseases 5. Food safety 6. Biosafety and biosecurity 7. Immunization IHR Core Capacities (measured through JEE) B: DETECT 1. National laboratory system 2. Real-time surveillance 3. Reporting 4. Workforce development
  • 12. C: RESPOND 1. Preparedness 2. Emergency response operations 3. Linking public health and security authorities 4. Medical countermeasure and personal deployment 5. Risk communication IHR Core Capacities (measured through JEE) D: OTHERS 1. Point of entry 2. Chemical events 3. Radiation emergencies Reports on provinces and federating areas
  • 13. IHR Index for Pakistan  Based on JEE (19 capacities and 48 indicators): 116/240 = 48.3%  Reported Globally (13 core capacities) = 53% Target: +80% (2030) Target 2023: 60% It is estimated that 41 million more people will be better protected from health emergencies, in case Pakistan achieves IHR index of 60% by 2023 Global Target 2023: 1 Billion more people protected from health emergencies
  • 14. Core Capacity wise Status IHR Core Capacity Progress/Remarks National legislation policy and financing - "Pakistan Public Health Surveillance and Response Act 2010" available - KP enacted public health act - Federal/national act being finalized by NIH Coordination and NFP Communications - National Focal Point designated for IHR and GHSA - Provincial focal points also notified - A multi-sectoral and multi disciplinary task-force for IHR notified (One health approach) - IHR-NFP TORs developed - NPHI development in progress
  • 15. Core Capacity wise Status IHR Core Capacity Progress/Remarks Surveillance & Response - Disease specific multiple vertical programme engaged in surveillance - Division of Field Epidemiology Disease Surveillance notified at NIH - Communicable Disease data compiled at NIH for Alerts & Advisories - Diseases Surveillance and Response Units established - Disease prioritization exercise – List of diseases for surveillance - Technical Working Group notified - IDSRS framework developed – phase I to be launched Preparedness - National Health Emergency Preparedness & Response Network (NHEPRN) - NHEPRN in collaboration with WHO developed “preparedness and contingency plan for the Communicable Disease” - NIH to finalize pandemic preparedness plan and its implementation
  • 16. Core Capacity wise Status IHR Core Capacity Progress/Remarks Risk Communication - Current coordination mechanism through "Health Clusters” - Provincial focal person notified Human Resource Capacity - Around 125 Field Epidemiologist since 2007 - 90 under training (60 per year from 2016 onwards) - Frontline launched (Shorter version) Laboratory - NIH as referral laboratory and Multiple Lab based surveillance initiative - BSL-3 functional - National Laboratory Working Group (NLWG) notified - Laboratory policy developed - Provincial PH Labs being established - Capacity building on cross cutting issues (BRM, LQMS, Info systems)
  • 17. Core Capacity wise Status IHR Core Capacity Progress/Remarks AMR - Focal point notified - Multi-sectoral/ multi disciplinary committee notified - National AMR strategic framework and action paln developed - Setting up sentinel surveillance using GLASS protocol Biosafety & biosecurity - Assessment conducted - National Biosafety/Biosecurity Policy endorsed - Multiple trainings on BRM EOC - Six EOC established (01 Federal, 4 provinces and 01 in FATA) - Presently used only for polio Immunization - Federal and provincial programmes in place - GHSA grant with CDC for strengthening routine immunization
  • 18. Core Capacity wise Status IHR Core Capacity Progress/Remarks Zoonotic diseases - Inclusion of animal and livestock sector professionals on different forums including AMR, Laboratory system, Biosafety and Biosecurity, Surveillance - One health hub at NIH - MoU with PARC & Global Change Impact study centre Others - Food safety assessment mission conducted - POEs assessment - Trainings and capacity building
  • 19. Key Challenges  Functional multi-sectoral coordination between federal & provincial levels through a joint IHR Task force;  Implementation of 5 year costed National Action Plan on Health Security for 19 technical areas against key priorities - Financing  Establishment of surveillance & laboratory systems with a ‘One Health Approach’ to include human and animal health sector  Development of uniform regulatory standards in all areas of food security  Comprehensive national cross-sectional approach towards Antimicrobial Resistance (AMR)
  • 20. Role of Security Agencies  Active involvement of security agencies is a must, as health emergencies have more serious implications (death, disease and disability - 3Ds with No Borders along with Security & Economic loss) than actual warfare  Deliberate use of biological, chemical and radiological agents should be prevented, detected and responded at an early stage  Developing IHR capacities both in civil sector and security agencies should augment each others efforts  Some capacities (radiation and chemical warfare) are largely the domain of the security agencies (a need for an agreed role of civil sector)  Poor IHR capacities in a country have a serious negative impact on military defence preparedness