SlideShare a Scribd company logo
1 of 11
Download to read offline
C R I T I C A L A N A LY S I S A N D
R E A S O N I N G I N D I S C I P L I N E -
B A S E D S T U D I E S ( C A R D S )
T U T O R I A L 1
TUTORIAL
• Tutorial is an indispensible component in university learning: try
interacting with each other to solve and clarify problems.
• Students are required to attend all 8 face-to-face tutorial sessions.
• Tutorials will be held in the week of Lecture 4-7, 9-12.
3
ASSESSMENT
Type of Assessment Description Weighting
Continuous Assessment
Inquiry-based group projects on ethical reasoning:
Groups of 2 to 3 students performing a 15 to 20
minutes presentation and answering questions in a
Q&A session
25%
Tutorial Participation 10%
Individual assignment on discipline-based studies:
One written assignment (500-600 words)
30%
One one-hour short quiz on critical thinking in the
form of multiple choice questions and/or short-
answer questions.
35%
Total: 100%
weett 4
ESSAY TOPIC
INDIVIDUAL ASSIGNMENT ON
DISCIPLINE-BASED STUDIES
• Essay Topic:
• In recent years, the Gen Z in modern society is being bombarded with information from social media that
intends to define the youth and determines their everyday decisions. Has social media in virtual reality
become an arena of 'Post-truth' which operates as consistent guidance for youth's behaviour and vision? Are
critical thinking and reasoning the useful means to help the youth to cope with the 'post-truth' era? Develop
your arguments with reference to the materials covered from lecture one to four. Expand your analysis with
your own interpretations, reasonings, and convincing evidence, etc.
• Write an essay of no more than 600 words giving your own arguments for or against this
view. You may refer to lecture 1-4 for inspiration. Reference is not required. But if you
quote, please follow the APA format.
• Written Assignment Consultation: Tutorial 2 (Please prepare your questions in advance)
• One 500 - 600 word essay on Discipline-based Studies (Lecture 1-4) (30%)
X
'
Inmyopiniou Inmypoiutcfview
www.iutaid 了 (巧 0
它
1. Has social media in virtual reality become an arena of 'Post-truth' which operates as consistent
guidance for youth's behaviour and vision?
UR
isudJGHaos.m.in
virtudredigbe.ae an arenad
比
嘫
| →
𤂑
Ǘgyiǜistatguidaefuyahishiaadsuppahy
visiaeviduceldndusehl)
② Haicritialthukareusefuliuhelpingtheyouthto
copewitutheiosttrutera
GENERAL FORMAT:
• 1. Length of paper: minimum 500 words; maximum 600 words excluding
citations and references (if any). Marks will be deducted if your paper exceeds
the word limit. (2 marks per word)
• 2. Language: no colloquial English or point-form will be accepted.
• 3. Double-line spacing with margins on the side.
THINGS TO NOTE:
• 1. Submit your paper via Turnitin@Soul.
• 2. Late paper will be penalized: 5 marks per day. No late submission is
allowed after 7 days.
• 3. Resubmission is allowed until due date and time.
• 4. Do not copy anything from other sources; cite if you want to use them.
TO SCORE WELL:
• 1. Organisation: The essay is well-organised and coherent. Arguments are clear in meaning.
• 2. Use of evidence, examples or relevant facts: Arguments are evidence-based, supported by
examples or relevant facts.
• 3. Application of concepts and theories: Concepts and theories are used appropriately.
• 4. Criticality and originality of arguments: The essay shows critical thinking, and originality
of thought.
• 5. Language: No typos and grammatical mistakes found in the essay. Fluent in English.
AN ARGUMENTATIVE ESSAY
• Critical thinking done on paper is known as an argumentative essay which generally has four
components:
• 1. A statement of the issue – Your essay should begin with an introduction to the issue that
demonstrates that the issue is important.
• 2. A statement of one’s position on that issue
• 3. Arguments that support one’s position – All points you make should be connected to the
issue under discussion. Emphasize your position on the issue. Arguments should be arranged in
a logical sequence. STICK TO THE ISSUE. DON’T GET LOST.
Be complete. Support your position adequately
• 4. Rebuttals of arguments that support contrary positions. Respond to possible objections i.e.
counter arguments
Objediu
Būwithstauceriūlroduction
Caihgwott Rebuttds
Infhseemgwhsense Búl
-
X
'
I
'
h-
Passievoiceostuce
•
Fuparagraphs
Ǜtrot Bltztstcondusiiqi
-
-
lparg-dea-Topicsataefaphrangsimikvsentene.lt
ndl-summarizigst.nu/1inktowextparagytmth'world
-
dusopiǔasyandeasw →
cbjediveth
-
Fakeusiusiyadertisyerdei
8aidtase.at
badwustgodluslfibsw-iact-chgistmctudpositi.nl/
Ffchecw
passive-sadiuetswitaht.netHg
Dqotuwneigadadithtliutuetusedstdistie
② searchwuei
Biasedsanrcetrianguktessameuewsidifflayuge
③
enggemaeiwithdhascxpraetnwrap
Demccragisaialmediaintrmālim
Nreedanispaticihizg

More Related Content

Similar to essay PowerPoint notes in introduction of CARD

C L A S S I, Very Final
C L A S S   I, Very FinalC L A S S   I, Very Final
C L A S S I, Very FinalJohn Carlson
 
week 1Discussion postPurpose of General Education.docx
week 1Discussion postPurpose of General Education.docxweek 1Discussion postPurpose of General Education.docx
week 1Discussion postPurpose of General Education.docxmelbruce90096
 
Ms3 lesson 2_research and referencing
Ms3 lesson 2_research and referencingMs3 lesson 2_research and referencing
Ms3 lesson 2_research and referencinghowardeffinghammedia
 
Reflective analysis helps you to make an evidence-based argument.docx
Reflective analysis helps you to make an evidence-based argument.docxReflective analysis helps you to make an evidence-based argument.docx
Reflective analysis helps you to make an evidence-based argument.docxcarlt3
 
The Art of Teaching Argument
The Art of Teaching ArgumentThe Art of Teaching Argument
The Art of Teaching Argumentdeliadec
 
Page 1 of 4 Controversial Issues in American Culture Rese.docx
 Page 1 of 4 Controversial Issues in American Culture Rese.docx Page 1 of 4 Controversial Issues in American Culture Rese.docx
Page 1 of 4 Controversial Issues in American Culture Rese.docxaryan532920
 
k3-reading-comprehension-practice-guide-aug-2011.pptx
k3-reading-comprehension-practice-guide-aug-2011.pptxk3-reading-comprehension-practice-guide-aug-2011.pptx
k3-reading-comprehension-practice-guide-aug-2011.pptxqueenpressman14
 
Teaching English Through English I Class #2
Teaching English Through English I Class #2Teaching English Through English I Class #2
Teaching English Through English I Class #2lisyaseloni
 
Small Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docxSmall Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docxrosemariebrayshaw
 
2. Nature of Academic texts ELE 704.pdf
2. Nature of Academic texts ELE 704.pdf2. Nature of Academic texts ELE 704.pdf
2. Nature of Academic texts ELE 704.pdfMARICARTEORIMA5
 
English 6th Semester BSN Notes, Educational Platform-1.pdf
English 6th Semester BSN Notes, Educational Platform-1.pdfEnglish 6th Semester BSN Notes, Educational Platform-1.pdf
English 6th Semester BSN Notes, Educational Platform-1.pdfMazharUllah4
 
Small Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docxSmall Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docxjennifer822
 
RM pedagogies workshop
RM pedagogies workshopRM pedagogies workshop
RM pedagogies workshopPhilwood
 
Engl 102 / Online / Summer 2019 / Syllabus
Engl 102 / Online / Summer 2019 / SyllabusEngl 102 / Online / Summer 2019 / Syllabus
Engl 102 / Online / Summer 2019 / SyllabusClare Shearer
 
UNIT 6.pptx
UNIT 6.pptxUNIT 6.pptx
UNIT 6.pptxsarasiby
 
Applied Final Project What are the Issues – An Investigative Essa.docx
Applied Final Project What are the Issues – An Investigative Essa.docxApplied Final Project What are the Issues – An Investigative Essa.docx
Applied Final Project What are the Issues – An Investigative Essa.docxjesuslightbody
 
English 102 syllabus-spring_2018
English 102 syllabus-spring_2018English 102 syllabus-spring_2018
English 102 syllabus-spring_2018Wiley Humbug
 
Research problem statement
Research problem statement Research problem statement
Research problem statement bikashtaly
 

Similar to essay PowerPoint notes in introduction of CARD (20)

C L A S S I, Very Final
C L A S S   I, Very FinalC L A S S   I, Very Final
C L A S S I, Very Final
 
week 1Discussion postPurpose of General Education.docx
week 1Discussion postPurpose of General Education.docxweek 1Discussion postPurpose of General Education.docx
week 1Discussion postPurpose of General Education.docx
 
Ms3 lesson 2_research and referencing
Ms3 lesson 2_research and referencingMs3 lesson 2_research and referencing
Ms3 lesson 2_research and referencing
 
Reflective analysis helps you to make an evidence-based argument.docx
Reflective analysis helps you to make an evidence-based argument.docxReflective analysis helps you to make an evidence-based argument.docx
Reflective analysis helps you to make an evidence-based argument.docx
 
The Art of Teaching Argument
The Art of Teaching ArgumentThe Art of Teaching Argument
The Art of Teaching Argument
 
SociologyExchange.co.uk Shared Resource
SociologyExchange.co.uk Shared ResourceSociologyExchange.co.uk Shared Resource
SociologyExchange.co.uk Shared Resource
 
Page 1 of 4 Controversial Issues in American Culture Rese.docx
 Page 1 of 4 Controversial Issues in American Culture Rese.docx Page 1 of 4 Controversial Issues in American Culture Rese.docx
Page 1 of 4 Controversial Issues in American Culture Rese.docx
 
k3-reading-comprehension-practice-guide-aug-2011.pptx
k3-reading-comprehension-practice-guide-aug-2011.pptxk3-reading-comprehension-practice-guide-aug-2011.pptx
k3-reading-comprehension-practice-guide-aug-2011.pptx
 
Teaching English Through English I Class #2
Teaching English Through English I Class #2Teaching English Through English I Class #2
Teaching English Through English I Class #2
 
Small Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docxSmall Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docx
 
HCS321 201790 Assesment 2
HCS321 201790 Assesment 2HCS321 201790 Assesment 2
HCS321 201790 Assesment 2
 
2. Nature of Academic texts ELE 704.pdf
2. Nature of Academic texts ELE 704.pdf2. Nature of Academic texts ELE 704.pdf
2. Nature of Academic texts ELE 704.pdf
 
English 6th Semester BSN Notes, Educational Platform-1.pdf
English 6th Semester BSN Notes, Educational Platform-1.pdfEnglish 6th Semester BSN Notes, Educational Platform-1.pdf
English 6th Semester BSN Notes, Educational Platform-1.pdf
 
Small Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docxSmall Group Discussion Grading RubricParticipation for MSNSmal.docx
Small Group Discussion Grading RubricParticipation for MSNSmal.docx
 
RM pedagogies workshop
RM pedagogies workshopRM pedagogies workshop
RM pedagogies workshop
 
Engl 102 / Online / Summer 2019 / Syllabus
Engl 102 / Online / Summer 2019 / SyllabusEngl 102 / Online / Summer 2019 / Syllabus
Engl 102 / Online / Summer 2019 / Syllabus
 
UNIT 6.pptx
UNIT 6.pptxUNIT 6.pptx
UNIT 6.pptx
 
Applied Final Project What are the Issues – An Investigative Essa.docx
Applied Final Project What are the Issues – An Investigative Essa.docxApplied Final Project What are the Issues – An Investigative Essa.docx
Applied Final Project What are the Issues – An Investigative Essa.docx
 
English 102 syllabus-spring_2018
English 102 syllabus-spring_2018English 102 syllabus-spring_2018
English 102 syllabus-spring_2018
 
Research problem statement
Research problem statement Research problem statement
Research problem statement
 

Recently uploaded

Museum of fine arts Lauren Simpson…………..
Museum of fine arts Lauren Simpson…………..Museum of fine arts Lauren Simpson…………..
Museum of fine arts Lauren Simpson…………..mvxpw22gfc
 
Hire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls Agency
Hire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls AgencyHire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls Agency
Hire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls AgencyNitya salvi
 
FULL NIGHT — 9999894380 Call Girls In Saket | Delhi
FULL NIGHT — 9999894380 Call Girls In Saket | DelhiFULL NIGHT — 9999894380 Call Girls In Saket | Delhi
FULL NIGHT — 9999894380 Call Girls In Saket | DelhiSaketCallGirlsCallUs
 
VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112
VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112
VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112Nitya salvi
 
Van Gogh Powerpoint for art lesson today
Van Gogh Powerpoint for art lesson todayVan Gogh Powerpoint for art lesson today
Van Gogh Powerpoint for art lesson todaylucygibson17
 
FULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | Delhi
FULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | DelhiFULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | Delhi
FULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | DelhiSaketCallGirlsCallUs
 
Akbar Religious Policy and Sufism comparison.pptx
Akbar Religious Policy and Sufism comparison.pptxAkbar Religious Policy and Sufism comparison.pptx
Akbar Religious Policy and Sufism comparison.pptxAmita Gupta
 
FULL NIGHT — 9999894380 Call Girls In Delhi | Delhi
FULL NIGHT — 9999894380 Call Girls In Delhi | DelhiFULL NIGHT — 9999894380 Call Girls In Delhi | Delhi
FULL NIGHT — 9999894380 Call Girls In Delhi | DelhiSaketCallGirlsCallUs
 
FULL NIGHT — 9999894380 Call Girls In Patel Nagar | Delhi
FULL NIGHT — 9999894380 Call Girls In Patel Nagar | DelhiFULL NIGHT — 9999894380 Call Girls In Patel Nagar | Delhi
FULL NIGHT — 9999894380 Call Girls In Patel Nagar | DelhiSaketCallGirlsCallUs
 
FULL NIGHT — 9999894380 Call Girls In Badarpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Badarpur | DelhiFULL NIGHT — 9999894380 Call Girls In Badarpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Badarpur | DelhiSaketCallGirlsCallUs
 
architect Hassan Khalil portfolio Year 2024
architect Hassan Khalil portfolio  Year 2024architect Hassan Khalil portfolio  Year 2024
architect Hassan Khalil portfolio Year 2024hassan khalil
 
FULL NIGHT — 9999894380 Call Girls In Dwarka Mor | Delhi
FULL NIGHT — 9999894380 Call Girls In Dwarka Mor | DelhiFULL NIGHT — 9999894380 Call Girls In Dwarka Mor | Delhi
FULL NIGHT — 9999894380 Call Girls In Dwarka Mor | DelhiSaketCallGirlsCallUs
 
FULL NIGHT — 9999894380 Call Girls In Jasola Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Jasola Vihar | DelhiFULL NIGHT — 9999894380 Call Girls In Jasola Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Jasola Vihar | DelhiSaketCallGirlsCallUs
 
❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...
❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...
❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...Sheetaleventcompany
 
FULL NIGHT — 9999894380 Call Girls In Paschim Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In  Paschim Vihar | DelhiFULL NIGHT — 9999894380 Call Girls In  Paschim Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Paschim Vihar | DelhiSaketCallGirlsCallUs
 
FULL NIGHT — 9999894380 Call Girls In Kishangarh | Delhi
FULL NIGHT — 9999894380 Call Girls In Kishangarh | DelhiFULL NIGHT — 9999894380 Call Girls In Kishangarh | Delhi
FULL NIGHT — 9999894380 Call Girls In Kishangarh | DelhiSaketCallGirlsCallUs
 
FULL NIGHT — 9999894380 Call Girls In Mahipalpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Mahipalpur | DelhiFULL NIGHT — 9999894380 Call Girls In Mahipalpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Mahipalpur | DelhiSaketCallGirlsCallUs
 
FULL NIGHT — 9999894380 Call Girls In Ashok Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Ashok Vihar | DelhiFULL NIGHT — 9999894380 Call Girls In Ashok Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Ashok Vihar | DelhiSaketCallGirlsCallUs
 

Recently uploaded (20)

Museum of fine arts Lauren Simpson…………..
Museum of fine arts Lauren Simpson…………..Museum of fine arts Lauren Simpson…………..
Museum of fine arts Lauren Simpson…………..
 
Hire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls Agency
Hire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls AgencyHire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls Agency
Hire 💕 8617370543 Mumbai Suburban Call Girls Service Call Girls Agency
 
FULL NIGHT — 9999894380 Call Girls In Saket | Delhi
FULL NIGHT — 9999894380 Call Girls In Saket | DelhiFULL NIGHT — 9999894380 Call Girls In Saket | Delhi
FULL NIGHT — 9999894380 Call Girls In Saket | Delhi
 
VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112
VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112
VIP Ramnagar Call Girls, Ramnagar escorts Girls 📞 8617697112
 
Van Gogh Powerpoint for art lesson today
Van Gogh Powerpoint for art lesson todayVan Gogh Powerpoint for art lesson today
Van Gogh Powerpoint for art lesson today
 
FULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | Delhi
FULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | DelhiFULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | Delhi
FULL NIGHT — 9999894380 Call Girls In Shivaji Enclave | Delhi
 
Akbar Religious Policy and Sufism comparison.pptx
Akbar Religious Policy and Sufism comparison.pptxAkbar Religious Policy and Sufism comparison.pptx
Akbar Religious Policy and Sufism comparison.pptx
 
FULL NIGHT — 9999894380 Call Girls In Delhi | Delhi
FULL NIGHT — 9999894380 Call Girls In Delhi | DelhiFULL NIGHT — 9999894380 Call Girls In Delhi | Delhi
FULL NIGHT — 9999894380 Call Girls In Delhi | Delhi
 
FULL NIGHT — 9999894380 Call Girls In Patel Nagar | Delhi
FULL NIGHT — 9999894380 Call Girls In Patel Nagar | DelhiFULL NIGHT — 9999894380 Call Girls In Patel Nagar | Delhi
FULL NIGHT — 9999894380 Call Girls In Patel Nagar | Delhi
 
FULL NIGHT — 9999894380 Call Girls In Badarpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Badarpur | DelhiFULL NIGHT — 9999894380 Call Girls In Badarpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Badarpur | Delhi
 
Dubai Call Girl Number # 00971588312479 # Call Girl Number In Dubai # (UAE)
Dubai Call Girl Number # 00971588312479 # Call Girl Number In Dubai # (UAE)Dubai Call Girl Number # 00971588312479 # Call Girl Number In Dubai # (UAE)
Dubai Call Girl Number # 00971588312479 # Call Girl Number In Dubai # (UAE)
 
architect Hassan Khalil portfolio Year 2024
architect Hassan Khalil portfolio  Year 2024architect Hassan Khalil portfolio  Year 2024
architect Hassan Khalil portfolio Year 2024
 
FULL NIGHT — 9999894380 Call Girls In Dwarka Mor | Delhi
FULL NIGHT — 9999894380 Call Girls In Dwarka Mor | DelhiFULL NIGHT — 9999894380 Call Girls In Dwarka Mor | Delhi
FULL NIGHT — 9999894380 Call Girls In Dwarka Mor | Delhi
 
UAE Call Girls # 971526940039 # Independent Call Girls In Dubai # (UAE)
UAE Call Girls # 971526940039 # Independent Call Girls In Dubai # (UAE)UAE Call Girls # 971526940039 # Independent Call Girls In Dubai # (UAE)
UAE Call Girls # 971526940039 # Independent Call Girls In Dubai # (UAE)
 
FULL NIGHT — 9999894380 Call Girls In Jasola Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Jasola Vihar | DelhiFULL NIGHT — 9999894380 Call Girls In Jasola Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Jasola Vihar | Delhi
 
❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...
❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...
❤️Call girls in Chandigarh ☎️8264406502☎️ Call Girl service in Chandigarh☎️ C...
 
FULL NIGHT — 9999894380 Call Girls In Paschim Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In  Paschim Vihar | DelhiFULL NIGHT — 9999894380 Call Girls In  Paschim Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Paschim Vihar | Delhi
 
FULL NIGHT — 9999894380 Call Girls In Kishangarh | Delhi
FULL NIGHT — 9999894380 Call Girls In Kishangarh | DelhiFULL NIGHT — 9999894380 Call Girls In Kishangarh | Delhi
FULL NIGHT — 9999894380 Call Girls In Kishangarh | Delhi
 
FULL NIGHT — 9999894380 Call Girls In Mahipalpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Mahipalpur | DelhiFULL NIGHT — 9999894380 Call Girls In Mahipalpur | Delhi
FULL NIGHT — 9999894380 Call Girls In Mahipalpur | Delhi
 
FULL NIGHT — 9999894380 Call Girls In Ashok Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Ashok Vihar | DelhiFULL NIGHT — 9999894380 Call Girls In Ashok Vihar | Delhi
FULL NIGHT — 9999894380 Call Girls In Ashok Vihar | Delhi
 

essay PowerPoint notes in introduction of CARD

  • 1. C R I T I C A L A N A LY S I S A N D R E A S O N I N G I N D I S C I P L I N E - B A S E D S T U D I E S ( C A R D S ) T U T O R I A L 1
  • 2. TUTORIAL • Tutorial is an indispensible component in university learning: try interacting with each other to solve and clarify problems. • Students are required to attend all 8 face-to-face tutorial sessions. • Tutorials will be held in the week of Lecture 4-7, 9-12. 3
  • 3. ASSESSMENT Type of Assessment Description Weighting Continuous Assessment Inquiry-based group projects on ethical reasoning: Groups of 2 to 3 students performing a 15 to 20 minutes presentation and answering questions in a Q&A session 25% Tutorial Participation 10% Individual assignment on discipline-based studies: One written assignment (500-600 words) 30% One one-hour short quiz on critical thinking in the form of multiple choice questions and/or short- answer questions. 35% Total: 100% weett 4
  • 5. INDIVIDUAL ASSIGNMENT ON DISCIPLINE-BASED STUDIES • Essay Topic: • In recent years, the Gen Z in modern society is being bombarded with information from social media that intends to define the youth and determines their everyday decisions. Has social media in virtual reality become an arena of 'Post-truth' which operates as consistent guidance for youth's behaviour and vision? Are critical thinking and reasoning the useful means to help the youth to cope with the 'post-truth' era? Develop your arguments with reference to the materials covered from lecture one to four. Expand your analysis with your own interpretations, reasonings, and convincing evidence, etc. • Write an essay of no more than 600 words giving your own arguments for or against this view. You may refer to lecture 1-4 for inspiration. Reference is not required. But if you quote, please follow the APA format. • Written Assignment Consultation: Tutorial 2 (Please prepare your questions in advance) • One 500 - 600 word essay on Discipline-based Studies (Lecture 1-4) (30%) X ' Inmyopiniou Inmypoiutcfview www.iutaid 了 (巧 0 它
  • 6. 1. Has social media in virtual reality become an arena of 'Post-truth' which operates as consistent guidance for youth's behaviour and vision? UR isudJGHaos.m.in virtudredigbe.ae an arenad 比 嘫 | → 𤂑 Ǘgyiǜistatguidaefuyahishiaadsuppahy visiaeviduceldndusehl) ② Haicritialthukareusefuliuhelpingtheyouthto copewitutheiosttrutera
  • 7. GENERAL FORMAT: • 1. Length of paper: minimum 500 words; maximum 600 words excluding citations and references (if any). Marks will be deducted if your paper exceeds the word limit. (2 marks per word) • 2. Language: no colloquial English or point-form will be accepted. • 3. Double-line spacing with margins on the side.
  • 8. THINGS TO NOTE: • 1. Submit your paper via Turnitin@Soul. • 2. Late paper will be penalized: 5 marks per day. No late submission is allowed after 7 days. • 3. Resubmission is allowed until due date and time. • 4. Do not copy anything from other sources; cite if you want to use them.
  • 9. TO SCORE WELL: • 1. Organisation: The essay is well-organised and coherent. Arguments are clear in meaning. • 2. Use of evidence, examples or relevant facts: Arguments are evidence-based, supported by examples or relevant facts. • 3. Application of concepts and theories: Concepts and theories are used appropriately. • 4. Criticality and originality of arguments: The essay shows critical thinking, and originality of thought. • 5. Language: No typos and grammatical mistakes found in the essay. Fluent in English.
  • 10. AN ARGUMENTATIVE ESSAY • Critical thinking done on paper is known as an argumentative essay which generally has four components: • 1. A statement of the issue – Your essay should begin with an introduction to the issue that demonstrates that the issue is important. • 2. A statement of one’s position on that issue • 3. Arguments that support one’s position – All points you make should be connected to the issue under discussion. Emphasize your position on the issue. Arguments should be arranged in a logical sequence. STICK TO THE ISSUE. DON’T GET LOST. Be complete. Support your position adequately • 4. Rebuttals of arguments that support contrary positions. Respond to possible objections i.e. counter arguments Objediu Būwithstauceriūlroduction Caihgwott Rebuttds Infhseemgwhsense Búl