Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.
º
Desarrollo de péptidos bioactivos y probióticos para la tercera edad
Ingredientes funcionales para la tercera edad
1. El proyecto SENIFOOD
2. A la búsqueda de péptidos bioactivos
3. ES1: un p...
Ingredientes funcionales para la tercera edad
1. El proyecto SENIFOOD
2. A la búsqueda de péptidos bioactivos
3. ES1: un p...
Biopolis SL
• Empresa biotecnológica creada hace
diez años como una spin-off del CSIC
• De la búsqueda del producto a su
v...
Centro de I+D
• El Centro de I+D de Biopolis SL está situado en el Parc Cientific de la Universitat de
València; es un edi...
Las plataformas de trabajo
Bioquímica
Microbiología
Biología molecular
Cultivos celulares
Organismos modelo
Escalado
Ferme...
La principal fortaleza
• En el grupo Biopolis trabajan 43 personas (36 en Biopolis SL y 7 en Lifesequencing
SL)
• La mayor...
El proyecto SENIFOOD
Mejorar la calidad de vida de las personas mayores por medio de la alimentación
a través de la formul...
Objetivos de Biopolis SL en SENIFOOD
Péptidos
InflamaciónProbióticos
Alzheimer
Ingredientes funcionales para la tercera edad
1. El proyecto SENIFOOD
2. A la búsqueda de péptidos bioactivos
3. ES1: un p...
La enfermedad de Alzheimer
Estrés oxidativo
Inflamación
Degeneración neuronal
Haces neurofibrilares
Inhibición de PEP
Efec...
Escrutinio de residuos agroalimentarios
Z-gly-pro-ρNA ρNA
PEP
OD410
± producto
Estrés
oxidativo
(3mM H2O2)
5 horas
5 días
...
El barquillo de cacao
Péptidos desde el barquillo de cacao
Hydrophobic Interaction chromatography (HIC)
HIDRÓLISIS PROTEÍCA
FRACCIONES HIC
FRACC...
Identificación del péptido
Theobroma cacao 21 kDa seed protein (221 aas)
FRACCIONES RPC POSITIVAS
IDENTIFICACIÓN MALDI-TOF...
Resultados
0
10
20
30
40
50
60
70
80
NGM NGM+vitaminC 9L 11R 13L 13R
%WormSurvival(C.elegansN2)
AntioxidantActivity
24 41 ...
Transcriptómica
PÉPTIDO 13L-mer
Regulación
Metabolismo del
piruvato
Regulación
Proteasoma
Regulación
Metabolismo del
tript...
Inhibición de la agregación de Aβ
25
112
30
61
13
Tubulina
Placebo 13L
Ratiodeagregación
0
0,2
0,4
0,6
0,8
1
1,2
Martorell...
Ingredientes funcionales para la tercera edad
1. El proyecto SENIFOOD
2. A la búsqueda de péptidos bioactivos
3. ES1: un p...
Origen de la cepa
• La cepa ES1 fué aislada por el grupo de la Dra.
Yolanda Sanz en el Instituto de Agroquímica y
Tecnolog...
Respuesta anti-inflamatoria en células PBMC
• Se ha realizado un estudio con heces coincubadas
con la cepa ES1 y se diseña...
• Se hicieron experimentos similares con
células Caco-2
• Se midieron los niveles de transcripción
de los genes que codifi...
Respuesta anti-inflamatoria en células dendríticas
• Se investigó la interacción de la cepa ES1 con
células dendríticas de...
Estudio preclínico de efectividad en ratas
B. longum ES1
Placebo
• Se usó un modelo de enteropatía
inducida por gliadinas ...
Respuesta anti-inflamatoria en animales
• Además, en los dos grupos se analizó la producción de componentes
del sistema in...
Estudios de seguridad alimentaria in vitro
• Se evaluó la seguridad alimentaria del probiótico ES1 siguiendo las
recomenda...
Estudios de seguridad alimentaria in vivo
• En colaboración con el Instituto Pasteur de
Montevideo, se llevó a cabo un est...
Secuenciación del genoma de la cepa
• Se ha secuenciado el genoma de la cepa ES1
utilizando técnicas de pirosecuenciación
...
Escalado de producción
• Se ha escalado la fermentación de la cepa ES1, desde el laboratorio a la planta piloto y
desde la...
Ensayo clínico fase I
• Se llevó a cabo con 12 voluntarios humanos
(edad media 30.3 años, rango de 23 a 40
años); fue un e...
Ensayo clínico fase II (I)
• Se llevó a cabo un ensayo doble ciego,
aletaorio y con control de placebo sobre 40
niños celi...
Ensayo clínico fase II (II)
• El estudio de la microbiota de los dos grupos reveló datos muy interesantes
• Se detectó una...
Dossier científico
• Izquierdo E, Medina M, Ennahar S, Marchioni E, Sanz . (2008). Resistance to simulated gastrointestina...
El producto Proceliac
Ingredientes funcionales para la tercera edad
1. El proyecto SENIFOOD
2. A la búsqueda de péptidos bioactivos
3. ES1: un p...
Biología de sistemas: clave de futuro
• Nuestra experiencia de I+D con clientes
nos ha enseñado que un abordaje
genómico/m...
El ejemplo de los líderes
Daniel Ramón Vidal (daniel.ramon@biopolis.es)
http://www.linkedin.com/profile/view?id=64921252&trk=tab_pro
Biopolis SL
Par...
Upcoming SlideShare
Loading in …5
×

Desarrollo de péptidos bioactivos y probióticos para la tercera_Daniel Ramón

704 views

Published on

Desarrollo de péptidos bioactivos y probióticos para la tercera_Daniel Ramón

  • Be the first to comment

  • Be the first to like this

Desarrollo de péptidos bioactivos y probióticos para la tercera_Daniel Ramón

  1. 1. º Desarrollo de péptidos bioactivos y probióticos para la tercera edad
  2. 2. Ingredientes funcionales para la tercera edad 1. El proyecto SENIFOOD 2. A la búsqueda de péptidos bioactivos 3. ES1: un probiótico contra la inflamación 4. Conclusiones
  3. 3. Ingredientes funcionales para la tercera edad 1. El proyecto SENIFOOD 2. A la búsqueda de péptidos bioactivos 3. ES1: un probiótico contra la inflamación 4. Conclusiones
  4. 4. Biopolis SL • Empresa biotecnológica creada hace diez años como una spin-off del CSIC • De la búsqueda del producto a su validación, de la idea original a la comercialización (“tailor-made biotechnology”) • Trabajamos con la excelencia científica como herramienta para comercializar productos de alto valor añadido • Nos dirigimos al sector de la alimentación humana y al químico farmacéutico • Somos expertos en la búsqueda, validación y producción de ingredientes funcionales y en la revalorización de residuos
  5. 5. Centro de I+D • El Centro de I+D de Biopolis SL está situado en el Parc Cientific de la Universitat de València; es un edificio con 1500 m2 • Está formado por once laboratorios y dos plantas de producción (una GMO y otra no- GMO), así como toda una serie de instalaciones anejas • Todas las instalaciones han sido autorizadas por la Comisión Nacional de Bioseguridad
  6. 6. Las plataformas de trabajo Bioquímica Microbiología Biología molecular Cultivos celulares Organismos modelo Escalado Fermentación Metabolómica Modelos murinos Genómica
  7. 7. La principal fortaleza • En el grupo Biopolis trabajan 43 personas (36 en Biopolis SL y 7 en Lifesequencing SL) • La mayoría son doctores (18) o licenciados (15); el resto son FP de grado superior (10) • Nuestra plantilla incluye biólogos, biotecnólogos, farmacéuticos, informáticos, ingenieros agrónomos e ingenieros químicos, químicos, tecnólogos de alimentos, abogados y economistas
  8. 8. El proyecto SENIFOOD Mejorar la calidad de vida de las personas mayores por medio de la alimentación a través de la formulación de dietas equilibradas de acuerdo con carencias nutricionales o patologías propias de las personas mayores o derivadas del envejecimiento
  9. 9. Objetivos de Biopolis SL en SENIFOOD Péptidos InflamaciónProbióticos Alzheimer
  10. 10. Ingredientes funcionales para la tercera edad 1. El proyecto SENIFOOD 2. A la búsqueda de péptidos bioactivos 3. ES1: un probiótico contra la inflamación 4. Conclusiones
  11. 11. La enfermedad de Alzheimer Estrés oxidativo Inflamación Degeneración neuronal Haces neurofibrilares Inhibición de PEP Efecto antioxidante in vivo Efecto antiagregante in vivo
  12. 12. Escrutinio de residuos agroalimentarios Z-gly-pro-ρNA ρNA PEP OD410 ± producto Estrés oxidativo (3mM H2O2) 5 horas 5 días - CCX + CCX Viables C. elegans Wild-type N2 1 2 3 Δt
  13. 13. El barquillo de cacao
  14. 14. Péptidos desde el barquillo de cacao Hydrophobic Interaction chromatography (HIC) HIDRÓLISIS PROTEÍCA FRACCIONES HIC FRACCIONES HIC POSITIVAS Reverse Phase Chromatography (RPC) FRACCIONES RPC FRACCIONES RPC POSITIVAS MALDI-TOF “COCOA BARQUILLO” IDENTIFICACIÓN DE LOS PÉPTIDOS
  15. 15. Identificación del péptido Theobroma cacao 21 kDa seed protein (221 aas) FRACCIONES RPC POSITIVAS IDENTIFICACIÓN MALDI-TOF SECUENCIAS PEPTÍDICAS (17 péptidos) mktatavvlllfaftsksyffgvanaanspvldtdgdelqtgvqyyvlssisgagggglalgratgqscpeivvqr rsdldngtpvifsnadskddvvrvstdvniefvpirdrlcststvwrldnydnsagkwwvttdgvkgepgpnt lcswfkiekagvlgykfrfcpsvcdscttlcsdigrhsdddgqirlalsdnewawmfkkasktikqvvnakh B. Muguerza, H. Monzó, N. Alepuz, E. Bataller, S. Genovés, M. Enrique, P. Martorell, D. Ramón. (2010). Obtainment of cocoa extracts rich in bioactive peptides with inhibiting activity of ACE and PEP enzymes. EP2322041A1 E. Bataller, S. Genovés, P. Martorell, D. Ramón, A. Ibañez, S. Llopis, N. González, H. Monzó, B. Muguerza. (2011). Obtainment of bioactive products from cocoa having inhibitory activity against the PEP enzyme and antioxidant and/or anti-neurodegenerative activity. WO2011/076954A1
  16. 16. Resultados 0 10 20 30 40 50 60 70 80 NGM NGM+vitaminC 9L 11R 13L 13R %WormSurvival(C.elegansN2) AntioxidantActivity 24 41 43 45 47 49 51 53 0 25 50 75 100 125 NGM ZPP 9L 11R 13L 13R not induced Time (h) PercentageNotparalyzed • Paralysis assay IC50 PEP 13-mer (0.19 mg/ml) [13-mer] mg/ml 0,0001 0,001 0,01 0,1 1 %Inhibition -20 0 20 40 60 80 100 • El valor IC50 más bajo para la inhibición de PEP lo dió el péptido 13L-mer (0.19 mg/mL) • Este péptido presentó la mayor actividad antioxidante in vivo • También fue el más eficaz en la reducción de la parálisis • Curiosamente, el péptido 13L-mer inhibe in vitro la enzima humana PLA2 • Hemos detectado trazas de este péptido en chocolates comerciales Actividad antioxidante ParálisisInhibición PEP
  17. 17. Transcriptómica PÉPTIDO 13L-mer Regulación Metabolismo del piruvato Regulación Proteasoma Regulación Metabolismo del triptófano Acetil coA Turnover de proteínas Serotonina Función sináptica Reducción del agregado amiloide Locomoción Apetito REDUCCIÓN DE LA TOXICIDAD DE Aβ
  18. 18. Inhibición de la agregación de Aβ 25 112 30 61 13 Tubulina Placebo 13L Ratiodeagregación 0 0,2 0,4 0,6 0,8 1 1,2 Martorell P, Bataller E, Llopis S, González N, Álvarez B, Montón F, Ortíz P, Ramón D, Genovés S. A cocoa peptide protects Caenorhabditis elegans from oxidative stress and β-amyloid peptide toxicity. PLOS ONE 8: e63283
  19. 19. Ingredientes funcionales para la tercera edad 1. El proyecto SENIFOOD 2. A la búsqueda de péptidos bioactivos 3. ES1: un probiótico contra la inflamación 4. Conclusiones
  20. 20. Origen de la cepa • La cepa ES1 fué aislada por el grupo de la Dra. Yolanda Sanz en el Instituto de Agroquímica y Tecnología de Alimentos del Consejo Superior de Investigaciones Científicas en Valencia • Se aisló a partir de las heces de un niño sano, menor de tres meses y sometido a lactancia materna • Mediante taxonomía molecular (secuenciación de la región del gen que codifica el rRNA 16S) se ha clasificado como un miembro de la especie Bifidobacterium longum • Dicha especie está incluida en los listados GRAS y QPS de la Food and Drug Administration y la European Food Safety Agency, respectivamente • La cepa está protegida por una patente y depositada en la Colección Española de Cultivos Tipo bajo el código CECT 7347; esta patente fue licenciada en exclusiva a Biopolis SL y está transferida a varios países
  21. 21. Respuesta anti-inflamatoria en células PBMC • Se ha realizado un estudio con heces coincubadas con la cepa ES1 y se diseñaron controles negativos sin la cepa; las muestras se usaron posteriormente para estimular células mononucleares de sangre periférica (PBMC) provenientes de individuos adultos sano • Las heces de los individuos con inflamación dieron lugar a un incremento de la producción de TNFα y la expresión de CD86 y a una disminución de la producción de IL-10 y la expresión de CD4 • Las heces coincubadas con la cepa ES1 suprimieron esta respuesta pro-inflamatoria e incrementaron la producción de IL-10
  22. 22. • Se hicieron experimentos similares con células Caco-2 • Se midieron los niveles de transcripción de los genes que codifican el receptor CXCR3, NFκβ y TNFα • Por ELISA se analizaron los niveles de las proteínas correspondientes y de IL-1β y p50 • Los cultivos celulares coincubados con la cepa ES1 tenían reducidos los niveles de transcripción y, consecuentemente, las concentraciones celulares de IL-1β, NFκβ , p50 y TNFα Respuesta anti-inflamatoria en células Caco-2
  23. 23. Respuesta anti-inflamatoria en células dendríticas • Se investigó la interacción de la cepa ES1 con células dendríticas derivadas de monocitos (CDDM), en combinación con gliadinas y células Caco-2 • Al contrario que algunas cepas patógenas(Escherichia coli o Shigella CBD8), la cepa ES1 indujo mínimos cambios morfológicos en las células CDDM y activó menos la adhesión, la propagación y la producción de citoquinas inflamatorias • Además, promovió una menor inducción de la expresión de CD86 y CD40 y una reducción en la producción inducida por gliadinas de IFN-γ, y dio lugar a un incremento en la secreción de IL-10
  24. 24. Estudio preclínico de efectividad en ratas B. longum ES1 Placebo • Se usó un modelo de enteropatía inducida por gliadinas utilizando ratas recién nacidas sensibilizadas con IFN-γ que fueron alimentadas con la cepa ES1 frente a un grupo control alimentadas con placebo • Las ratas alimentadas con la cepa ES1 tenían importantes cambios en la morfología del epitelio intestinal • En concreto, era posible detectar en las ratas de este grupo una restauración de la altura de los enterocitos, una de las características negativas de la enfermedad celiaca
  25. 25. Respuesta anti-inflamatoria en animales • Además, en los dos grupos se analizó la producción de componentes del sistema inmunitario y se estudió la microbiota de las heces • Los yeyunos de las ratas alimentadas con la cepa ES1 contenían menos TNF-α y más IL-10
  26. 26. Estudios de seguridad alimentaria in vitro • Se evaluó la seguridad alimentaria del probiótico ES1 siguiendo las recomendaciones de FAO y OMS • Se analizó la producción de metabolitos no deseados (aminas biogenas, ratio D-láctico/L-láctico y sales biliares desconjugadas,) no detectándose valores problemáticos • Se determinaron los break-points de una veintena de antibióticos de uso clínico y no se detectó resistencia significativa a alguno de ellos
  27. 27. Estudios de seguridad alimentaria in vivo • En colaboración con el Instituto Pasteur de Montevideo, se llevó a cabo un estudio de ingesta aguda de la cepa ES1 (109 ufc/día) en ratones BALB/c sanos o sometidos a inmunodepresión por tratamiento con ciclofosfamida • No se detectó mortalidad ni patologías asociadas a la ingesta de la cepa • Tampoco se observó translocación de la cepa, pudiéndose concluir la seguridad alimentaria de la misma
  28. 28. Secuenciación del genoma de la cepa • Se ha secuenciado el genoma de la cepa ES1 utilizando técnicas de pirosecuenciación genómica masiva • El genoma de la cepa ES1 tiene aproximadamente 2.5 Mb • En total se dispone de casi 75 Mb de información (aproximadamente 30X de secuencia del genoma) • No se detectan genes de virulencia o factores de patogenicidad • No hay genes funcionales de resistencia a antibióticos
  29. 29. Escalado de producción • Se ha escalado la fermentación de la cepa ES1, desde el laboratorio a la planta piloto y desde la planta piloto a la planta de producción • El proceso de fermentación ya está optimizado • También se ha escalado y optimizado el proceso de secado por liofilización
  30. 30. Ensayo clínico fase I • Se llevó a cabo con 12 voluntarios humanos (edad media 30.3 años, rango de 23 a 40 años); fue un ensayo doble ciego, aletaorio y con control de placebo • Los voluntarios ingirieron la cepa ES1 o el placebo durante dos semanas (109 ufc/día), posteriormente se realizó un período de lavado de 2 semanas y luego se siguió la ingesta cruzada durante otras 3 semanas • La ingesta de la cepa ES1 no produjo efectos adversos • La microbiota de las heces de los individuos control frente a los que habían ingerido la cepa ES1 no presentó diferencias significativas, si bien el 70-80% de las cepas de bifidobacterias en los individuos problema eran la cepa ES1
  31. 31. Ensayo clínico fase II (I) • Se llevó a cabo un ensayo doble ciego, aletaorio y con control de placebo sobre 40 niños celiacos voluntarios de edades comprendidas entre los 2 y los 14 años (Hospital Universitari Sant Joan de Reus y Hospital Sant Joan de Déu de Barcelona) • Uno de los grupos recibió la cepa ES1 durante 3 meses en una dosis diaria de 109 ufc y el otro recibió un placebo • Al analizar sangre periférica se detectó una disminución de la concentración de TNF-α y de linfocitos CD3+ • Finalmente, los individuos del grupo que había ingerido el probiótico presentaron una mayor talla y peso (si bien en este último caso la diferencia no fue estadísticamente significativa)
  32. 32. Ensayo clínico fase II (II) • El estudio de la microbiota de los dos grupos reveló datos muy interesantes • Se detectó una disminución estadísticamente significativa de Bacteroides y Clostridium en el grupo que recibió el probiótico ES1 frente al grupo que recibe el placebo • El grupo que recibió la cepa ES1 presentó mayores recuentos de bifidobacterias, aunque los datos no fueron estadísticamente significativos
  33. 33. Dossier científico • Izquierdo E, Medina M, Ennahar S, Marchioni E, Sanz . (2008). Resistance to simulated gastrointestinal condtions and adhesions to mucus as probiotic criteria for Bifidobacterium longum strains. Current Microbiology 56: 613-618 • Medina M, de Palma G, Ribes-Koninckx C, Calabuig M, Sanz Y. (2008). Bifidobacterium strains suppress in vitro the pro-inflammatory milieu triggered by the large intestinal microbiota of coeliac patients. Journal of Inflammation 3: 5-19 • Laparra JM, Sanz Y. (2010). Bifidobacteria inhibit the inflammatory response induced by gliadins in intestinal epithelial cells via modifications of toxic peptide generation during digestion. Journal of Cell Biochemistry 109: 801-807 • Olivares M, Laparra M, Sanz Y. (2011). Influence of Bifidobacterium longum CECT 7347 and gliadin peptides on intestinal epithelial cell proteome. Journal of Agricultural and Food Chemistry 59: 7666-7671 • Laparra JM, Olivares M, Gallina O, Sanz Y. (2012). Bifidobacterium longum CECT7347 modulates immune responses in a gliadin-induced enteropathy animal model. PLoS ONE 7: e30744 • de Palma G, Kamanova J, Cinova J, Olivares M, Drasarova H, Tuckova L, Sanz Y. (2012). Modulation of phenotypic and functional maturation of dendritic cells by intestinal bacteria and gliadin: relevance for celiac disease. Journal of Leukocyte Biology 92: 1043-1054 • Olivares M, Laparra M, Sanz Y. (2012). Oral administration of Bifidobacterium longum CECT 7347 modulates jejunal proteome in an in vivo gliadin-induced enteropathy animal model. Journal of Proteomics 77: 310-320 • Chenoll E, Codoñer FM, Silva A. Ibañez, Martínez-Blanch JF, Bollati-Fogolin M, Sanz Y, Ramón D, Genovés S. (2013). Genomic sequence and pre-clinical safety assessment of Bifidobacterium longum CECT7347, a probiotic able to reduce the toxicity and inflammatory potential of gliadin-derived peptides. Journal of Probiotics and Health 1: 106 doi:10.4172/jph.1000106 • Laparra JM, Olivares M, Sanz Y. (2013). Oral administration of Bifidobacterium longum CECT 7347 ameliorates gliadin-induced alterations in liver iron mobilization. British Journal of Nutrition 110: 1828-1836 • Olivares M, Castillejo G, Varea V, Sanz Y. (2013). Double-blind, randomized, placebo-controlled intervention trial to evaluate the effects of Bifidobacterium longum CECT 7347 on children with newly diagnosed celiac disease. Aceptado en British Journal of Nutrition
  34. 34. El producto Proceliac
  35. 35. Ingredientes funcionales para la tercera edad 1. El proyecto SENIFOOD 2. A la búsqueda de péptidos bioactivos 3. ES1: un probiótico contra la inflamación 4. Conclusiones
  36. 36. Biología de sistemas: clave de futuro • Nuestra experiencia de I+D con clientes nos ha enseñado que un abordaje genómico/metabolómico es clave para entender el fondo real de los problemas industriales • Estamos empezando a entender la biología de sistemas a través de nuestros proyectos internos de I+D • No nos creemos el binomio ciencia básica versus ciencia aplicada • Nos gusta el modelo de interacción con lo público que siguen algunos de nuestros clientes en Holanda, Suiza y países nórdicos
  37. 37. El ejemplo de los líderes
  38. 38. Daniel Ramón Vidal (daniel.ramon@biopolis.es) http://www.linkedin.com/profile/view?id=64921252&trk=tab_pro Biopolis SL Parc Cientific Universitat de València C/ Catedrático Agustín Escardino Benlloch 9; Edificio B; 469809-Paterna; Valencia

×