SlideShare a Scribd company logo
1 of 19
The traditional speed camera warning only alerts you based on the distance to the camera,
which usually results in dangerous hard brakes if driving in high speed.
Mio SmartAlerts warns you the upcoming cameras based your current diving speed, offering
you extra distance and enough time to safely slow down
Mio Smart Speed Cam Alert*
Driving Safety Technology
Mio
GPS SpeedCam Alert
Video locking table – file allocation
Find your files quick and easy
Video/Images are grouped in different folders for easy finding. Our
dashcam offers the intuitive memory management tool to know how
your internal memory allocated and find the most important files in
specific folder without navigating through files
Videos recorded by
Event mode
PhotosVideo recorded
by Parking Mode
Videos
Driving Safety Technology
*MiVue 698, 658 WIFI supports Parking Mode
Playback on dash cam, or PC
Google Map support
Video playback on device
Connect to PC or Mac :
• Direction & G-force analysis
• Google map overlay of video*
• Export file of collision information
• Social media sharing
• Safety camera updates*
^Windows 7 or later. MAC OSX 10.7 or later
Driving Safety Technology
Easily switch front and rear
video on main screen & sub
screen while play video on PC
2-CH record
on device: PIP
Adjustment when darkness Adjustment when brightness
WDR Support
Automatically optical adjustment to have better
video quality in darkness or brightness
Driving Safety Technology
How to :
close to speed cam location
Data review :
In Cruise Speed Alert menu to review
all custom speed cam data
Click
Custom Speed Cam
Adding a custom speed cam
Next time drive approach to same location
then can have warning alarm
*Only available in GPS models
Driving Safety Technology
Setting speed
Over speeding
Visual and audio alarm
Cruise Speed Alert
Over speeding alert
108 km/h
*Only available in GPS models
Driving Safety Technology
Photo Image with Coordinate
Still image has GPS coordinate data in EXIF
*Only available in GPS models
Driving Safety Technology
Turn off vehicle engine, system enable motion
detection and collision detection function to
secure every emergency video be saved
Parking Mode – Motion detection Parking Mode – Collision detection
Driving Safety Technology
Smart Box Cable  36 Hours Continuous Recording
 Vehicle Battery voltage setting
 Latest Motion Detection technology
 Provides the ultimate power supply
 Protects your vehicle battery run out
with Parking Mode
 4 different voltage/time settings
Best Parking Monitor Solution
(option accessory – SmartBox)
HUD Display Mode
While you driving, not to disturb your view
Display Current Timing, Speed and Recording Status on screen,
and Speed Cam Alert to remind you the coming speed cam.
Current
speed
Distance to the
safety camera
Speed limit
Driving Safety Technology
2-CH with Rear Camera (MiVue A20)
 MiVue 698 support A20 rear cam
accessories kit, offering 2-CH videos
recordings with 1296p+1080p videos.
Driving Safety Technology
Front camera Rear camera
*MiVue 698 supports A20 rearcam accessories kit
Support up to 128G microSD card
• Support up to 128G microSD card
•MiVue C320 continue recording up to 22 hours
•MiVue 698 continue recording up to 20 hours
•MiVue 698 with A20, 2-CH continue recording up to 10 hours
128G
Driving Safety Technology
20+ hours
ADAS
(Advanced Driver Assistance Systems)
Software add-on features
• LDWS
• FCWS
• Head-light reminding
• Fatigue alert
• Eco drive
Driving Safety Technology
LDWS
Lane Departure Warning System
* GPS speed 60Km auto activate
Driver safety feature of lane departure
warning system
Youtube video:
https://www.youtube.com/watch?v=WzqRvLoV4wc
FCWS
Forward Collision Warning System
*GPS speed over 5km, frontal vehicle 5m~15m
Driver safety feature of forward collision
warning system
Driver Fatigue Alert
Driver safety technology which helps
prevent accidents caused by the driver
getting drowsy
With fatigue warming function improve driver safety! Various
studies have suggested that around 20% of all road accidents are
fatigue-related, up to 50% on certain roads.
Head-light reminding
Remind driver they should turn on the light
When get into tunnel or parking lot in basement, will remind
driver they should turn on the light for safety.
Eco Drive
Base on driving behavior display the degree
by different color.
Reduce speeding, rapid acceleration, and harsh breaking will prevent you from getting into
accidents and other dangerous situations, also saving oil with better energy perform.
MiVue manager (PC player for 2-CH)
RearCam video
Date + time + model name
(model name: MiVue A20)
Switch front camera video,
or rear camera video
Front Camera video
model name + date + time + Lat/Log
or G-sensor, + speed
Switch dashboard, or
GoogleMpas
F: front camera video
R: Rear camera video

More Related Content

What's hot

2015 Kia Sportage | Stroudsburg Area Kia Dealer
2015 Kia Sportage | Stroudsburg Area Kia Dealer2015 Kia Sportage | Stroudsburg Area Kia Dealer
2015 Kia Sportage | Stroudsburg Area Kia Dealerelectriccitykia
 
2011 Nissan 370 Z Roadster Tyler Texas
2011 Nissan 370 Z Roadster Tyler Texas2011 Nissan 370 Z Roadster Tyler Texas
2011 Nissan 370 Z Roadster Tyler TexasPeltier Nissan
 
2013 Ford Escape Specs
2013 Ford Escape Specs2013 Ford Escape Specs
2013 Ford Escape SpecsAlex Automan
 
2011 Nissan Juke Tyler Texas
2011 Nissan Juke Tyler Texas2011 Nissan Juke Tyler Texas
2011 Nissan Juke Tyler TexasPeltier Nissan
 
BMW 3 Series Gran Turismo Sport Line techspecs
BMW 3 Series Gran Turismo Sport Line techspecsBMW 3 Series Gran Turismo Sport Line techspecs
BMW 3 Series Gran Turismo Sport Line techspecsRushLane
 
Embedded system in automobile
Embedded system in automobileEmbedded system in automobile
Embedded system in automobileAali Aalim
 
Gladius video management software.
Gladius video management software.Gladius video management software.
Gladius video management software.Mindtree Ltd.
 
Detailed technolgy-selfdrivingcars
Detailed technolgy-selfdrivingcarsDetailed technolgy-selfdrivingcars
Detailed technolgy-selfdrivingcarsmarissakillpack23
 
Advance Safety Systems in automobile
Advance Safety Systems in automobileAdvance Safety Systems in automobile
Advance Safety Systems in automobilegunjan panchal
 
Embedded system in automobile
Embedded system in automobile Embedded system in automobile
Embedded system in automobile Swaraj Nayak
 
Peugeot 5008 Range Brochure
Peugeot 5008 Range BrochurePeugeot 5008 Range Brochure
Peugeot 5008 Range BrochurepeugeotUK
 

What's hot (18)

2015 Kia Sportage | Stroudsburg Area Kia Dealer
2015 Kia Sportage | Stroudsburg Area Kia Dealer2015 Kia Sportage | Stroudsburg Area Kia Dealer
2015 Kia Sportage | Stroudsburg Area Kia Dealer
 
2011 Nissan 370 Z Roadster Tyler Texas
2011 Nissan 370 Z Roadster Tyler Texas2011 Nissan 370 Z Roadster Tyler Texas
2011 Nissan 370 Z Roadster Tyler Texas
 
2013 Ford Escape Specs
2013 Ford Escape Specs2013 Ford Escape Specs
2013 Ford Escape Specs
 
2015 Kia Sorento Brochure Vehicle Details Mandan Bismarck Dealership - Bill B...
2015 Kia Sorento Brochure Vehicle Details Mandan Bismarck Dealership - Bill B...2015 Kia Sorento Brochure Vehicle Details Mandan Bismarck Dealership - Bill B...
2015 Kia Sorento Brochure Vehicle Details Mandan Bismarck Dealership - Bill B...
 
2011 Nissan Juke Tyler Texas
2011 Nissan Juke Tyler Texas2011 Nissan Juke Tyler Texas
2011 Nissan Juke Tyler Texas
 
BMW 3 Series Gran Turismo Sport Line techspecs
BMW 3 Series Gran Turismo Sport Line techspecsBMW 3 Series Gran Turismo Sport Line techspecs
BMW 3 Series Gran Turismo Sport Line techspecs
 
Embedded system in automobile
Embedded system in automobileEmbedded system in automobile
Embedded system in automobile
 
Gladius video management software.
Gladius video management software.Gladius video management software.
Gladius video management software.
 
2015 fusion
2015 fusion2015 fusion
2015 fusion
 
Irin1223
Irin1223Irin1223
Irin1223
 
Cdi manual-forerunner 910-xt
Cdi manual-forerunner 910-xtCdi manual-forerunner 910-xt
Cdi manual-forerunner 910-xt
 
D3000 e nnoprint
D3000 e nnoprintD3000 e nnoprint
D3000 e nnoprint
 
Detailed technolgy-selfdrivingcars
Detailed technolgy-selfdrivingcarsDetailed technolgy-selfdrivingcars
Detailed technolgy-selfdrivingcars
 
Advance Safety Systems in automobile
Advance Safety Systems in automobileAdvance Safety Systems in automobile
Advance Safety Systems in automobile
 
Canon cug e519
Canon cug e519Canon cug e519
Canon cug e519
 
2015 explorer
2015 explorer2015 explorer
2015 explorer
 
Embedded system in automobile
Embedded system in automobile Embedded system in automobile
Embedded system in automobile
 
Peugeot 5008 Range Brochure
Peugeot 5008 Range BrochurePeugeot 5008 Range Brochure
Peugeot 5008 Range Brochure
 

Similar to Driving safety

Samsung Techwin | Business sales vertical solution railway
Samsung Techwin | Business sales vertical solution railwaySamsung Techwin | Business sales vertical solution railway
Samsung Techwin | Business sales vertical solution railwayAndriy Dudko
 
Carpa Sales Brochure - VT300
Carpa Sales Brochure - VT300Carpa Sales Brochure - VT300
Carpa Sales Brochure - VT300Mary-Jo Gouws
 
Mio MiVue 388 GPS enabled in car DVR
Mio MiVue 388 GPS enabled in car DVRMio MiVue 388 GPS enabled in car DVR
Mio MiVue 388 GPS enabled in car DVREugene Taylor
 
FLEETCAM 3g PP June 2016
FLEETCAM 3g PP June 2016FLEETCAM 3g PP June 2016
FLEETCAM 3g PP June 2016Sanda Paliso
 
Surfsight brochure
Surfsight brochureSurfsight brochure
Surfsight brochureSteve Bure
 
Palm oil Truck Anti Theft Solution
Palm oil Truck Anti Theft SolutionPalm oil Truck Anti Theft Solution
Palm oil Truck Anti Theft Solutionardentlover
 
Circuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IPCircuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IPguest022763
 
Circuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IPCircuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IPChema Alonso
 
iGPS- Vehicle & Personal Tracking Solution
iGPS- Vehicle & Personal Tracking SolutioniGPS- Vehicle & Personal Tracking Solution
iGPS- Vehicle & Personal Tracking SolutionSatya Patri
 
Mobile surveillance for public bus 2020
Mobile surveillance for public bus 2020Mobile surveillance for public bus 2020
Mobile surveillance for public bus 2020EcoTelematics Sofjins
 
Learn about ACETECH Solutions
Learn about ACETECH SolutionsLearn about ACETECH Solutions
Learn about ACETECH SolutionsACETECH
 
Frost & Sullivan Das Active Safety
Frost & Sullivan  Das Active SafetyFrost & Sullivan  Das Active Safety
Frost & Sullivan Das Active Safetylambrechtp
 
Altra - Fleet Management (User).pdf
Altra - Fleet Management (User).pdfAltra - Fleet Management (User).pdf
Altra - Fleet Management (User).pdfChapoGuevarra
 
Digital Watchdog DWC-MV421TIRB User Manual
Digital Watchdog DWC-MV421TIRB User ManualDigital Watchdog DWC-MV421TIRB User Manual
Digital Watchdog DWC-MV421TIRB User ManualJMAC Supply
 

Similar to Driving safety (20)

Samsung Techwin | Business sales vertical solution railway
Samsung Techwin | Business sales vertical solution railwaySamsung Techwin | Business sales vertical solution railway
Samsung Techwin | Business sales vertical solution railway
 
Carpa Sales Brochure - VT300
Carpa Sales Brochure - VT300Carpa Sales Brochure - VT300
Carpa Sales Brochure - VT300
 
Mio MiVue 388 GPS enabled in car DVR
Mio MiVue 388 GPS enabled in car DVRMio MiVue 388 GPS enabled in car DVR
Mio MiVue 388 GPS enabled in car DVR
 
Business Profile
Business ProfileBusiness Profile
Business Profile
 
FLEETCAM 3g PP June 2016
FLEETCAM 3g PP June 2016FLEETCAM 3g PP June 2016
FLEETCAM 3g PP June 2016
 
IJIREEICE 45
IJIREEICE 45IJIREEICE 45
IJIREEICE 45
 
Surfsight brochure
Surfsight brochureSurfsight brochure
Surfsight brochure
 
Trucking technology
Trucking technologyTrucking technology
Trucking technology
 
Curiosity + uav
Curiosity + uavCuriosity + uav
Curiosity + uav
 
Palm oil Truck Anti Theft Solution
Palm oil Truck Anti Theft SolutionPalm oil Truck Anti Theft Solution
Palm oil Truck Anti Theft Solution
 
Circuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IPCircuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IP
 
Circuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IPCircuitos de Video Vigilancia IP
Circuitos de Video Vigilancia IP
 
iGPS- Vehicle & Personal Tracking Solution
iGPS- Vehicle & Personal Tracking SolutioniGPS- Vehicle & Personal Tracking Solution
iGPS- Vehicle & Personal Tracking Solution
 
Mobile surveillance for public bus 2020
Mobile surveillance for public bus 2020Mobile surveillance for public bus 2020
Mobile surveillance for public bus 2020
 
Mdvr H264
Mdvr H264Mdvr H264
Mdvr H264
 
Curiosity plus-uav
Curiosity plus-uavCuriosity plus-uav
Curiosity plus-uav
 
Learn about ACETECH Solutions
Learn about ACETECH SolutionsLearn about ACETECH Solutions
Learn about ACETECH Solutions
 
Frost & Sullivan Das Active Safety
Frost & Sullivan  Das Active SafetyFrost & Sullivan  Das Active Safety
Frost & Sullivan Das Active Safety
 
Altra - Fleet Management (User).pdf
Altra - Fleet Management (User).pdfAltra - Fleet Management (User).pdf
Altra - Fleet Management (User).pdf
 
Digital Watchdog DWC-MV421TIRB User Manual
Digital Watchdog DWC-MV421TIRB User ManualDigital Watchdog DWC-MV421TIRB User Manual
Digital Watchdog DWC-MV421TIRB User Manual
 

Recently uploaded

BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,
BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,
BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,noida100girls
 
Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...
Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...
Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...lizamodels9
 
2024 Numerator Consumer Study of Cannabis Usage
2024 Numerator Consumer Study of Cannabis Usage2024 Numerator Consumer Study of Cannabis Usage
2024 Numerator Consumer Study of Cannabis UsageNeil Kimberley
 
Ten Organizational Design Models to align structure and operations to busines...
Ten Organizational Design Models to align structure and operations to busines...Ten Organizational Design Models to align structure and operations to busines...
Ten Organizational Design Models to align structure and operations to busines...Seta Wicaksana
 
Market Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 EditionMarket Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 EditionMintel Group
 
Youth Involvement in an Innovative Coconut Value Chain by Mwalimu Menza
Youth Involvement in an Innovative Coconut Value Chain by Mwalimu MenzaYouth Involvement in an Innovative Coconut Value Chain by Mwalimu Menza
Youth Involvement in an Innovative Coconut Value Chain by Mwalimu Menzaictsugar
 
Organizational Structure Running A Successful Business
Organizational Structure Running A Successful BusinessOrganizational Structure Running A Successful Business
Organizational Structure Running A Successful BusinessSeta Wicaksana
 
Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024Kirill Klimov
 
Kenya’s Coconut Value Chain by Gatsby Africa
Kenya’s Coconut Value Chain by Gatsby AfricaKenya’s Coconut Value Chain by Gatsby Africa
Kenya’s Coconut Value Chain by Gatsby Africaictsugar
 
Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...
Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...
Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...lizamodels9
 
Buy gmail accounts.pdf Buy Old Gmail Accounts
Buy gmail accounts.pdf Buy Old Gmail AccountsBuy gmail accounts.pdf Buy Old Gmail Accounts
Buy gmail accounts.pdf Buy Old Gmail AccountsBuy Verified Accounts
 
Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...
Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...
Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...lizamodels9
 
Keppel Ltd. 1Q 2024 Business Update Presentation Slides
Keppel Ltd. 1Q 2024 Business Update  Presentation SlidesKeppel Ltd. 1Q 2024 Business Update  Presentation Slides
Keppel Ltd. 1Q 2024 Business Update Presentation SlidesKeppelCorporation
 
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptxContemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptxMarkAnthonyAurellano
 
Future Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted VersionFuture Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted VersionMintel Group
 
FULL ENJOY Call girls in Paharganj Delhi | 8377087607
FULL ENJOY Call girls in Paharganj Delhi | 8377087607FULL ENJOY Call girls in Paharganj Delhi | 8377087607
FULL ENJOY Call girls in Paharganj Delhi | 8377087607dollysharma2066
 
Digital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdfDigital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdfJos Voskuil
 
Annual General Meeting Presentation Slides
Annual General Meeting Presentation SlidesAnnual General Meeting Presentation Slides
Annual General Meeting Presentation SlidesKeppelCorporation
 

Recently uploaded (20)

BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,
BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,
BEST Call Girls In Old Faridabad ✨ 9773824855 ✨ Escorts Service In Delhi Ncr,
 
Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...
Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...
Call Girls In Sikandarpur Gurgaon ❤️8860477959_Russian 100% Genuine Escorts I...
 
2024 Numerator Consumer Study of Cannabis Usage
2024 Numerator Consumer Study of Cannabis Usage2024 Numerator Consumer Study of Cannabis Usage
2024 Numerator Consumer Study of Cannabis Usage
 
Ten Organizational Design Models to align structure and operations to busines...
Ten Organizational Design Models to align structure and operations to busines...Ten Organizational Design Models to align structure and operations to busines...
Ten Organizational Design Models to align structure and operations to busines...
 
Market Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 EditionMarket Sizes Sample Report - 2024 Edition
Market Sizes Sample Report - 2024 Edition
 
Youth Involvement in an Innovative Coconut Value Chain by Mwalimu Menza
Youth Involvement in an Innovative Coconut Value Chain by Mwalimu MenzaYouth Involvement in an Innovative Coconut Value Chain by Mwalimu Menza
Youth Involvement in an Innovative Coconut Value Chain by Mwalimu Menza
 
Corporate Profile 47Billion Information Technology
Corporate Profile 47Billion Information TechnologyCorporate Profile 47Billion Information Technology
Corporate Profile 47Billion Information Technology
 
Organizational Structure Running A Successful Business
Organizational Structure Running A Successful BusinessOrganizational Structure Running A Successful Business
Organizational Structure Running A Successful Business
 
Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024Flow Your Strategy at Flight Levels Day 2024
Flow Your Strategy at Flight Levels Day 2024
 
Kenya’s Coconut Value Chain by Gatsby Africa
Kenya’s Coconut Value Chain by Gatsby AfricaKenya’s Coconut Value Chain by Gatsby Africa
Kenya’s Coconut Value Chain by Gatsby Africa
 
Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...
Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...
Call Girls In Radisson Blu Hotel New Delhi Paschim Vihar ❤️8860477959 Escorts...
 
Buy gmail accounts.pdf Buy Old Gmail Accounts
Buy gmail accounts.pdf Buy Old Gmail AccountsBuy gmail accounts.pdf Buy Old Gmail Accounts
Buy gmail accounts.pdf Buy Old Gmail Accounts
 
Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...
Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...
Call Girls In Connaught Place Delhi ❤️88604**77959_Russian 100% Genuine Escor...
 
Keppel Ltd. 1Q 2024 Business Update Presentation Slides
Keppel Ltd. 1Q 2024 Business Update  Presentation SlidesKeppel Ltd. 1Q 2024 Business Update  Presentation Slides
Keppel Ltd. 1Q 2024 Business Update Presentation Slides
 
Japan IT Week 2024 Brochure by 47Billion (English)
Japan IT Week 2024 Brochure by 47Billion (English)Japan IT Week 2024 Brochure by 47Billion (English)
Japan IT Week 2024 Brochure by 47Billion (English)
 
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptxContemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
Contemporary Economic Issues Facing the Filipino Entrepreneur (1).pptx
 
Future Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted VersionFuture Of Sample Report 2024 | Redacted Version
Future Of Sample Report 2024 | Redacted Version
 
FULL ENJOY Call girls in Paharganj Delhi | 8377087607
FULL ENJOY Call girls in Paharganj Delhi | 8377087607FULL ENJOY Call girls in Paharganj Delhi | 8377087607
FULL ENJOY Call girls in Paharganj Delhi | 8377087607
 
Digital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdfDigital Transformation in the PLM domain - distrib.pdf
Digital Transformation in the PLM domain - distrib.pdf
 
Annual General Meeting Presentation Slides
Annual General Meeting Presentation SlidesAnnual General Meeting Presentation Slides
Annual General Meeting Presentation Slides
 

Driving safety

  • 1. The traditional speed camera warning only alerts you based on the distance to the camera, which usually results in dangerous hard brakes if driving in high speed. Mio SmartAlerts warns you the upcoming cameras based your current diving speed, offering you extra distance and enough time to safely slow down Mio Smart Speed Cam Alert* Driving Safety Technology Mio GPS SpeedCam Alert
  • 2. Video locking table – file allocation Find your files quick and easy Video/Images are grouped in different folders for easy finding. Our dashcam offers the intuitive memory management tool to know how your internal memory allocated and find the most important files in specific folder without navigating through files Videos recorded by Event mode PhotosVideo recorded by Parking Mode Videos Driving Safety Technology *MiVue 698, 658 WIFI supports Parking Mode
  • 3. Playback on dash cam, or PC Google Map support Video playback on device Connect to PC or Mac : • Direction & G-force analysis • Google map overlay of video* • Export file of collision information • Social media sharing • Safety camera updates* ^Windows 7 or later. MAC OSX 10.7 or later Driving Safety Technology Easily switch front and rear video on main screen & sub screen while play video on PC 2-CH record on device: PIP
  • 4. Adjustment when darkness Adjustment when brightness WDR Support Automatically optical adjustment to have better video quality in darkness or brightness Driving Safety Technology
  • 5. How to : close to speed cam location Data review : In Cruise Speed Alert menu to review all custom speed cam data Click Custom Speed Cam Adding a custom speed cam Next time drive approach to same location then can have warning alarm *Only available in GPS models Driving Safety Technology
  • 6. Setting speed Over speeding Visual and audio alarm Cruise Speed Alert Over speeding alert 108 km/h *Only available in GPS models Driving Safety Technology
  • 7. Photo Image with Coordinate Still image has GPS coordinate data in EXIF *Only available in GPS models Driving Safety Technology
  • 8. Turn off vehicle engine, system enable motion detection and collision detection function to secure every emergency video be saved Parking Mode – Motion detection Parking Mode – Collision detection Driving Safety Technology
  • 9. Smart Box Cable  36 Hours Continuous Recording  Vehicle Battery voltage setting  Latest Motion Detection technology  Provides the ultimate power supply  Protects your vehicle battery run out with Parking Mode  4 different voltage/time settings Best Parking Monitor Solution (option accessory – SmartBox)
  • 10. HUD Display Mode While you driving, not to disturb your view Display Current Timing, Speed and Recording Status on screen, and Speed Cam Alert to remind you the coming speed cam. Current speed Distance to the safety camera Speed limit Driving Safety Technology
  • 11. 2-CH with Rear Camera (MiVue A20)  MiVue 698 support A20 rear cam accessories kit, offering 2-CH videos recordings with 1296p+1080p videos. Driving Safety Technology Front camera Rear camera *MiVue 698 supports A20 rearcam accessories kit
  • 12. Support up to 128G microSD card • Support up to 128G microSD card •MiVue C320 continue recording up to 22 hours •MiVue 698 continue recording up to 20 hours •MiVue 698 with A20, 2-CH continue recording up to 10 hours 128G Driving Safety Technology 20+ hours
  • 13. ADAS (Advanced Driver Assistance Systems) Software add-on features • LDWS • FCWS • Head-light reminding • Fatigue alert • Eco drive Driving Safety Technology
  • 14. LDWS Lane Departure Warning System * GPS speed 60Km auto activate Driver safety feature of lane departure warning system Youtube video: https://www.youtube.com/watch?v=WzqRvLoV4wc
  • 15. FCWS Forward Collision Warning System *GPS speed over 5km, frontal vehicle 5m~15m Driver safety feature of forward collision warning system
  • 16. Driver Fatigue Alert Driver safety technology which helps prevent accidents caused by the driver getting drowsy With fatigue warming function improve driver safety! Various studies have suggested that around 20% of all road accidents are fatigue-related, up to 50% on certain roads.
  • 17. Head-light reminding Remind driver they should turn on the light When get into tunnel or parking lot in basement, will remind driver they should turn on the light for safety.
  • 18. Eco Drive Base on driving behavior display the degree by different color. Reduce speeding, rapid acceleration, and harsh breaking will prevent you from getting into accidents and other dangerous situations, also saving oil with better energy perform.
  • 19. MiVue manager (PC player for 2-CH) RearCam video Date + time + model name (model name: MiVue A20) Switch front camera video, or rear camera video Front Camera video model name + date + time + Lat/Log or G-sensor, + speed Switch dashboard, or GoogleMpas F: front camera video R: Rear camera video