SlideShare a Scribd company logo
1 of 27
Regulation of Myc-induced cell growth by the histonedemethylase Lid AECC May 5th, 2010
Myc genes are deregulated in human cancers Myc gene deregulated Cancer type c-myc Bladder, breast, colon, gastric, melanoma, myeloma, ovary, prostate, lung N-myc Neuroblastoma, breast, lung L-myc Breast, lung
Myc target genes - Myc target genes are involved in proliferation, vasculogenesis, cell adhesion  RNA POL I ribosomal RNA Myc RNA POL II Growth metabolism, translation,  ribosomal proteins RNA POL III tRNAs
Myc expression induces cell growth Control dMyc (GMM) Gal4 GMR Gal4 dMyc Gal4 UAS dMyc dMyc dMyc Expression of dMyc in post-mitotic cells during eye development GMR-Gal4, UAS-dMyc
Identifying regulators of dMyc-induced growth Co-activators Negative regulators dMyc dMyc targets Cell growth Large, rough eye
Identifying regulators of dMyc-induced growth Co-activators Negative regulators dMyc dMyc targets Cell growth Large, rough eye Less rough (suppressed)
Identifying regulators of dMyc-induced growth Co-activators Negative regulators dMyc dMyc targets Cell growth + apoptosis Large, rough eye More rough (enhanced)
GMM UAS-lid GMM lid +/- WT GMM -dMyc -Histone H3 Little ImaginalDiscs (Lid) is limiting for dMyc-induced cell growth GMM, lid/+ Control GMM
GMM UAS-lid GMM lid +/- WT GMM -dMyc -Histone H3 Little Imaginal Discs (Lid) is limiting for dMyc-induced cell growth GMM, lid/+ GMM, UAS-Lid  Control GMM
Lid and its orthologs JmjC PHD PHD PHD ARID JmjN C5HC2 Lid A. gambie Lid C. elegans rbr-2 H. sapiens KDM5a H. sapiens KDM5b H. sapiens KDM5c H. sapiens KDM5d D. rerio Lid ,[object Object]
 KDM5b is overexpressed in breast, bladder and prostate cancer
 The C-terminal finger of KDM5a forms an oncogenic fusion with Nup98,[object Object]
 Lid co-IPs with dMyc
 Lid is required for dMyc to activate Nop60B  ? Lid Nop60B E-box
JmjC is a lysine demethylase domain Nature, 2006 - JHDM1A demethylates histone H3 lysine 36 - Enzymatic activity requires the JmjC domain, Fe2+ and a-ketoglutarate
M M M M M M CH3 CH3 CH3 H3C CH3 CH3 trimethyl dimethyl monomethyl unmodified N+ NH+ NH2+ NH3+ JmjC-dependent demethylase activities H3 ARTKYTARKSTGGKAPRKQLATKAARKSAPATGGVK..K..K H4 SGRGKGGKGLGKGGAKRHRKVLR
What is the mechanism of Lid function? JmjC PHD PHD PHD ARID JmjN C5HC2 Is Lid a histone demethylase? Is this activity required for dMyc-induced cell growth?
Lid demethylates trimethyl H3 lysine 4 JmjC PHD PHD PHD ARID JmjN C5HC2 NLS hs-FLP ;            UAS-Lid                actin>CD2>Gal4, UAS-GFP GFP a-Lid a-H3K4me3 GFP Larval Fat Body Cells
Histone H3 lysine 4 methylation correlates with transcriptional activation Correlation with transcription + K4me3 + K4me2 +/- K4me1 Adapted from Li and Workman, 2007 - Lid’s demethylase activity implicates it as a transcriptional repressor
* * dMyc    Lid-JmjC* Lid’s JmjC-encoded demethylase activity is not required for dMyc function JmjC PHD PHD PHD ARID JmjN C5HC2 NLS dMyc    Lid dMyc - Expression of either wildtype or JmjC* Lid alone has no effect on eye development
Myc What is the mechanism of Lid function? ? Lid Nop60B E-box
Enhanced? dMyc    Lid dMyc dMyc    Lid-JmjC* dMyc    Lid-D Identifying domains of Lid required for Myc-induced cell growth? Lid domain UAS
Domains of Lid required for dMyc function Enhance dMyc phenotype? JmjN JmjC PHD PHD PHD ARID C5HC2 NLS * * X ( ) ( ) ( ) X ( ) ( ) nd X
TFIID TAF3 H3K4me3 Transcriptional initiation PHD fingers read the histone code Nurf BPTF Pygo BHC80 H3K4me0 H3K4me2 H3K4me2/3 Wnt-induced transcriptional activation Tethers the LSD1 repressor to chromatin Nucleosome remodeling
Lid’s PHD3 binds to H3K4me2/3 JmjN ARID PHD PHD PHD JmjC C5HC2 ECRAENCHKPTGREVDWVPCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT H3 21-40 H3K4 H3K9 H3K27 5% input H3 1-21 Beads H4 me1 me2 me3 me1 me2 me3 me1 me2 me3 49 PHD3 38
c-Myc binding correlates with high levels of di and trimethylated H3K4 - Histone H3 lysine 4 methylation precedes and is independent of Myc binding.
Working model for Lid-dMyc function Me Me Me Me Myc ? Activation ? Lid Me Me K4 K4 E-box Nop60B ,[object Object]

More Related Content

Similar to Session 5.1 Secombe (6)

Ganoderma lucidum
Ganoderma lucidumGanoderma lucidum
Ganoderma lucidum
 
Targeted Therapies for Breast Cancer
Targeted Therapies for Breast CancerTargeted Therapies for Breast Cancer
Targeted Therapies for Breast Cancer
 
Host Response
Host ResponseHost Response
Host Response
 
Anindya seminar 1 growth factors and cell cycle signalling in pathogenesis of...
Anindya seminar 1 growth factors and cell cycle signalling in pathogenesis of...Anindya seminar 1 growth factors and cell cycle signalling in pathogenesis of...
Anindya seminar 1 growth factors and cell cycle signalling in pathogenesis of...
 
Summary of ADC Targets For Solid Tumors & Hematological Tumors.pdf
Summary of ADC Targets For Solid Tumors & Hematological Tumors.pdfSummary of ADC Targets For Solid Tumors & Hematological Tumors.pdf
Summary of ADC Targets For Solid Tumors & Hematological Tumors.pdf
 
Ld b 145 geni mutanti_2014-11-18 jamora - ricerca scientifica 3
Ld b 145 geni mutanti_2014-11-18 jamora - ricerca scientifica 3Ld b 145 geni mutanti_2014-11-18 jamora - ricerca scientifica 3
Ld b 145 geni mutanti_2014-11-18 jamora - ricerca scientifica 3
 

More from Albert Einstein Cancer Center

More from Albert Einstein Cancer Center (20)

Advances Agenda Slide 2016
Advances Agenda Slide 2016Advances Agenda Slide 2016
Advances Agenda Slide 2016
 
Nciccwithsocialmedia
NciccwithsocialmediaNciccwithsocialmedia
Nciccwithsocialmedia
 
000 agenda
000   agenda000   agenda
000 agenda
 
The Biosketch format, SciENcv and the paper
The Biosketch format, SciENcv and the paperThe Biosketch format, SciENcv and the paper
The Biosketch format, SciENcv and the paper
 
Using MyNCBI & My Bibliography
Using MyNCBI & My BibliographyUsing MyNCBI & My Bibliography
Using MyNCBI & My Bibliography
 
Using MyNCBI & My Bibliography
Using MyNCBI & My BibliographyUsing MyNCBI & My Bibliography
Using MyNCBI & My Bibliography
 
The Biosketch format, SciENcv and the paper
The Biosketch format, SciENcv and the paperThe Biosketch format, SciENcv and the paper
The Biosketch format, SciENcv and the paper
 
Using My NCBI & My Bibliography
Using My NCBI & My BibliographyUsing My NCBI & My Bibliography
Using My NCBI & My Bibliography
 
Nih public access_policy
Nih public access_policyNih public access_policy
Nih public access_policy
 
Guide for My Bibliography and Compliance
Guide for My Bibliography and ComplianceGuide for My Bibliography and Compliance
Guide for My Bibliography and Compliance
 
Nciccwithsocialmedia
NciccwithsocialmediaNciccwithsocialmedia
Nciccwithsocialmedia
 
NCICC with socialmedia
NCICC with socialmediaNCICC with socialmedia
NCICC with socialmedia
 
04.2 kurland pc
04.2 kurland pc04.2 kurland pc
04.2 kurland pc
 
03.1 libutti pc
03.1 libutti pc03.1 libutti pc
03.1 libutti pc
 
02.3 gabeau mac
02.3 gabeau mac02.3 gabeau mac
02.3 gabeau mac
 
02.2 kaubisch pc
02.2 kaubisch pc02.2 kaubisch pc
02.2 kaubisch pc
 
02.1 kinkhabwala
02.1 kinkhabwala02.1 kinkhabwala
02.1 kinkhabwala
 
01.5 belbin aecc advances 2010 for web
01.5 belbin aecc advances 2010 for web01.5 belbin aecc advances 2010 for web
01.5 belbin aecc advances 2010 for web
 
01.4 steidl pc for upload
01.4 steidl pc for upload01.4 steidl pc for upload
01.4 steidl pc for upload
 
01.3 klampfer pc
01.3 klampfer pc01.3 klampfer pc
01.3 klampfer pc
 

Recently uploaded

Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...
Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...
Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...
Sheetaleventcompany
 
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Sheetaleventcompany
 
Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...
Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...
Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...
Sheetaleventcompany
 
Electrocardiogram (ECG) physiological basis .pdf
Electrocardiogram (ECG) physiological basis .pdfElectrocardiogram (ECG) physiological basis .pdf
Electrocardiogram (ECG) physiological basis .pdf
MedicoseAcademics
 
Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...
Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...
Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...
Sheetaleventcompany
 
Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...
Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...
Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...
Sheetaleventcompany
 
Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...
Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...
Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...
Sheetaleventcompany
 
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Sheetaleventcompany
 
Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...
Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...
Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...
Sheetaleventcompany
 

Recently uploaded (20)

Cardiac Output, Venous Return, and Their Regulation
Cardiac Output, Venous Return, and Their RegulationCardiac Output, Venous Return, and Their Regulation
Cardiac Output, Venous Return, and Their Regulation
 
Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...
Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...
Gorgeous Call Girls Dehradun {8854095900} ❤️VVIP ROCKY Call Girls in Dehradun...
 
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
Goa Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Goa No💰Advanc...
 
Bandra East [ best call girls in Mumbai Get 50% Off On VIP Escorts Service 90...
Bandra East [ best call girls in Mumbai Get 50% Off On VIP Escorts Service 90...Bandra East [ best call girls in Mumbai Get 50% Off On VIP Escorts Service 90...
Bandra East [ best call girls in Mumbai Get 50% Off On VIP Escorts Service 90...
 
Call 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room Delivery
Call 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room DeliveryCall 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room Delivery
Call 8250092165 Patna Call Girls ₹4.5k Cash Payment With Room Delivery
 
Circulatory Shock, types and stages, compensatory mechanisms
Circulatory Shock, types and stages, compensatory mechanismsCirculatory Shock, types and stages, compensatory mechanisms
Circulatory Shock, types and stages, compensatory mechanisms
 
Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...
Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...
Call Girl In Indore 📞9235973566📞 Just📲 Call Inaaya Indore Call Girls Service ...
 
Electrocardiogram (ECG) physiological basis .pdf
Electrocardiogram (ECG) physiological basis .pdfElectrocardiogram (ECG) physiological basis .pdf
Electrocardiogram (ECG) physiological basis .pdf
 
Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...
Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...
Dehradun Call Girls Service {8854095900} ❤️VVIP ROCKY Call Girl in Dehradun U...
 
ANATOMY AND PHYSIOLOGY OF REPRODUCTIVE SYSTEM.pptx
ANATOMY AND PHYSIOLOGY OF REPRODUCTIVE SYSTEM.pptxANATOMY AND PHYSIOLOGY OF REPRODUCTIVE SYSTEM.pptx
ANATOMY AND PHYSIOLOGY OF REPRODUCTIVE SYSTEM.pptx
 
Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...
Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...
Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...
 
Shazia Iqbal 2024 - Bioorganic Chemistry.pdf
Shazia Iqbal 2024 - Bioorganic Chemistry.pdfShazia Iqbal 2024 - Bioorganic Chemistry.pdf
Shazia Iqbal 2024 - Bioorganic Chemistry.pdf
 
Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...
Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...
Call Girls Bangalore - 450+ Call Girl Cash Payment 💯Call Us 🔝 6378878445 🔝 💃 ...
 
Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...
Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...
Chandigarh Call Girls Service ❤️🍑 9809698092 👄🫦Independent Escort Service Cha...
 
Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...
Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...
Pune Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Pune No💰Adva...
 
7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta
7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta
7 steps How to prevent Thalassemia : Dr Sharda Jain & Vandana Gupta
 
Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...
Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...
Jaipur Call Girl Service 📞9xx000xx09📞Just Call Divya📲 Call Girl In Jaipur No💰...
 
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
Premium Call Girls Dehradun {8854095900} ❤️VVIP ANJU Call Girls in Dehradun U...
 
Most Beautiful Call Girl in Chennai 7427069034 Contact on WhatsApp
Most Beautiful Call Girl in Chennai 7427069034 Contact on WhatsAppMost Beautiful Call Girl in Chennai 7427069034 Contact on WhatsApp
Most Beautiful Call Girl in Chennai 7427069034 Contact on WhatsApp
 
Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...
Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...
Premium Call Girls Nagpur {9xx000xx09} ❤️VVIP POOJA Call Girls in Nagpur Maha...
 

Session 5.1 Secombe

  • 1. Regulation of Myc-induced cell growth by the histonedemethylase Lid AECC May 5th, 2010
  • 2. Myc genes are deregulated in human cancers Myc gene deregulated Cancer type c-myc Bladder, breast, colon, gastric, melanoma, myeloma, ovary, prostate, lung N-myc Neuroblastoma, breast, lung L-myc Breast, lung
  • 3. Myc target genes - Myc target genes are involved in proliferation, vasculogenesis, cell adhesion RNA POL I ribosomal RNA Myc RNA POL II Growth metabolism, translation, ribosomal proteins RNA POL III tRNAs
  • 4. Myc expression induces cell growth Control dMyc (GMM) Gal4 GMR Gal4 dMyc Gal4 UAS dMyc dMyc dMyc Expression of dMyc in post-mitotic cells during eye development GMR-Gal4, UAS-dMyc
  • 5. Identifying regulators of dMyc-induced growth Co-activators Negative regulators dMyc dMyc targets Cell growth Large, rough eye
  • 6. Identifying regulators of dMyc-induced growth Co-activators Negative regulators dMyc dMyc targets Cell growth Large, rough eye Less rough (suppressed)
  • 7. Identifying regulators of dMyc-induced growth Co-activators Negative regulators dMyc dMyc targets Cell growth + apoptosis Large, rough eye More rough (enhanced)
  • 8. GMM UAS-lid GMM lid +/- WT GMM -dMyc -Histone H3 Little ImaginalDiscs (Lid) is limiting for dMyc-induced cell growth GMM, lid/+ Control GMM
  • 9. GMM UAS-lid GMM lid +/- WT GMM -dMyc -Histone H3 Little Imaginal Discs (Lid) is limiting for dMyc-induced cell growth GMM, lid/+ GMM, UAS-Lid Control GMM
  • 10.
  • 11. KDM5b is overexpressed in breast, bladder and prostate cancer
  • 12.
  • 13. Lid co-IPs with dMyc
  • 14. Lid is required for dMyc to activate Nop60B ? Lid Nop60B E-box
  • 15. JmjC is a lysine demethylase domain Nature, 2006 - JHDM1A demethylates histone H3 lysine 36 - Enzymatic activity requires the JmjC domain, Fe2+ and a-ketoglutarate
  • 16. M M M M M M CH3 CH3 CH3 H3C CH3 CH3 trimethyl dimethyl monomethyl unmodified N+ NH+ NH2+ NH3+ JmjC-dependent demethylase activities H3 ARTKYTARKSTGGKAPRKQLATKAARKSAPATGGVK..K..K H4 SGRGKGGKGLGKGGAKRHRKVLR
  • 17. What is the mechanism of Lid function? JmjC PHD PHD PHD ARID JmjN C5HC2 Is Lid a histone demethylase? Is this activity required for dMyc-induced cell growth?
  • 18. Lid demethylates trimethyl H3 lysine 4 JmjC PHD PHD PHD ARID JmjN C5HC2 NLS hs-FLP ; UAS-Lid actin>CD2>Gal4, UAS-GFP GFP a-Lid a-H3K4me3 GFP Larval Fat Body Cells
  • 19. Histone H3 lysine 4 methylation correlates with transcriptional activation Correlation with transcription + K4me3 + K4me2 +/- K4me1 Adapted from Li and Workman, 2007 - Lid’s demethylase activity implicates it as a transcriptional repressor
  • 20. * * dMyc Lid-JmjC* Lid’s JmjC-encoded demethylase activity is not required for dMyc function JmjC PHD PHD PHD ARID JmjN C5HC2 NLS dMyc Lid dMyc - Expression of either wildtype or JmjC* Lid alone has no effect on eye development
  • 21. Myc What is the mechanism of Lid function? ? Lid Nop60B E-box
  • 22. Enhanced? dMyc Lid dMyc dMyc Lid-JmjC* dMyc Lid-D Identifying domains of Lid required for Myc-induced cell growth? Lid domain UAS
  • 23. Domains of Lid required for dMyc function Enhance dMyc phenotype? JmjN JmjC PHD PHD PHD ARID C5HC2 NLS * * X ( ) ( ) ( ) X ( ) ( ) nd X
  • 24. TFIID TAF3 H3K4me3 Transcriptional initiation PHD fingers read the histone code Nurf BPTF Pygo BHC80 H3K4me0 H3K4me2 H3K4me2/3 Wnt-induced transcriptional activation Tethers the LSD1 repressor to chromatin Nucleosome remodeling
  • 25. Lid’s PHD3 binds to H3K4me2/3 JmjN ARID PHD PHD PHD JmjC C5HC2 ECRAENCHKPTGREVDWVPCDGGCNEWFHMYCVGLNRSQIKPDDDYICIRCT H3 21-40 H3K4 H3K9 H3K27 5% input H3 1-21 Beads H4 me1 me2 me3 me1 me2 me3 me1 me2 me3 49 PHD3 38
  • 26. c-Myc binding correlates with high levels of di and trimethylated H3K4 - Histone H3 lysine 4 methylation precedes and is independent of Myc binding.
  • 27.
  • 28. One of the functions on Lid might be to ‘recruit’ Myc to sites that are enriched for H3K4me2/3
  • 29. Thank you Einstein Christina Greer FHCRC Ling Li Bob Eisenman Salk institute Satchin Panda Hiep Le
  • 30.
  • 31. Lid co-IPs with dMyc
  • 32.