SlideShare a Scribd company logo
1 of 41
Druggability Considerations for GPCRs
           and Ion Channels




              Shaun R. Stauffer
6th Drug Discovery for Neurodegeneration Conference
               February 12-14, 2012
Outline

1.   CNS drug development statistics and the hope for BACE inhibitors

2.   Druggability considerations for GPCRs

        Orthosteric versus Allosteric Approaches

        M1/M4 PAMs- receptor reserve and probe dependence

        mGluR5 PAMs- ‘mode switching’ and allosteric agonism

3. Summary and Outlook
CNS drug development challenges
Tremendous need: neurological and psychiatric conditions account for 13% of the global burden of
disease

CNS drugs spend 8.1 yrs in human testing, more than 2 yrs longer than average for all agents

Regulatory approval of CNS drugs takes longer- 1.8 yrs vs1.2 yrs for all drugs

8.2% of CNS drug candidates that begin human testing will reach marketplace vs. 15 % for drugs
overall

46% of CNS candidates succeed in late-stage (phase III) trials, compared with 66% for all drugs

Evaluation of clinical improvement more difficult- schizophrenic episodes or cognitive
improvement in Alzheimer‟s patients more variable and require outcomes trials for therapies aimed
at disease modification

New coalitions emerging to bring government agencies, drug companies and patient advocacy
groups together, to develop a standardized clinical trials database to allow researchers to design
more efficient studies for new treatments and share the risk for development.


A Dearth of New Meds: Drugs to treat neuropsychiatric disorders have become too risky for Big Pharma.
K. I. Kaitin, C. P. Milne Scientific American, Aug. 2011.
Amyloid Precursor Protein (APP) Proteolysis:
                   A Fork in the Road
• -Secretase pathway – Predominant, sAPP neurotrophic (non-amyloidogenic)

•     -Secretase pathway – Minor, normal in development/repair and pathologic
    (A ) roles (oligomerization, “amyloidogenic”)

        -secretase         -secretase                   -secretase


           VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
              DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
                              LVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK

               A 1-40 (major)


    sAPP        A 1-42 (minor)


             sAPP

              Inhibition of -secretase (BACE) should impede the production
              of the peptide A , hence slowing the progress of Alzheimer‟s
              disease
BACE Active Site Properties

•   Membrane associated aspartyl protease within pepsin family
•   First cloned and purified in 1999
•   Large, open, hydrophilic cleft
•   Complementary binding to extended -strand inhibitor/substrate to achieve potency



                      P2
                                                P1'
                                NH2
           CO2H                                                CO2H
                                    O
                  H   O             H   OH Me H        O           H
                  N                 N         N                    N   CO2H       ~1 nM BACE-1
         H2N           N                             N
               O       H        O        Me O     Me H         O
               Me     Me
                                        Me
                           P3                P1
                                                      L. Hong, J. Tang et al, Science 2000, 290, 150
Key Achievement




Tang and coworkers, Science 2000, 290, 150-153.
BACE Inhibitor Challenges

•   Best known inhibitory motifs are Transition State Analogues (TSA‟s)
•   Problem: TSA‟s historically have poor brain penetration (Ritonavir®),
    CYP inhibition and poor oral bioavailability (Renin inhibitors)


                             P2
                                                       P1'
                                       NH2
                CO2H                                                  CO2H
                                           O
                        H    O             H   OH Me H        O           H
                        N                  N         N                    N   CO2H       ~1 nM BACE-1
             H2N              N                               N
                     O        H        O        Me O       Me H       O
                     Me      Me
                                               Me
                                  P3                  P1
                                                             L. Hong, J. Tang et al, Science 2000, 290, 150



     How can we achieve BACE inhibition in the CNS?
     Average properties of marketed CNS drugs:
     small, rigid, Pgp <2.5, LogP >2, MW ~320; HBD ~1, HBA ~2, PSA ~41

     K.M. Mahar Doan, J.W. Polli, et al. J. Pharmacol. Exp. Ther., 2002, 1029-1037
Aspartyl Protease Transition State Analogues

                                            HHO OHP1' H O
                                            N         N
                                                 N
                                           O P1 H O P2'
                                                 transition state


    H    OH P1'                      H    OH P1'                          H    NH2 P1'         H    OH O
    N                                N                                    N                    N
                                                                                                            n
O       P1           O           O       P1 OH O                    O         P1      O    O       P1

hydroxyethylene (HE)        di-hydroxyethylene (DHE)                aminoethylene (AE)      statine-based




     H       NH2 O                       OH H     O                     H     OH P1' O         H            P1'
                                 H
     N                           N          N                           N     P                N
                 n                                                                                      N
                                                                              O                         H
 O       P1                  O       P1         P1'                 O       P1     P1 '    O       P1           O

aminostatine (AS)          hydroxyethyamine (HEA)                       phospinate-based   reduced amide (RA)



             Rich, D. J. Med.Chem., 2002,45, 541.; Greenlee, W. J. J. Med. Res. Rev. 10, 173, (1990)
Merck-Neogenesis Collaboration
       • Screening a 5 million member compound library yields a single lead
        P2 Opt.
                                                                             O O
                                                                              S
                                                                                N
                  N    O        P1 /TSA Opt.
                                                                         O               O
                                                                                              OH H
          O                       O                                          NH     HN           N
                            O                                                                            P1 '
              NH                 NH        HEA incorporation

                                           Rich, D. et al              P3
                      NH2                  JMC 2002, 45, 541                             P1
              1
                                                                    2 BACE-1 IC50 = 10 nM
    BACE-1 IC50 = 25,000 nM
           MW 506                                                                 MW 578
            3 HBD                                                                   P3 + P1 amides
            4 HBA                                                  PGP              P2 sulfonamide
                                                                   substrate        HEA
Coburn et al, J. Med. Chem., 2004, 47, 6117         V. John et al, J. Med Chem., 2004, 47, 158 (Elan)
Stachel et al, J. Med. Chem., 2004, 47, 6447        S. Kaldor et al, Bioorg. Med. Chem. Lett., 1995, 5, 721 (HIV)
X-Ray of HydroxyEthylAmine (HEA)
                                         P2

                                        O O
                                         S
                                           N

                                    O               O
                                                        OH H
                               Ph       NH     HN          N

                                               Ph
                                P3                             P1'
                                               P1

                                               2
    S1, S3
                                    hydrophobic
                                    regions:
                                    S1, S3 and S2’



  S2’
Emerging Chemical Methods Enables
                             Truncation of HEA

                O O
                 S                                                                                  O O
                   N                                                                                 S
                                                                                                       N
                                            1) Rh(acac)(C2H4)2 / rac-BINAP
F           O               O
                                O                                                   F         O                 O
                NH     HN                        (HO)2B
                                    O                         N                                     NH     HN
                                                                                                                      OH
                                                          R
                                            2) LiBH4
                                                                                                                    Ar
                                                                                        35 / 48 successfully isolated

                                    Cl
Ar =
                                                                                                                    + meta
                                        F                                                            N              isomer
                                                                             HO2C

                                                                       F                        H
                                            HN                    F                             N
    S                                                                                       O
                        O
        4

 IC50 = 28 nM
SAR: Alkyl Branch and P1




          Stauffer, S. R. et al. Bioorg. Med. Chem. Lett., 2007, 17, 1788.
Origin of P3 Potency Enhancement?




• New H-bonding manifold for aminopyridine?
• 10s loop conformational change (S3 pocket, residues 9-14)?

        Apo BACE-1,10s dynamics: J. Yon, et al. J. Mol. Biol. (2004) 343, 407.
        Renin S3sp: J. Rahuel, et al. Chem. Biol., 2000, 493.
        McGaughey, G. B. et al. Bioorg. Med. Chem. Lett., 2007, 17, 1117.
        Stauffer, S. R. et al. Bioorg. Med. Chem. Lett., 2007, 17, 1788.
Pocket Collapses via Ligand-Dependent Conformational Change



                                     Ser10




                                             Thr232




                                                     G. McGaughey
Pocket Collapses via Ligand-Dependent Conformational Change
Fast forward: Carbinamines, Spiropiperidines, and Acyl Amidines

                    O O
                     S
                       N
                       N
                   N               X


                            Ph


Low CNS penetration 0.05 b/pIC50 = 330 nM IC50 = 0.4 nM
                      BACE-1          BACE-1         fragment-based discovery
                      sAPP _NF IC50 = 4200 nM ICMK-8931 entering PhII
                                      sAPP _NF 50 = 40 nM
PSA >100                              P-gp ratio(h) = 2, Papp =reduction in HV
                                                     robust A 22
Log P 2.5 – 4.0                       HBD/HBA = 1/6
                                      cLogP = 2.6, PSA = 120 Å2
MW >500
HBD/HBA = 2/4                         40% reduction Rhesus CSF A 40
                                                                      after IV infusion
                                                                      high metabolism, low %F


                                   Persistence and serendipity!
                                                                                     Zhu, Z. et al. J.Med.Chem. 2010, 951.
Stanton, M. et al. J. Med. Chem. 2007, 3431.                                         US20080103351
Sankaranarayanan, S. et al. J.Pharm. Exp.      Barrow, J. et al. J.Med.Chem. 2008,   US20080200445
Ther. 2009, 131-140.                           6259.                                 US20070287692
G protein-coupled receptors
                orthosteric                 NH2                             allosteric
                binding site                                             binding site(s)

          transmembrane
        heptahelical domain
           (7TM domain)


                                                      COOH
•   Classical GPCR ligands modulate signaling through the orthosteric site by:
     – Blocking the native agonist (competitive antagonist)
     – Directly stimulating a receptor response (agonist)
     – Blocking constitutive activity (inverse agonist)

•   Functional assays identify:                   Allosteric Modulators Offer Advantages
                                                  • Selectivity
     – Negative allosteric modulators             • Mimic physiological conditions
                                                  • No desensitization, down regulation or
     – Positive allosteric modulators               internalization
                                                  • Less side effects
     – Allosteric agonists
                                                  Challenges: Steep/Flat SAR, ‘mode switching’
     – Neutral cooperativity
Druggability Challenges for Allosteric Ligands of GPCRs

Allosteric modulators can act at multiple distinct, often overlapping, but
also non-overlapping sites on the same receptor. SAR fails to translate.
Shallow (steep or flat) SAR and difficult to add polar and/or solublizing
groups to generally small, lipophilic chemotypes
Allosteric modulators can differentially regulate coupling of mGlus to
different signaling pathways
Members of a single structural class can have a range of activities
from PAM to NAM and can include neutral ligands, ago-PAMs, allosteric
agonist to partial antagonist


‘Molecular Switch’ – unexpected alteration of pharmacology within an
established series due to subtle, single heavy atom modifications.




                          Wood, et al., Biochemistry 2011, 50, 2403-2410.
Receptor Reserve: Excess Receptors Beyond Those
       Necessary for a Maximal Response

                                                                •     High Receptor Reserve:
                                                                      Potency < Affinity

                                                                •     Low Receptor Reserve:
                                                                      Potency ≈ Affinity

                                                                •     In vivo there is a large range
                                                                      of mAChR receptor reserve
                                                                      levels

                                                                •     In a given cell, mAChR
                                                                      coupling to distinct pathways
                                                                      can have different receptor
                                                                      reserves
                              VU0364572 allosteric agonist/PAM
                              High reserve M1 EC50 = 110 nM (96% AcH max)
                              Low reserve M1 EC50 = 1300 nM

                              Highly selective (M2-M5, Ricerca)
                              Rat CLp = 14.7 mL/min/kg, %F 37
                              Brain AUC/Plasma AUC = 1.4
                              Potentiate NMDA currents in hippocampal CA1

           Lebois, E.P. et al. Bioorg. Med. Chem. Lett. 2011, 6451.
Receptor Reserve – Weak Partial Agonist Considerations

                                      •   Weak partial agonists
                                          can have increased
                                          efficacy and potency in
                                          high receptor reserve

                                      •   Weak partial agonists
                                          can look like antagonists
                                          in low receptor reserve

                                      •   High receptor reserve
                                          systems set the highest
                                          bar for identifying
                                          antagonists

                                      •   This is critical for an
                                          antagonist program as it
                                          is the safest way to
                                          identify true antagonists
Probe Dependence


                                                                        •       Allosteric ligands induce
                                                                                distinct GPCR
                  M4 Allosteric Modulator LY2033298
                                                                                conformations which
                                                                                impact interactions with
                                                                                orthosteric ligands and
Probes:                                                                         intracellular signalling
                                                                                partners

     orthosteric agonist                                                •       Surrogate probes may
   LY2033298 > M4 Potentiator                                                   be preferred however
                                    [3H]-QNB antagonist
        Selective PAM                                                           undesired pharmacology
                                    LY2033298 > M4 „Neutral‟
                                                                                may occur

                                                                        •       Utilize more native
                                                                                systems during LO
                                                                                transition

                M1/M4 preferring agonist (Xanomeline)
                    LY2033298 > M4 Potentiator
                    non-selective (M2 modulator)

                       Melancon, B. J. J. et. al. J. Med. Chem. 2012 in press
Metabotropic Glutamate Receptor 5 and Schizophrenia

 Schizophrenia
 - Afflicts 1% of the worldwide population
 - Three symptom clusters: positive, negative and cognitive

 NMDA receptor hypofunction hypothesis
 - PCP and ketamine (NMDA receptor antagonists) induce schizophrenia-like
   symptoms in humans and rats (Krystal JH et al., 1994; Gaspar PA et al., 2009)

 Metabotropic Glutamate Receptor 5
 - Close signalling partner with NMDA receptors; regulating NMDA receptor
   function, cognition enhancement
 - non-dopminergic approach required to develop more effective antipsychotics
   that will target negative and cognitive symptoms.
Evidence for Therapeutic Potential for Schizophrenia via
            Facilitation of mGluR5 Function

• Modulating dopamine release                  → positive symptoms
 Renoldi et al., 2007; Liu et al., 2008
• Affecting dopamine-mediated behaviour
 Liu et al., 2008; Spear et al., 2011

• Enhancing cognitive function                 → cognitive symptoms
 Balschun et al., 2006; Liu et al., 2008;
 Uslaner et al., 2009; Ayala et al., 2009
• Enhancing synaptic plasticity
 Le Vasseur et al., 2008; Kwon and Castillo,
 2008; Rebola et al., 2008

• Hedonic processes                            → negative symptoms
 Vardigan et al., 2010
mGlu5 PAMs – in the beginning….




 O‟Brien et al., Mol. Pharm. 2003, 64, 731-740; O‟Brien et al. J. Pharm. Exp. Ther. 2004, 309, 568-579;
 Lindsley et al. J. Med. Chem. 2004, 47, 5825-5829; Kinney et al. J. Pharm. Exp. Ther. 2005, 313, 199-212;
 Hemstapat, et al. Mol. Pharm. 2006, 70, 616-626.
mGlu5 PAMs – A New Series, A new ‘Switch’




Nature of HBA and amide steric bulk can promote „switches‟
Western basic pyridine routinely instills NAM character- „Molecular lock‟

                          Rodriguez et al. Mol. Pharmacol. 2010, 78, 1105-1123.
                      Williams et al. Bioorg. Med. Chem. Lett. 2011, 21, 1350-1353.
                       Sams et al. Bioorg. Med. Chem. Lett. 2011, 21, 3407-3410.
mGlu5 NAMs – A New Series, A new ‘Switch’




                                       VU0364289 Reversal of Amphetamine Induced Hyperlocomotor Activity




                                                                           20%BCD vehicle i.p./Amphetamine 1.0 mg/kg; n=14
                                                                1600       10e 56.6 mg/kg i.p./Amphetamine 1.0 mg/kg; n=12

                           (Total Beam Breaks/5 min interval)   1400

                                                                1200
                                     Ambulations




                                                                1000

                                                                 800                                                    # #   # #         #
                                                                                                                  # #               # #
                                                                 600
                                                                                                            # #
                                                                 400

                                                                 200

                                                                  0
                                                                       0      20         40          60           80          100         120
                                                                                                Time (min)
           Rodriguez et al.,Bioorg. Med. Chem. Lett., 2009, 19, 3209-3213
                 Zhou et al. ACS Med. Chem. Lett. 2010, 1, 433-438.
             Xionget al.,Bioorg. Med. Chem. Lett., 2010, 20, 7381-7384
PAM Versus Ago-Potentiator Pharmacology
Ago-PAMs vs PAMs: PAMs could maintain spatial and
      temporal aspects of mGluR5 signaling
                                   LTD – Cognition
                                   impairment?




                                            Epileptiform
                                            activity?




 Theoretically, pure positive allosteric modulators should maintain
  activity-dependence of mGluR5 activation and reduce adverse
             effect liability relative to mGluR5 agonists.
Allosteric agonist activity is dependent on mGluR5 expression levels
             and may have no impact in native systems


                                                                          • No agonist activity in
                                                                            cultured astrocytes
                                                                          • No agonist activity in
                                                                            neuronal populations
                                                                            assessed using
                                                                            electrophysiology
                                                                          • Representative pure
     VU0360172                     VU0361747
                                                                            PAMs and ago-PAMs
                                                                            have identical activity
                                                                            in animal models of
                                                                            antipsychotic-like
                                                                            efficacy..




                 Noetzel, M. Mol. Pharmacol. 2011, in press (doi:10.1124/mol.111.075184)
Finding true Ago-PAMs: VU0424465 is a robust agonist in low
           expressing cell lines and native systems
                EC50 = 7 nM (69%)     cLogP = 3.6
                rmGlu5: Ago-PAM       PPB (h, r) 97.8, 97.2%
                Astrocytes: Ago-PAM   AHL- beh. disturbances


                                                               VU0424465
    VU0424465
mGluR5 orthosteric and allosteric agonists induce
 epileptiform activity in hippocampal area CA3
                               VU0360172    VU0424465
                               (Pure PAM)   (Ago-PAM)
‘Molecular Locks’ provide pure PAMs with no epileptiform activity:
              Oxetane Amide VU0430644 (ML254)

     PAM CRC                                                           Agonist CRC
               VU0424465

                                                                                  VU0424465
                                              ML254
                                  EC50 = 8.7 nM
                                  Fold-Shift ~ 2                                                VU0430644
                    VU0430644     cLogP = 3.1
                                  PPB (h, r): 97, 96%
                                  Clhep (h, r) : 0.2, 1.6 mL/min/kg




      LTD                                            Epileptiform activity
                           VU0430644                                  VU0424465




                             VU0424465

                                                                                              VU0430644
Is There a Big Enough Safety Window?
 •   Group I agonist DHPG is epileptogenic (Merlin and Lisa, 2002)
          Relative Incidence of Behavioural Effects (%)
     Observation              Compound A       Compound B             PTZ threshold cpd B
     Excitation                   77               0
     Forepaw trampling            60               0
     Salivation                   50               0
     Chewing movements            40               0
     Flat body posture            33               0
     Tremor                       23               0
     Piloerection                 10               0
     Sniffing                      7               3
     Body twitches                 3               0
     Spasms                        3               0
     Clonic convulsions            3               0
     Wet urogenital region         3               0

 Monitor Ago-PAM activity to identify compounds free from potential pro-convulsive activity
Summary and Druggability Principles for Allosteric
              GPCR Modulation
Receptor reserve: consider multiple recombinant systems with different
expression levels, primary neurons or other native systems
Selectivity screening/Probe Dependence: Profile key compounds in
functional GPCR assays with full agonists CRCs (select Millipore panel),
utilize multiple probes and/or native orthosteric ligand
Mode Switching: Avoid scaffolds that show a strong tendency for
dramatic changes in activity with subtle structural changes. Metabolite
ID and in vivo testing of metabolites is critical for key compounds and
final candidates.
Ago-PAM activity: Drive chemistry effort using cell lines with relatively
low receptor expression. Cross check in native systems.
PET Ligand development: Develop PET ligand in same series as
candidate. However within detailed molecular pharmacology studies
needed to validate utility of PET ligand.
Vanderbilt Center for Neuroscience Drug Discovery
                               Prof. P. Jeff Conn, Director
In vivo/Ephys          Molecular Pharm            Med Chem               DMPK
  Carrie Jones          Colleen Niswender         Craig Lindsley      Scott Daniels
    Jennifer Ayala          Dave Weaver                               Satyawan Jadhav
                                                   Shaun Stauffer
     Jana Shirey             Evan LeBois                               Annie Blobaum
                                                   Corey Hopkins
     Zixiu Xiang           Alice Rodriguez                              Usha Menon
                                                    Kyle Emmitte
  Alexis Hammond            Paige Vinson                                Matt Mulder
                                                   Michael Wood
  Paulianda Jones             Greg Digby                               Katrina Brewer
                                                  Sameer Sharma
      Alex Kane               Tom Utley                                Ryan Morrison
                                                  Richard Williams
 Analisa Thompson           Daryl Venable                               Frank Byers
                                                    Phil Kennedy
      Jerri Rook             Kari Johnson                               Tom Bridges
                                                   Darren Engers
    Jay Rosanelli           Doug Sheffler                            Tammy Santomango
                                                  Rocco Gogliotti
Elizabeth J. Herman           Joy Marlo           James Salovich
   Michael Bubser           Ashley Brady          Yiu-Yin Cheung
  Merideth Noetzel         Meredith Noetzel
     Dan Foster             Karen Gregory

Outside Collaborators: Robert Kessler
(Vanderbilt), Marc Caron (Duke), Tanya Daigle
(Duke)

Supported by NIMH, NIDA, NINDS, NARSAD.
Backup Slides
GABA-A receptor PAMs provide precedent for different
   in vivo effects of pure PAMs versus ago-PAMs




 Pure PAMs: anxiolytic,                                       Ago-PAMs: general
 sedative - safe, large                                       anesthetic; potentially
 therapeutic window                                           lethal adverse effects,
                                                              narrow therapeutic window


     Other Potential Mechanisms for CNS Adverse Effect Liability
     - Agonist activity at Ionotropic glutamate receptors (Kainate, AMPA, NMDA)?
     - mGlu3 antagonist activity?
     - Glutamate transporter inhibition?
     - Excessive fold-shift of glutamate CRC on mGluR5?

                        Confidential-Janssen-Vanderbilt mGluR5 PAM Project
Xanomeline Induces Robust Improvement in
          Behavioral Disturbances in AD Patients


        Xanomeline (LY246708)
                                                                Bodick et al., Arch Neurology (1997) 54(4):465-73.
        M1/M4 preferring agonist




 AChE inhibitors have antipsychotic efficacy in AD patients (double blind, placebo-controlled
trials) (Cummings et al., 2001; Raskind et al., 1997; McKeith et al., 2000).
BIOLOGICS FOR
CHALLENGING TARGETS:
UNIQUE CHALLENGES
AND LESSONS LEARNED
GURIQ BASI, Ph.D.
VP, ELAN PHARMACEUTICALS

6TH DRUG DISCOVERY FOR NEURODEGENERATION CONFERENCE
Evolution of drug development for neurodegeneration:
Symptomatic to disease modifying

                   Neurodegenerative disease
L-DOPA                 Restrictions imposed by BBB = small molecules main-stay for
                        Rx
AChEI‟s                No-go for neurotrophin biologics
                   Access of biologics to CNS
Neurotrophins
                       Historic
Immunotherap           AD immunotherapy
y                      Targeted delivery
                       Alternative routes (nasal insulin)
Gene therapy       Opportunity on case by case basis
RNAi               Antibody Technology Platforms
                   CM&C, costs, and timelines to IND
Neurotrophins
   Promises
       Neuroprotection, Neuro-restoration
       NGF, BDNF, Nerturin
   Limitations
       Poor bio-availability in target organ following systemic peripheral delivery
       Undesirable side effects from non-targeted central delivery, e.g. generalized sprouting promoting
        inappropriate connections, neuralgia
   Solutions
       Localized (chronic) central delivery to affected region(s)
       Surgical implants for localized infusion (GDNF)
       Targeted delivery
       Gene therapy (Tuczyinski 2004) via implantation of genetically modified fibroblasts;
           CERE-110 – viral delivery of NGF (recruiting P2, n=50 end May 2012)
           CERE-120 (AAV2-Neurturin) - P2 (Dec 2008): Failed on 1o endpoint (efficacy in motor function at 12
            mo), may have benefit at 18 mo. OLE in progress

More Related Content

Similar to Session 4 part 3

Similar to Session 4 part 3 (7)

Dna and rna
Dna and rnaDna and rna
Dna and rna
 
2 da fecha no todos los inh dpp4 son iguales (2)
2 da fecha  no todos los inh dpp4 son iguales (2)2 da fecha  no todos los inh dpp4 son iguales (2)
2 da fecha no todos los inh dpp4 son iguales (2)
 
Acs 2010 San Fransico
Acs 2010 San FransicoAcs 2010 San Fransico
Acs 2010 San Fransico
 
Lecture6: 123.702
Lecture6: 123.702Lecture6: 123.702
Lecture6: 123.702
 
Lecture3: 123.702
Lecture3: 123.702Lecture3: 123.702
Lecture3: 123.702
 
Mannich reaction (1)
Mannich reaction (1)Mannich reaction (1)
Mannich reaction (1)
 
Eln 296571 seminar v 5b
Eln 296571 seminar v 5bEln 296571 seminar v 5b
Eln 296571 seminar v 5b
 

More from plmiami

Am 8.00 workowski
Am 8.00 workowskiAm 8.00 workowski
Am 8.00 workowskiplmiami
 
Am 8.45 policar vulvovag
Am 8.45 policar vulvovagAm 8.45 policar vulvovag
Am 8.45 policar vulvovagplmiami
 
Noon friedman
Noon friedmanNoon friedman
Noon friedmanplmiami
 
Am 11.20 oxentenko
Am 11.20 oxentenkoAm 11.20 oxentenko
Am 11.20 oxentenkoplmiami
 
Am 10.40 gardner
Am 10.40 gardnerAm 10.40 gardner
Am 10.40 gardnerplmiami
 
Am 9.15 awards
Am 9.15  awardsAm 9.15  awards
Am 9.15 awardsplmiami
 
Am 8.50 salganicoff
Am 8.50 salganicoffAm 8.50 salganicoff
Am 8.50 salganicoffplmiami
 
Am 8.40 diaz
Am 8.40 diazAm 8.40 diaz
Am 8.40 diazplmiami
 
Am 8.30 lee
Am 8.30 leeAm 8.30 lee
Am 8.30 leeplmiami
 
Final slide deck for dr iglesia
Final slide deck for dr  iglesiaFinal slide deck for dr  iglesia
Final slide deck for dr iglesiaplmiami
 
Pm 4.45 mcintyre-seltman
Pm 4.45 mcintyre-seltmanPm 4.45 mcintyre-seltman
Pm 4.45 mcintyre-seltmanplmiami
 
Pm 4.00 wisner
Pm 4.00 wisnerPm 4.00 wisner
Pm 4.00 wisnerplmiami
 
Pm 2.45 kushner
Pm 2.45 kushnerPm 2.45 kushner
Pm 2.45 kushnerplmiami
 
Pm 1.50 trudy bush
Pm 1.50 trudy bushPm 1.50 trudy bush
Pm 1.50 trudy bushplmiami
 
Evidence based management of cardiovascular disease in women
Evidence based management of cardiovascular disease in women Evidence based management of cardiovascular disease in women
Evidence based management of cardiovascular disease in women plmiami
 
Am 11.30 grunfeld
Am 11.30 grunfeldAm 11.30 grunfeld
Am 11.30 grunfeldplmiami
 
Am 10.45 lindsay bone health
Am 10.45 lindsay bone healthAm 10.45 lindsay bone health
Am 10.45 lindsay bone healthplmiami
 
Am 9.30 robertson
Am 9.30 robertsonAm 9.30 robertson
Am 9.30 robertsonplmiami
 
Am 7.15 shulman
Am 7.15 shulmanAm 7.15 shulman
Am 7.15 shulmanplmiami
 
Pm 4.50 hochberg
Pm 4.50 hochbergPm 4.50 hochberg
Pm 4.50 hochbergplmiami
 

More from plmiami (20)

Am 8.00 workowski
Am 8.00 workowskiAm 8.00 workowski
Am 8.00 workowski
 
Am 8.45 policar vulvovag
Am 8.45 policar vulvovagAm 8.45 policar vulvovag
Am 8.45 policar vulvovag
 
Noon friedman
Noon friedmanNoon friedman
Noon friedman
 
Am 11.20 oxentenko
Am 11.20 oxentenkoAm 11.20 oxentenko
Am 11.20 oxentenko
 
Am 10.40 gardner
Am 10.40 gardnerAm 10.40 gardner
Am 10.40 gardner
 
Am 9.15 awards
Am 9.15  awardsAm 9.15  awards
Am 9.15 awards
 
Am 8.50 salganicoff
Am 8.50 salganicoffAm 8.50 salganicoff
Am 8.50 salganicoff
 
Am 8.40 diaz
Am 8.40 diazAm 8.40 diaz
Am 8.40 diaz
 
Am 8.30 lee
Am 8.30 leeAm 8.30 lee
Am 8.30 lee
 
Final slide deck for dr iglesia
Final slide deck for dr  iglesiaFinal slide deck for dr  iglesia
Final slide deck for dr iglesia
 
Pm 4.45 mcintyre-seltman
Pm 4.45 mcintyre-seltmanPm 4.45 mcintyre-seltman
Pm 4.45 mcintyre-seltman
 
Pm 4.00 wisner
Pm 4.00 wisnerPm 4.00 wisner
Pm 4.00 wisner
 
Pm 2.45 kushner
Pm 2.45 kushnerPm 2.45 kushner
Pm 2.45 kushner
 
Pm 1.50 trudy bush
Pm 1.50 trudy bushPm 1.50 trudy bush
Pm 1.50 trudy bush
 
Evidence based management of cardiovascular disease in women
Evidence based management of cardiovascular disease in women Evidence based management of cardiovascular disease in women
Evidence based management of cardiovascular disease in women
 
Am 11.30 grunfeld
Am 11.30 grunfeldAm 11.30 grunfeld
Am 11.30 grunfeld
 
Am 10.45 lindsay bone health
Am 10.45 lindsay bone healthAm 10.45 lindsay bone health
Am 10.45 lindsay bone health
 
Am 9.30 robertson
Am 9.30 robertsonAm 9.30 robertson
Am 9.30 robertson
 
Am 7.15 shulman
Am 7.15 shulmanAm 7.15 shulman
Am 7.15 shulman
 
Pm 4.50 hochberg
Pm 4.50 hochbergPm 4.50 hochberg
Pm 4.50 hochberg
 

Recently uploaded

A DAY IN THE LIFE OF A SALESMAN / WOMAN
A DAY IN THE LIFE OF A  SALESMAN / WOMANA DAY IN THE LIFE OF A  SALESMAN / WOMAN
A DAY IN THE LIFE OF A SALESMAN / WOMANIlamathiKannappan
 
Dr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdfDr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdfAdmir Softic
 
Business Model Canvas (BMC)- A new venture concept
Business Model Canvas (BMC)-  A new venture conceptBusiness Model Canvas (BMC)-  A new venture concept
Business Model Canvas (BMC)- A new venture conceptP&CO
 
Monthly Social Media Update April 2024 pptx.pptx
Monthly Social Media Update April 2024 pptx.pptxMonthly Social Media Update April 2024 pptx.pptx
Monthly Social Media Update April 2024 pptx.pptxAndy Lambert
 
Mysore Call Girls 8617370543 WhatsApp Number 24x7 Best Services
Mysore Call Girls 8617370543 WhatsApp Number 24x7 Best ServicesMysore Call Girls 8617370543 WhatsApp Number 24x7 Best Services
Mysore Call Girls 8617370543 WhatsApp Number 24x7 Best ServicesDipal Arora
 
Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...
Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...
Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...amitlee9823
 
Falcon Invoice Discounting: The best investment platform in india for investors
Falcon Invoice Discounting: The best investment platform in india for investorsFalcon Invoice Discounting: The best investment platform in india for investors
Falcon Invoice Discounting: The best investment platform in india for investorsFalcon Invoice Discounting
 
Katrina Personal Brand Project and portfolio 1
Katrina Personal Brand Project and portfolio 1Katrina Personal Brand Project and portfolio 1
Katrina Personal Brand Project and portfolio 1kcpayne
 
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...lizamodels9
 
Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...
Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...
Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...Dave Litwiller
 
Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...
Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...
Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...lizamodels9
 
Insurers' journeys to build a mastery in the IoT usage
Insurers' journeys to build a mastery in the IoT usageInsurers' journeys to build a mastery in the IoT usage
Insurers' journeys to build a mastery in the IoT usageMatteo Carbone
 
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort ServiceEluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort ServiceDamini Dixit
 
Famous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st CenturyFamous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st Centuryrwgiffor
 
Cracking the Cultural Competence Code.pptx
Cracking the Cultural Competence Code.pptxCracking the Cultural Competence Code.pptx
Cracking the Cultural Competence Code.pptxWorkforce Group
 
Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...
Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...
Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...lizamodels9
 
Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...
Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...
Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...Anamikakaur10
 
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...daisycvs
 
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service AvailableSeo
 
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...amitlee9823
 

Recently uploaded (20)

A DAY IN THE LIFE OF A SALESMAN / WOMAN
A DAY IN THE LIFE OF A  SALESMAN / WOMANA DAY IN THE LIFE OF A  SALESMAN / WOMAN
A DAY IN THE LIFE OF A SALESMAN / WOMAN
 
Dr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdfDr. Admir Softic_ presentation_Green Club_ENG.pdf
Dr. Admir Softic_ presentation_Green Club_ENG.pdf
 
Business Model Canvas (BMC)- A new venture concept
Business Model Canvas (BMC)-  A new venture conceptBusiness Model Canvas (BMC)-  A new venture concept
Business Model Canvas (BMC)- A new venture concept
 
Monthly Social Media Update April 2024 pptx.pptx
Monthly Social Media Update April 2024 pptx.pptxMonthly Social Media Update April 2024 pptx.pptx
Monthly Social Media Update April 2024 pptx.pptx
 
Mysore Call Girls 8617370543 WhatsApp Number 24x7 Best Services
Mysore Call Girls 8617370543 WhatsApp Number 24x7 Best ServicesMysore Call Girls 8617370543 WhatsApp Number 24x7 Best Services
Mysore Call Girls 8617370543 WhatsApp Number 24x7 Best Services
 
Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...
Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...
Call Girls Kengeri Satellite Town Just Call 👗 7737669865 👗 Top Class Call Gir...
 
Falcon Invoice Discounting: The best investment platform in india for investors
Falcon Invoice Discounting: The best investment platform in india for investorsFalcon Invoice Discounting: The best investment platform in india for investors
Falcon Invoice Discounting: The best investment platform in india for investors
 
Katrina Personal Brand Project and portfolio 1
Katrina Personal Brand Project and portfolio 1Katrina Personal Brand Project and portfolio 1
Katrina Personal Brand Project and portfolio 1
 
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
Call Girls From Pari Chowk Greater Noida ❤️8448577510 ⊹Best Escorts Service I...
 
Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...
Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...
Enhancing and Restoring Safety & Quality Cultures - Dave Litwiller - May 2024...
 
Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...
Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...
Russian Call Girls In Gurgaon ❤️8448577510 ⊹Best Escorts Service In 24/7 Delh...
 
Insurers' journeys to build a mastery in the IoT usage
Insurers' journeys to build a mastery in the IoT usageInsurers' journeys to build a mastery in the IoT usage
Insurers' journeys to build a mastery in the IoT usage
 
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort ServiceEluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
Eluru Call Girls Service ☎ ️93326-06886 ❤️‍🔥 Enjoy 24/7 Escort Service
 
Famous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st CenturyFamous Olympic Siblings from the 21st Century
Famous Olympic Siblings from the 21st Century
 
Cracking the Cultural Competence Code.pptx
Cracking the Cultural Competence Code.pptxCracking the Cultural Competence Code.pptx
Cracking the Cultural Competence Code.pptx
 
Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...
Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...
Call Girls In DLf Gurgaon ➥99902@11544 ( Best price)100% Genuine Escort In 24...
 
Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...
Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...
Call Now ☎️🔝 9332606886🔝 Call Girls ❤ Service In Bhilwara Female Escorts Serv...
 
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
Quick Doctor In Kuwait +2773`7758`557 Kuwait Doha Qatar Dubai Abu Dhabi Sharj...
 
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service AvailableCall Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
Call Girls Ludhiana Just Call 98765-12871 Top Class Call Girl Service Available
 
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
Call Girls Electronic City Just Call 👗 7737669865 👗 Top Class Call Girl Servi...
 

Session 4 part 3

  • 1. Druggability Considerations for GPCRs and Ion Channels Shaun R. Stauffer 6th Drug Discovery for Neurodegeneration Conference February 12-14, 2012
  • 2. Outline 1. CNS drug development statistics and the hope for BACE inhibitors 2. Druggability considerations for GPCRs  Orthosteric versus Allosteric Approaches  M1/M4 PAMs- receptor reserve and probe dependence  mGluR5 PAMs- ‘mode switching’ and allosteric agonism 3. Summary and Outlook
  • 3. CNS drug development challenges Tremendous need: neurological and psychiatric conditions account for 13% of the global burden of disease CNS drugs spend 8.1 yrs in human testing, more than 2 yrs longer than average for all agents Regulatory approval of CNS drugs takes longer- 1.8 yrs vs1.2 yrs for all drugs 8.2% of CNS drug candidates that begin human testing will reach marketplace vs. 15 % for drugs overall 46% of CNS candidates succeed in late-stage (phase III) trials, compared with 66% for all drugs Evaluation of clinical improvement more difficult- schizophrenic episodes or cognitive improvement in Alzheimer‟s patients more variable and require outcomes trials for therapies aimed at disease modification New coalitions emerging to bring government agencies, drug companies and patient advocacy groups together, to develop a standardized clinical trials database to allow researchers to design more efficient studies for new treatments and share the risk for development. A Dearth of New Meds: Drugs to treat neuropsychiatric disorders have become too risky for Big Pharma. K. I. Kaitin, C. P. Milne Scientific American, Aug. 2011.
  • 4. Amyloid Precursor Protein (APP) Proteolysis: A Fork in the Road • -Secretase pathway – Predominant, sAPP neurotrophic (non-amyloidogenic) • -Secretase pathway – Minor, normal in development/repair and pathologic (A ) roles (oligomerization, “amyloidogenic”) -secretase -secretase -secretase VKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK LVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK A 1-40 (major) sAPP A 1-42 (minor) sAPP Inhibition of -secretase (BACE) should impede the production of the peptide A , hence slowing the progress of Alzheimer‟s disease
  • 5. BACE Active Site Properties • Membrane associated aspartyl protease within pepsin family • First cloned and purified in 1999 • Large, open, hydrophilic cleft • Complementary binding to extended -strand inhibitor/substrate to achieve potency P2 P1' NH2 CO2H CO2H O H O H OH Me H O H N N N N CO2H ~1 nM BACE-1 H2N N N O H O Me O Me H O Me Me Me P3 P1 L. Hong, J. Tang et al, Science 2000, 290, 150
  • 6. Key Achievement Tang and coworkers, Science 2000, 290, 150-153.
  • 7. BACE Inhibitor Challenges • Best known inhibitory motifs are Transition State Analogues (TSA‟s) • Problem: TSA‟s historically have poor brain penetration (Ritonavir®), CYP inhibition and poor oral bioavailability (Renin inhibitors) P2 P1' NH2 CO2H CO2H O H O H OH Me H O H N N N N CO2H ~1 nM BACE-1 H2N N N O H O Me O Me H O Me Me Me P3 P1 L. Hong, J. Tang et al, Science 2000, 290, 150 How can we achieve BACE inhibition in the CNS? Average properties of marketed CNS drugs: small, rigid, Pgp <2.5, LogP >2, MW ~320; HBD ~1, HBA ~2, PSA ~41 K.M. Mahar Doan, J.W. Polli, et al. J. Pharmacol. Exp. Ther., 2002, 1029-1037
  • 8. Aspartyl Protease Transition State Analogues HHO OHP1' H O N N N O P1 H O P2' transition state H OH P1' H OH P1' H NH2 P1' H OH O N N N N n O P1 O O P1 OH O O P1 O O P1 hydroxyethylene (HE) di-hydroxyethylene (DHE) aminoethylene (AE) statine-based H NH2 O OH H O H OH P1' O H P1' H N N N N P N n N O H O P1 O P1 P1' O P1 P1 ' O P1 O aminostatine (AS) hydroxyethyamine (HEA) phospinate-based reduced amide (RA) Rich, D. J. Med.Chem., 2002,45, 541.; Greenlee, W. J. J. Med. Res. Rev. 10, 173, (1990)
  • 9. Merck-Neogenesis Collaboration • Screening a 5 million member compound library yields a single lead P2 Opt. O O S N N O P1 /TSA Opt. O O OH H O O NH HN N O P1 ' NH NH HEA incorporation Rich, D. et al P3 NH2 JMC 2002, 45, 541 P1 1 2 BACE-1 IC50 = 10 nM BACE-1 IC50 = 25,000 nM MW 506 MW 578 3 HBD P3 + P1 amides 4 HBA PGP P2 sulfonamide substrate HEA Coburn et al, J. Med. Chem., 2004, 47, 6117 V. John et al, J. Med Chem., 2004, 47, 158 (Elan) Stachel et al, J. Med. Chem., 2004, 47, 6447 S. Kaldor et al, Bioorg. Med. Chem. Lett., 1995, 5, 721 (HIV)
  • 10. X-Ray of HydroxyEthylAmine (HEA) P2 O O S N O O OH H Ph NH HN N Ph P3 P1' P1 2 S1, S3 hydrophobic regions: S1, S3 and S2’ S2’
  • 11. Emerging Chemical Methods Enables Truncation of HEA O O S O O N S N 1) Rh(acac)(C2H4)2 / rac-BINAP F O O O F O O NH HN (HO)2B O N NH HN OH R 2) LiBH4 Ar 35 / 48 successfully isolated Cl Ar = + meta F N isomer HO2C F H HN F N S O O 4 IC50 = 28 nM
  • 12. SAR: Alkyl Branch and P1 Stauffer, S. R. et al. Bioorg. Med. Chem. Lett., 2007, 17, 1788.
  • 13. Origin of P3 Potency Enhancement? • New H-bonding manifold for aminopyridine? • 10s loop conformational change (S3 pocket, residues 9-14)? Apo BACE-1,10s dynamics: J. Yon, et al. J. Mol. Biol. (2004) 343, 407. Renin S3sp: J. Rahuel, et al. Chem. Biol., 2000, 493. McGaughey, G. B. et al. Bioorg. Med. Chem. Lett., 2007, 17, 1117. Stauffer, S. R. et al. Bioorg. Med. Chem. Lett., 2007, 17, 1788.
  • 14. Pocket Collapses via Ligand-Dependent Conformational Change Ser10 Thr232 G. McGaughey
  • 15. Pocket Collapses via Ligand-Dependent Conformational Change
  • 16. Fast forward: Carbinamines, Spiropiperidines, and Acyl Amidines O O S N N N X Ph Low CNS penetration 0.05 b/pIC50 = 330 nM IC50 = 0.4 nM BACE-1 BACE-1 fragment-based discovery sAPP _NF IC50 = 4200 nM ICMK-8931 entering PhII sAPP _NF 50 = 40 nM PSA >100 P-gp ratio(h) = 2, Papp =reduction in HV robust A 22 Log P 2.5 – 4.0 HBD/HBA = 1/6 cLogP = 2.6, PSA = 120 Å2 MW >500 HBD/HBA = 2/4 40% reduction Rhesus CSF A 40 after IV infusion high metabolism, low %F Persistence and serendipity! Zhu, Z. et al. J.Med.Chem. 2010, 951. Stanton, M. et al. J. Med. Chem. 2007, 3431. US20080103351 Sankaranarayanan, S. et al. J.Pharm. Exp. Barrow, J. et al. J.Med.Chem. 2008, US20080200445 Ther. 2009, 131-140. 6259. US20070287692
  • 17. G protein-coupled receptors orthosteric NH2 allosteric binding site binding site(s) transmembrane heptahelical domain (7TM domain) COOH • Classical GPCR ligands modulate signaling through the orthosteric site by: – Blocking the native agonist (competitive antagonist) – Directly stimulating a receptor response (agonist) – Blocking constitutive activity (inverse agonist) • Functional assays identify: Allosteric Modulators Offer Advantages • Selectivity – Negative allosteric modulators • Mimic physiological conditions • No desensitization, down regulation or – Positive allosteric modulators internalization • Less side effects – Allosteric agonists Challenges: Steep/Flat SAR, ‘mode switching’ – Neutral cooperativity
  • 18. Druggability Challenges for Allosteric Ligands of GPCRs Allosteric modulators can act at multiple distinct, often overlapping, but also non-overlapping sites on the same receptor. SAR fails to translate. Shallow (steep or flat) SAR and difficult to add polar and/or solublizing groups to generally small, lipophilic chemotypes Allosteric modulators can differentially regulate coupling of mGlus to different signaling pathways Members of a single structural class can have a range of activities from PAM to NAM and can include neutral ligands, ago-PAMs, allosteric agonist to partial antagonist ‘Molecular Switch’ – unexpected alteration of pharmacology within an established series due to subtle, single heavy atom modifications. Wood, et al., Biochemistry 2011, 50, 2403-2410.
  • 19. Receptor Reserve: Excess Receptors Beyond Those Necessary for a Maximal Response • High Receptor Reserve: Potency < Affinity • Low Receptor Reserve: Potency ≈ Affinity • In vivo there is a large range of mAChR receptor reserve levels • In a given cell, mAChR coupling to distinct pathways can have different receptor reserves VU0364572 allosteric agonist/PAM High reserve M1 EC50 = 110 nM (96% AcH max) Low reserve M1 EC50 = 1300 nM Highly selective (M2-M5, Ricerca) Rat CLp = 14.7 mL/min/kg, %F 37 Brain AUC/Plasma AUC = 1.4 Potentiate NMDA currents in hippocampal CA1 Lebois, E.P. et al. Bioorg. Med. Chem. Lett. 2011, 6451.
  • 20. Receptor Reserve – Weak Partial Agonist Considerations • Weak partial agonists can have increased efficacy and potency in high receptor reserve • Weak partial agonists can look like antagonists in low receptor reserve • High receptor reserve systems set the highest bar for identifying antagonists • This is critical for an antagonist program as it is the safest way to identify true antagonists
  • 21. Probe Dependence • Allosteric ligands induce distinct GPCR M4 Allosteric Modulator LY2033298 conformations which impact interactions with orthosteric ligands and Probes: intracellular signalling partners orthosteric agonist • Surrogate probes may LY2033298 > M4 Potentiator be preferred however [3H]-QNB antagonist Selective PAM undesired pharmacology LY2033298 > M4 „Neutral‟ may occur • Utilize more native systems during LO transition M1/M4 preferring agonist (Xanomeline) LY2033298 > M4 Potentiator non-selective (M2 modulator) Melancon, B. J. J. et. al. J. Med. Chem. 2012 in press
  • 22. Metabotropic Glutamate Receptor 5 and Schizophrenia Schizophrenia - Afflicts 1% of the worldwide population - Three symptom clusters: positive, negative and cognitive NMDA receptor hypofunction hypothesis - PCP and ketamine (NMDA receptor antagonists) induce schizophrenia-like symptoms in humans and rats (Krystal JH et al., 1994; Gaspar PA et al., 2009) Metabotropic Glutamate Receptor 5 - Close signalling partner with NMDA receptors; regulating NMDA receptor function, cognition enhancement - non-dopminergic approach required to develop more effective antipsychotics that will target negative and cognitive symptoms.
  • 23. Evidence for Therapeutic Potential for Schizophrenia via Facilitation of mGluR5 Function • Modulating dopamine release → positive symptoms Renoldi et al., 2007; Liu et al., 2008 • Affecting dopamine-mediated behaviour Liu et al., 2008; Spear et al., 2011 • Enhancing cognitive function → cognitive symptoms Balschun et al., 2006; Liu et al., 2008; Uslaner et al., 2009; Ayala et al., 2009 • Enhancing synaptic plasticity Le Vasseur et al., 2008; Kwon and Castillo, 2008; Rebola et al., 2008 • Hedonic processes → negative symptoms Vardigan et al., 2010
  • 24. mGlu5 PAMs – in the beginning…. O‟Brien et al., Mol. Pharm. 2003, 64, 731-740; O‟Brien et al. J. Pharm. Exp. Ther. 2004, 309, 568-579; Lindsley et al. J. Med. Chem. 2004, 47, 5825-5829; Kinney et al. J. Pharm. Exp. Ther. 2005, 313, 199-212; Hemstapat, et al. Mol. Pharm. 2006, 70, 616-626.
  • 25. mGlu5 PAMs – A New Series, A new ‘Switch’ Nature of HBA and amide steric bulk can promote „switches‟ Western basic pyridine routinely instills NAM character- „Molecular lock‟ Rodriguez et al. Mol. Pharmacol. 2010, 78, 1105-1123. Williams et al. Bioorg. Med. Chem. Lett. 2011, 21, 1350-1353. Sams et al. Bioorg. Med. Chem. Lett. 2011, 21, 3407-3410.
  • 26. mGlu5 NAMs – A New Series, A new ‘Switch’ VU0364289 Reversal of Amphetamine Induced Hyperlocomotor Activity 20%BCD vehicle i.p./Amphetamine 1.0 mg/kg; n=14 1600 10e 56.6 mg/kg i.p./Amphetamine 1.0 mg/kg; n=12 (Total Beam Breaks/5 min interval) 1400 1200 Ambulations 1000 800 # # # # # # # # # 600 # # 400 200 0 0 20 40 60 80 100 120 Time (min) Rodriguez et al.,Bioorg. Med. Chem. Lett., 2009, 19, 3209-3213 Zhou et al. ACS Med. Chem. Lett. 2010, 1, 433-438. Xionget al.,Bioorg. Med. Chem. Lett., 2010, 20, 7381-7384
  • 28. Ago-PAMs vs PAMs: PAMs could maintain spatial and temporal aspects of mGluR5 signaling LTD – Cognition impairment? Epileptiform activity? Theoretically, pure positive allosteric modulators should maintain activity-dependence of mGluR5 activation and reduce adverse effect liability relative to mGluR5 agonists.
  • 29. Allosteric agonist activity is dependent on mGluR5 expression levels and may have no impact in native systems • No agonist activity in cultured astrocytes • No agonist activity in neuronal populations assessed using electrophysiology • Representative pure VU0360172 VU0361747 PAMs and ago-PAMs have identical activity in animal models of antipsychotic-like efficacy.. Noetzel, M. Mol. Pharmacol. 2011, in press (doi:10.1124/mol.111.075184)
  • 30. Finding true Ago-PAMs: VU0424465 is a robust agonist in low expressing cell lines and native systems EC50 = 7 nM (69%) cLogP = 3.6 rmGlu5: Ago-PAM PPB (h, r) 97.8, 97.2% Astrocytes: Ago-PAM AHL- beh. disturbances VU0424465 VU0424465
  • 31. mGluR5 orthosteric and allosteric agonists induce epileptiform activity in hippocampal area CA3 VU0360172 VU0424465 (Pure PAM) (Ago-PAM)
  • 32. ‘Molecular Locks’ provide pure PAMs with no epileptiform activity: Oxetane Amide VU0430644 (ML254) PAM CRC Agonist CRC VU0424465 VU0424465 ML254 EC50 = 8.7 nM Fold-Shift ~ 2 VU0430644 VU0430644 cLogP = 3.1 PPB (h, r): 97, 96% Clhep (h, r) : 0.2, 1.6 mL/min/kg LTD Epileptiform activity VU0430644 VU0424465 VU0424465 VU0430644
  • 33. Is There a Big Enough Safety Window? • Group I agonist DHPG is epileptogenic (Merlin and Lisa, 2002) Relative Incidence of Behavioural Effects (%) Observation Compound A Compound B PTZ threshold cpd B Excitation 77 0 Forepaw trampling 60 0 Salivation 50 0 Chewing movements 40 0 Flat body posture 33 0 Tremor 23 0 Piloerection 10 0 Sniffing 7 3 Body twitches 3 0 Spasms 3 0 Clonic convulsions 3 0 Wet urogenital region 3 0  Monitor Ago-PAM activity to identify compounds free from potential pro-convulsive activity
  • 34. Summary and Druggability Principles for Allosteric GPCR Modulation Receptor reserve: consider multiple recombinant systems with different expression levels, primary neurons or other native systems Selectivity screening/Probe Dependence: Profile key compounds in functional GPCR assays with full agonists CRCs (select Millipore panel), utilize multiple probes and/or native orthosteric ligand Mode Switching: Avoid scaffolds that show a strong tendency for dramatic changes in activity with subtle structural changes. Metabolite ID and in vivo testing of metabolites is critical for key compounds and final candidates. Ago-PAM activity: Drive chemistry effort using cell lines with relatively low receptor expression. Cross check in native systems. PET Ligand development: Develop PET ligand in same series as candidate. However within detailed molecular pharmacology studies needed to validate utility of PET ligand.
  • 35. Vanderbilt Center for Neuroscience Drug Discovery Prof. P. Jeff Conn, Director In vivo/Ephys Molecular Pharm Med Chem DMPK Carrie Jones Colleen Niswender Craig Lindsley Scott Daniels Jennifer Ayala Dave Weaver Satyawan Jadhav Shaun Stauffer Jana Shirey Evan LeBois Annie Blobaum Corey Hopkins Zixiu Xiang Alice Rodriguez Usha Menon Kyle Emmitte Alexis Hammond Paige Vinson Matt Mulder Michael Wood Paulianda Jones Greg Digby Katrina Brewer Sameer Sharma Alex Kane Tom Utley Ryan Morrison Richard Williams Analisa Thompson Daryl Venable Frank Byers Phil Kennedy Jerri Rook Kari Johnson Tom Bridges Darren Engers Jay Rosanelli Doug Sheffler Tammy Santomango Rocco Gogliotti Elizabeth J. Herman Joy Marlo James Salovich Michael Bubser Ashley Brady Yiu-Yin Cheung Merideth Noetzel Meredith Noetzel Dan Foster Karen Gregory Outside Collaborators: Robert Kessler (Vanderbilt), Marc Caron (Duke), Tanya Daigle (Duke) Supported by NIMH, NIDA, NINDS, NARSAD.
  • 37. GABA-A receptor PAMs provide precedent for different in vivo effects of pure PAMs versus ago-PAMs Pure PAMs: anxiolytic, Ago-PAMs: general sedative - safe, large anesthetic; potentially therapeutic window lethal adverse effects, narrow therapeutic window Other Potential Mechanisms for CNS Adverse Effect Liability - Agonist activity at Ionotropic glutamate receptors (Kainate, AMPA, NMDA)? - mGlu3 antagonist activity? - Glutamate transporter inhibition? - Excessive fold-shift of glutamate CRC on mGluR5? Confidential-Janssen-Vanderbilt mGluR5 PAM Project
  • 38. Xanomeline Induces Robust Improvement in Behavioral Disturbances in AD Patients Xanomeline (LY246708) Bodick et al., Arch Neurology (1997) 54(4):465-73. M1/M4 preferring agonist  AChE inhibitors have antipsychotic efficacy in AD patients (double blind, placebo-controlled trials) (Cummings et al., 2001; Raskind et al., 1997; McKeith et al., 2000).
  • 39. BIOLOGICS FOR CHALLENGING TARGETS: UNIQUE CHALLENGES AND LESSONS LEARNED GURIQ BASI, Ph.D. VP, ELAN PHARMACEUTICALS 6TH DRUG DISCOVERY FOR NEURODEGENERATION CONFERENCE
  • 40. Evolution of drug development for neurodegeneration: Symptomatic to disease modifying  Neurodegenerative disease L-DOPA  Restrictions imposed by BBB = small molecules main-stay for Rx AChEI‟s  No-go for neurotrophin biologics  Access of biologics to CNS Neurotrophins  Historic Immunotherap  AD immunotherapy y  Targeted delivery  Alternative routes (nasal insulin) Gene therapy  Opportunity on case by case basis RNAi  Antibody Technology Platforms  CM&C, costs, and timelines to IND
  • 41. Neurotrophins  Promises  Neuroprotection, Neuro-restoration  NGF, BDNF, Nerturin  Limitations  Poor bio-availability in target organ following systemic peripheral delivery  Undesirable side effects from non-targeted central delivery, e.g. generalized sprouting promoting inappropriate connections, neuralgia  Solutions  Localized (chronic) central delivery to affected region(s)  Surgical implants for localized infusion (GDNF)  Targeted delivery  Gene therapy (Tuczyinski 2004) via implantation of genetically modified fibroblasts;  CERE-110 – viral delivery of NGF (recruiting P2, n=50 end May 2012)  CERE-120 (AAV2-Neurturin) - P2 (Dec 2008): Failed on 1o endpoint (efficacy in motor function at 12 mo), may have benefit at 18 mo. OLE in progress

Editor's Notes

  1. For example, in hippocampal neurons, the receptor reserve for depolarization is high whereas the receptor reserve for NMDAR potentiation and for PI hydrolysis is much lowerThis becomes a particular consideration when one is trying to identify antagonists….
  2. Historic: Nerenberg,S.T.,andPrasad,R.(1975). Radioimmunoassays for Ig classes G, A, M,D,and E in spinal fluids:normal values of different age groups. J. Lab.Clin.Med. 86, 887–898. Compromised BBB in neurodegenerative disease;
  3. www.dana.org/news/publications/detail.aspx?id=4270www.alzheimers.org/clinicaltrials/fullrec.asp?PrimaryKey=308http://www.medscape.com/viewarticle/733407