SlideShare a Scribd company logo

Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03

E
E

Here is an exercise done for the Schoolism storyboarding course. The assignment required 2 characters with a 3rd character who enters the scene. Also, the story *must* contain eggs. Had fun making this quick board sequence.

Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03

1 of 36
Download to read offline
Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03
Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03
Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03
Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03
Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03
Jack Lays A Golden Egg - Schoolism Storyboard Assignment 03

Recommended

Stuck at the Movies - TAG Assignment 02
Stuck at the Movies - TAG Assignment 02Stuck at the Movies - TAG Assignment 02
Stuck at the Movies - TAG Assignment 02Eric Martin
 
Eric T. Martin - 2018 Story Portfolio
Eric T. Martin - 2018 Story PortfolioEric T. Martin - 2018 Story Portfolio
Eric T. Martin - 2018 Story PortfolioEric Martin
 
Fremont the Banjo Frog - Rough Storyboards
Fremont the Banjo Frog - Rough StoryboardsFremont the Banjo Frog - Rough Storyboards
Fremont the Banjo Frog - Rough StoryboardsEric Martin
 
How I Got Here - Schoolism Storyboard Assignment 01
How I Got Here - Schoolism Storyboard Assignment 01How I Got Here - Schoolism Storyboard Assignment 01
How I Got Here - Schoolism Storyboard Assignment 01Eric Martin
 
Dashel & Ham - Belly of the Banquet Storyboards
Dashel & Ham - Belly of the Banquet StoryboardsDashel & Ham - Belly of the Banquet Storyboards
Dashel & Ham - Belly of the Banquet StoryboardsEric Martin
 
Officer CARE Storyboards
Officer CARE StoryboardsOfficer CARE Storyboards
Officer CARE StoryboardsEric Martin
 
How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024How to Prepare For a Successful Job Search for 2024
How to Prepare For a Successful Job Search for 2024Albert Qian
 
Social Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie InsightsSocial Media Marketing Trends 2024 // The Global Indie Insights
Social Media Marketing Trends 2024 // The Global Indie InsightsKurio // The Social Media Age(ncy)
 

More Related Content

Recently uploaded

Jazmin portfolio by DR.Jibachha Sah for arth
Jazmin portfolio by DR.Jibachha Sah for arthJazmin portfolio by DR.Jibachha Sah for arth
Jazmin portfolio by DR.Jibachha Sah for arthDrJibachhaSahVetphys
 
PPT Skripsi #2 tanpa hyperlnbnmbbink.pptxb
PPT Skripsi #2 tanpa hyperlnbnmbbink.pptxbPPT Skripsi #2 tanpa hyperlnbnmbbink.pptxb
PPT Skripsi #2 tanpa hyperlnbnmbbink.pptxbWardhaniNabilla1
 
Ms.Shahla Baghdad`- alyarmouk street - .pdf
Ms.Shahla Baghdad`- alyarmouk street - .pdfMs.Shahla Baghdad`- alyarmouk street - .pdf
Ms.Shahla Baghdad`- alyarmouk street - .pdfmahmoudtabaa3
 
Multicolor Clouds Daily Class Agenda Template.pdf
Multicolor Clouds Daily Class Agenda Template.pdfMulticolor Clouds Daily Class Agenda Template.pdf
Multicolor Clouds Daily Class Agenda Template.pdfbyqjzxcrnf
 
BASIC A resumido de ingles para aprender muy rapido
BASIC A resumido de ingles para aprender muy rapidoBASIC A resumido de ingles para aprender muy rapido
BASIC A resumido de ingles para aprender muy rapidoabdulmgirul
 
Far Away Friends - Storyboard by Chloe Lemay
Far Away Friends - Storyboard by Chloe LemayFar Away Friends - Storyboard by Chloe Lemay
Far Away Friends - Storyboard by Chloe LemayChloe Lemay
 
next5p21story challenge by danishdavid khan.pdf
next5p21story challenge by danishdavid khan.pdfnext5p21story challenge by danishdavid khan.pdf
next5p21story challenge by danishdavid khan.pdfdanishkhan798905
 
goodbyestoryboardsequencebydanishdavidkhan.pdf
goodbyestoryboardsequencebydanishdavidkhan.pdfgoodbyestoryboardsequencebydanishdavidkhan.pdf
goodbyestoryboardsequencebydanishdavidkhan.pdfdanishkhan798905
 
1. Assumptions, Misconceptions, Functions, and Philosophy of Art.pdf
1.  Assumptions, Misconceptions, Functions, and Philosophy of Art.pdf1.  Assumptions, Misconceptions, Functions, and Philosophy of Art.pdf
1. Assumptions, Misconceptions, Functions, and Philosophy of Art.pdfGiovanniPierroJrMali
 
OPDD 2420 capstone small.pdf
OPDD 2420 capstone small.pdfOPDD 2420 capstone small.pdf
OPDD 2420 capstone small.pdfloganmartinw
 
Firebuds_Cut N Chrome Caper_Renee Badua 2023.pdf
Firebuds_Cut N Chrome Caper_Renee Badua 2023.pdfFirebuds_Cut N Chrome Caper_Renee Badua 2023.pdf
Firebuds_Cut N Chrome Caper_Renee Badua 2023.pdfreneecamilleb
 
IDMPO Slot Gacor Mudah Menang Dengan Cepat
IDMPO Slot Gacor Mudah Menang Dengan CepatIDMPO Slot Gacor Mudah Menang Dengan Cepat
IDMPO Slot Gacor Mudah Menang Dengan Cepatserlywin77
 
Gutierrez_Juan_Retail Store Scavenger Hunt
Gutierrez_Juan_Retail Store Scavenger HuntGutierrez_Juan_Retail Store Scavenger Hunt
Gutierrez_Juan_Retail Store Scavenger Huntjuangutiiofficial
 
COLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptx
COLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptxCOLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptx
COLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptxevelynpanilaglipura1
 
Art of a Ferret - Beatboards - Julia Vallega
Art of a Ferret - Beatboards - Julia VallegaArt of a Ferret - Beatboards - Julia Vallega
Art of a Ferret - Beatboards - Julia VallegaJuliaVallega
 
MacedoAngelina_KJM_01.pdf
MacedoAngelina_KJM_01.pdfMacedoAngelina_KJM_01.pdf
MacedoAngelina_KJM_01.pdfAngelinaMacedo3
 

Recently uploaded (16)

Jazmin portfolio by DR.Jibachha Sah for arth
Jazmin portfolio by DR.Jibachha Sah for arthJazmin portfolio by DR.Jibachha Sah for arth
Jazmin portfolio by DR.Jibachha Sah for arth
 
PPT Skripsi #2 tanpa hyperlnbnmbbink.pptxb
PPT Skripsi #2 tanpa hyperlnbnmbbink.pptxbPPT Skripsi #2 tanpa hyperlnbnmbbink.pptxb
PPT Skripsi #2 tanpa hyperlnbnmbbink.pptxb
 
Ms.Shahla Baghdad`- alyarmouk street - .pdf
Ms.Shahla Baghdad`- alyarmouk street - .pdfMs.Shahla Baghdad`- alyarmouk street - .pdf
Ms.Shahla Baghdad`- alyarmouk street - .pdf
 
Multicolor Clouds Daily Class Agenda Template.pdf
Multicolor Clouds Daily Class Agenda Template.pdfMulticolor Clouds Daily Class Agenda Template.pdf
Multicolor Clouds Daily Class Agenda Template.pdf
 
BASIC A resumido de ingles para aprender muy rapido
BASIC A resumido de ingles para aprender muy rapidoBASIC A resumido de ingles para aprender muy rapido
BASIC A resumido de ingles para aprender muy rapido
 
Far Away Friends - Storyboard by Chloe Lemay
Far Away Friends - Storyboard by Chloe LemayFar Away Friends - Storyboard by Chloe Lemay
Far Away Friends - Storyboard by Chloe Lemay
 
next5p21story challenge by danishdavid khan.pdf
next5p21story challenge by danishdavid khan.pdfnext5p21story challenge by danishdavid khan.pdf
next5p21story challenge by danishdavid khan.pdf
 
goodbyestoryboardsequencebydanishdavidkhan.pdf
goodbyestoryboardsequencebydanishdavidkhan.pdfgoodbyestoryboardsequencebydanishdavidkhan.pdf
goodbyestoryboardsequencebydanishdavidkhan.pdf
 
1. Assumptions, Misconceptions, Functions, and Philosophy of Art.pdf
1.  Assumptions, Misconceptions, Functions, and Philosophy of Art.pdf1.  Assumptions, Misconceptions, Functions, and Philosophy of Art.pdf
1. Assumptions, Misconceptions, Functions, and Philosophy of Art.pdf
 
OPDD 2420 capstone small.pdf
OPDD 2420 capstone small.pdfOPDD 2420 capstone small.pdf
OPDD 2420 capstone small.pdf
 
Firebuds_Cut N Chrome Caper_Renee Badua 2023.pdf
Firebuds_Cut N Chrome Caper_Renee Badua 2023.pdfFirebuds_Cut N Chrome Caper_Renee Badua 2023.pdf
Firebuds_Cut N Chrome Caper_Renee Badua 2023.pdf
 
IDMPO Slot Gacor Mudah Menang Dengan Cepat
IDMPO Slot Gacor Mudah Menang Dengan CepatIDMPO Slot Gacor Mudah Menang Dengan Cepat
IDMPO Slot Gacor Mudah Menang Dengan Cepat
 
Gutierrez_Juan_Retail Store Scavenger Hunt
Gutierrez_Juan_Retail Store Scavenger HuntGutierrez_Juan_Retail Store Scavenger Hunt
Gutierrez_Juan_Retail Store Scavenger Hunt
 
COLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptx
COLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptxCOLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptx
COLLABORATIVE&TRANSFORMATIVE.evelynpanilaglipurapptx
 
Art of a Ferret - Beatboards - Julia Vallega
Art of a Ferret - Beatboards - Julia VallegaArt of a Ferret - Beatboards - Julia Vallega
Art of a Ferret - Beatboards - Julia Vallega
 
MacedoAngelina_KJM_01.pdf
MacedoAngelina_KJM_01.pdfMacedoAngelina_KJM_01.pdf
MacedoAngelina_KJM_01.pdf
 

Featured

Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024Search Engine Journal
 
5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summarySpeakerHub
 
ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd Clark Boyd
 
Getting into the tech field. what next
Getting into the tech field. what next Getting into the tech field. what next
Getting into the tech field. what next Tessa Mero
 
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search IntentGoogle's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search IntentLily Ray
 
Time Management & Productivity - Best Practices
Time Management & Productivity -  Best PracticesTime Management & Productivity -  Best Practices
Time Management & Productivity - Best PracticesVit Horky
 
The six step guide to practical project management
The six step guide to practical project managementThe six step guide to practical project management
The six step guide to practical project managementMindGenius
 
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...RachelPearson36
 
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...Applitools
 
12 Ways to Increase Your Influence at Work
12 Ways to Increase Your Influence at Work12 Ways to Increase Your Influence at Work
12 Ways to Increase Your Influence at WorkGetSmarter
 
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...DevGAMM Conference
 
Barbie - Brand Strategy Presentation
Barbie - Brand Strategy PresentationBarbie - Brand Strategy Presentation
Barbie - Brand Strategy PresentationErica Santiago
 
Good Stuff Happens in 1:1 Meetings: Why you need them and how to do them well
Good Stuff Happens in 1:1 Meetings: Why you need them and how to do them wellGood Stuff Happens in 1:1 Meetings: Why you need them and how to do them well
Good Stuff Happens in 1:1 Meetings: Why you need them and how to do them wellSaba Software
 
Introduction to C Programming Language
Introduction to C Programming LanguageIntroduction to C Programming Language
Introduction to C Programming LanguageSimplilearn
 
The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...
The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...
The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...Palo Alto Software
 
9 Tips for a Work-free Vacation
9 Tips for a Work-free Vacation9 Tips for a Work-free Vacation
9 Tips for a Work-free VacationWeekdone.com
 

Featured (20)

Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024Trends In Paid Search: Navigating The Digital Landscape In 2024
Trends In Paid Search: Navigating The Digital Landscape In 2024
 
5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary5 Public speaking tips from TED - Visualized summary
5 Public speaking tips from TED - Visualized summary
 
ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd ChatGPT and the Future of Work - Clark Boyd
ChatGPT and the Future of Work - Clark Boyd
 
Getting into the tech field. what next
Getting into the tech field. what next Getting into the tech field. what next
Getting into the tech field. what next
 
Google's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search IntentGoogle's Just Not That Into You: Understanding Core Updates & Search Intent
Google's Just Not That Into You: Understanding Core Updates & Search Intent
 
How to have difficult conversations
How to have difficult conversations How to have difficult conversations
How to have difficult conversations
 
Introduction to Data Science
Introduction to Data ScienceIntroduction to Data Science
Introduction to Data Science
 
Time Management & Productivity - Best Practices
Time Management & Productivity -  Best PracticesTime Management & Productivity -  Best Practices
Time Management & Productivity - Best Practices
 
The six step guide to practical project management
The six step guide to practical project managementThe six step guide to practical project management
The six step guide to practical project management
 
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
Beginners Guide to TikTok for Search - Rachel Pearson - We are Tilt __ Bright...
 
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
Unlocking the Power of ChatGPT and AI in Testing - A Real-World Look, present...
 
12 Ways to Increase Your Influence at Work
12 Ways to Increase Your Influence at Work12 Ways to Increase Your Influence at Work
12 Ways to Increase Your Influence at Work
 
ChatGPT webinar slides
ChatGPT webinar slidesChatGPT webinar slides
ChatGPT webinar slides
 
More than Just Lines on a Map: Best Practices for U.S Bike Routes
More than Just Lines on a Map: Best Practices for U.S Bike RoutesMore than Just Lines on a Map: Best Practices for U.S Bike Routes
More than Just Lines on a Map: Best Practices for U.S Bike Routes
 
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
Ride the Storm: Navigating Through Unstable Periods / Katerina Rudko (Belka G...
 
Barbie - Brand Strategy Presentation
Barbie - Brand Strategy PresentationBarbie - Brand Strategy Presentation
Barbie - Brand Strategy Presentation
 
Good Stuff Happens in 1:1 Meetings: Why you need them and how to do them well
Good Stuff Happens in 1:1 Meetings: Why you need them and how to do them wellGood Stuff Happens in 1:1 Meetings: Why you need them and how to do them well
Good Stuff Happens in 1:1 Meetings: Why you need them and how to do them well
 
Introduction to C Programming Language
Introduction to C Programming LanguageIntroduction to C Programming Language
Introduction to C Programming Language
 
The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...
The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...
The Pixar Way: 37 Quotes on Developing and Maintaining a Creative Company (fr...
 
9 Tips for a Work-free Vacation
9 Tips for a Work-free Vacation9 Tips for a Work-free Vacation
9 Tips for a Work-free Vacation