SlideShare a Scribd company logo

Peptidos y proteinas antibioticos

Charla científica

1 of 65
Download to read offline
Nuestras otras defensas: Proteínas propias con acción antibiótica 
Luis Rivas 
luis.rivas@cib.csic.es
PROTEÍNAS Y PÉPTIDOS ANTIMICROBIANOS: 
¿Qué son?
ADN -> ARN-> Proteína 
Proteína está hecha de aminoácidos (20 diferentes) 
Qué es un péptido 
PÉPTIDO: UNA PROTEÍNA O UN TROZO DE PROTEÍNA PEQUEÑO
Peptidos y proteinas antibioticos
Inducción de actividad microbicida en la hemolinfa 
de la larva de la mosca de la carne (Phormia terranovae) 
Cociancich et al,(1994) Parasitol. Today 10:132 
Tiempo (h) 
0 
3 
6 
9 
12 
24 
48 
Actividad Bactericida 
(Zona de Inhibciión (mm)) 
0 
2 
4 
6 
8 
10 
12 
14 
Bacteria 
Injury 
Control
Inmunidad innata 
Inmunidad antígeno específica 
Preservación de los péptidos antibióticos en la evolución

More Related Content

What's hot

Presentación Bioquímica clínica II 2012
Presentación Bioquímica clínica II 2012Presentación Bioquímica clínica II 2012
Presentación Bioquímica clínica II 2012Claudia Castillo
 
DIAGNOSTICO DE INFECCIONES VIRALES
DIAGNOSTICO DE INFECCIONES VIRALESDIAGNOSTICO DE INFECCIONES VIRALES
DIAGNOSTICO DE INFECCIONES VIRALESLaura Moreno
 
Mecanismos de resistencia bacteriana a los antimicrobianos
Mecanismos de resistencia bacteriana a los antimicrobianosMecanismos de resistencia bacteriana a los antimicrobianos
Mecanismos de resistencia bacteriana a los antimicrobianosamesys
 
FAST PROTEIN LIQUID CHROMATOGRAPHY.pptx
FAST PROTEIN LIQUID CHROMATOGRAPHY.pptxFAST PROTEIN LIQUID CHROMATOGRAPHY.pptx
FAST PROTEIN LIQUID CHROMATOGRAPHY.pptxRanjitaRaniSamal
 
Sareer ahmad khan
Sareer ahmad khanSareer ahmad khan
Sareer ahmad khansareerkhan3
 
Actualizaciones en el estudio de Líquidos Biológicos
Actualizaciones en el estudio de Líquidos BiológicosActualizaciones en el estudio de Líquidos Biológicos
Actualizaciones en el estudio de Líquidos BiológicosJose Castellano del Toro
 
Mecanismos de resistencia bacteriana a antimicrobianos
Mecanismos de resistencia bacteriana a antimicrobianosMecanismos de resistencia bacteriana a antimicrobianos
Mecanismos de resistencia bacteriana a antimicrobianosCarla Rivera González
 
Práctica de floculación y pruebas rápidas
Práctica de floculación y pruebas rápidasPráctica de floculación y pruebas rápidas
Práctica de floculación y pruebas rápidasesmer77
 
Contaminacion Bacteriana Biomerieux
Contaminacion Bacteriana BiomerieuxContaminacion Bacteriana Biomerieux
Contaminacion Bacteriana Biomerieuxlucasmerel
 
CCalidad Interno UST
CCalidad Interno USTCCalidad Interno UST
CCalidad Interno USTYerko Bravo
 
Chemiluminescence immunoassay and Immunofluorescence Assay
Chemiluminescence immunoassay and Immunofluorescence AssayChemiluminescence immunoassay and Immunofluorescence Assay
Chemiluminescence immunoassay and Immunofluorescence AssayAmany Elsayed
 
Betalactamasas expo...
Betalactamasas expo...Betalactamasas expo...
Betalactamasas expo...Erley Madrid
 
6 Investigacion de anticuerpos irregulares
6 Investigacion de anticuerpos irregulares6 Investigacion de anticuerpos irregulares
6 Investigacion de anticuerpos irregularesCEPECAP TRUJILLO
 
Reacciones Ag-Ac por técnicas complejas
Reacciones Ag-Ac por técnicas complejasReacciones Ag-Ac por técnicas complejas
Reacciones Ag-Ac por técnicas complejasSofía Jaramillo Quiroz
 

What's hot (20)

Presentación Bioquímica clínica II 2012
Presentación Bioquímica clínica II 2012Presentación Bioquímica clínica II 2012
Presentación Bioquímica clínica II 2012
 
DIAGNOSTICO DE INFECCIONES VIRALES
DIAGNOSTICO DE INFECCIONES VIRALESDIAGNOSTICO DE INFECCIONES VIRALES
DIAGNOSTICO DE INFECCIONES VIRALES
 
Mecanismos de resistencia bacteriana a los antimicrobianos
Mecanismos de resistencia bacteriana a los antimicrobianosMecanismos de resistencia bacteriana a los antimicrobianos
Mecanismos de resistencia bacteriana a los antimicrobianos
 
FAST PROTEIN LIQUID CHROMATOGRAPHY.pptx
FAST PROTEIN LIQUID CHROMATOGRAPHY.pptxFAST PROTEIN LIQUID CHROMATOGRAPHY.pptx
FAST PROTEIN LIQUID CHROMATOGRAPHY.pptx
 
Estudio de proteinas sericas
Estudio de proteinas sericasEstudio de proteinas sericas
Estudio de proteinas sericas
 
Perfiles bioquímicos de laboratorio
Perfiles bioquímicos de laboratorioPerfiles bioquímicos de laboratorio
Perfiles bioquímicos de laboratorio
 
Sareer ahmad khan
Sareer ahmad khanSareer ahmad khan
Sareer ahmad khan
 
Actualizaciones en el estudio de Líquidos Biológicos
Actualizaciones en el estudio de Líquidos BiológicosActualizaciones en el estudio de Líquidos Biológicos
Actualizaciones en el estudio de Líquidos Biológicos
 
Practica 13. vih
Practica 13.   vihPractica 13.   vih
Practica 13. vih
 
Mecanismos de resistencia bacteriana a antimicrobianos
Mecanismos de resistencia bacteriana a antimicrobianosMecanismos de resistencia bacteriana a antimicrobianos
Mecanismos de resistencia bacteriana a antimicrobianos
 
Práctica de floculación y pruebas rápidas
Práctica de floculación y pruebas rápidasPráctica de floculación y pruebas rápidas
Práctica de floculación y pruebas rápidas
 
Western blot.
Western blot.Western blot.
Western blot.
 
Atlasmicrobiologia1
Atlasmicrobiologia1Atlasmicrobiologia1
Atlasmicrobiologia1
 
Contaminacion Bacteriana Biomerieux
Contaminacion Bacteriana BiomerieuxContaminacion Bacteriana Biomerieux
Contaminacion Bacteriana Biomerieux
 
CCalidad Interno UST
CCalidad Interno USTCCalidad Interno UST
CCalidad Interno UST
 
Chemiluminescence immunoassay and Immunofluorescence Assay
Chemiluminescence immunoassay and Immunofluorescence AssayChemiluminescence immunoassay and Immunofluorescence Assay
Chemiluminescence immunoassay and Immunofluorescence Assay
 
Betalactamasas expo...
Betalactamasas expo...Betalactamasas expo...
Betalactamasas expo...
 
6 Investigacion de anticuerpos irregulares
6 Investigacion de anticuerpos irregulares6 Investigacion de anticuerpos irregulares
6 Investigacion de anticuerpos irregulares
 
Reacciones Ag-Ac por técnicas complejas
Reacciones Ag-Ac por técnicas complejasReacciones Ag-Ac por técnicas complejas
Reacciones Ag-Ac por técnicas complejas
 
Lectura antibiograma cocos gram postivos
Lectura antibiograma cocos gram postivosLectura antibiograma cocos gram postivos
Lectura antibiograma cocos gram postivos
 

Similar to Peptidos y proteinas antibioticos

Exotoxinas
ExotoxinasExotoxinas
ExotoxinasIPN
 
A N T I B I O T I C O S F I N A L E X P 24 S E T 07
A N T I B I O T I C O S   F I N A L  E X P 24   S E T 07A N T I B I O T I C O S   F I N A L  E X P 24   S E T 07
A N T I B I O T I C O S F I N A L E X P 24 S E T 07ogamase
 
Clase_Antibioticos_y_Resistencia.pdf
Clase_Antibioticos_y_Resistencia.pdfClase_Antibioticos_y_Resistencia.pdf
Clase_Antibioticos_y_Resistencia.pdfAlexFernandes559301
 
Taller semillas 2011 Paul Chavarriaga
Taller semillas 2011 Paul ChavarriagaTaller semillas 2011 Paul Chavarriaga
Taller semillas 2011 Paul ChavarriagaCIAT
 
Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...
Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...
Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...Lina Maria Ruiz Hincapie
 
clase 17, 18, 19 y 20 Inmunidad contra Bacterias, virus, parasitos y hongos....
clase 17, 18, 19 y 20  Inmunidad contra Bacterias, virus, parasitos y hongos....clase 17, 18, 19 y 20  Inmunidad contra Bacterias, virus, parasitos y hongos....
clase 17, 18, 19 y 20 Inmunidad contra Bacterias, virus, parasitos y hongos....BleyKennethSedano
 
Farmacologia de los antimicrobianos
Farmacologia de los antimicrobianosFarmacologia de los antimicrobianos
Farmacologia de los antimicrobianosSaneva Zuazo
 
Animales TransgéNicos
Animales TransgéNicosAnimales TransgéNicos
Animales TransgéNicosEugenio Roman
 
Anemia megaloblastica
Anemia megaloblasticaAnemia megaloblastica
Anemia megaloblasticaFernanda Mena
 
Presentación respuesta inmune a malaria
Presentación respuesta inmune a malariaPresentación respuesta inmune a malaria
Presentación respuesta inmune a malariaJuliana Caicedo
 
Bacteriófagos y sus aplicaciones en seguridad alimentaria
Bacteriófagos y sus aplicaciones en seguridad alimentariaBacteriófagos y sus aplicaciones en seguridad alimentaria
Bacteriófagos y sus aplicaciones en seguridad alimentariaDairybiotech
 

Similar to Peptidos y proteinas antibioticos (20)

Exotoxinas
ExotoxinasExotoxinas
Exotoxinas
 
Fam pseudomonaceae
Fam pseudomonaceaeFam pseudomonaceae
Fam pseudomonaceae
 
A N T I B I O T I C O S F I N A L E X P 24 S E T 07
A N T I B I O T I C O S   F I N A L  E X P 24   S E T 07A N T I B I O T I C O S   F I N A L  E X P 24   S E T 07
A N T I B I O T I C O S F I N A L E X P 24 S E T 07
 
Clase_Antibioticos_y_Resistencia.pdf
Clase_Antibioticos_y_Resistencia.pdfClase_Antibioticos_y_Resistencia.pdf
Clase_Antibioticos_y_Resistencia.pdf
 
Antibioticos
AntibioticosAntibioticos
Antibioticos
 
Antibioticos
AntibioticosAntibioticos
Antibioticos
 
Taller semillas 2011 Paul Chavarriaga
Taller semillas 2011 Paul ChavarriagaTaller semillas 2011 Paul Chavarriaga
Taller semillas 2011 Paul Chavarriaga
 
Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...
Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...
Estudio de la expresión de plásmidos de adn y su respuesta inmune en un model...
 
clase 17, 18, 19 y 20 Inmunidad contra Bacterias, virus, parasitos y hongos....
clase 17, 18, 19 y 20  Inmunidad contra Bacterias, virus, parasitos y hongos....clase 17, 18, 19 y 20  Inmunidad contra Bacterias, virus, parasitos y hongos....
clase 17, 18, 19 y 20 Inmunidad contra Bacterias, virus, parasitos y hongos....
 
Ultima clase
Ultima claseUltima clase
Ultima clase
 
Biologia De La Periodontitis
Biologia De La PeriodontitisBiologia De La Periodontitis
Biologia De La Periodontitis
 
Farmacologia de los antimicrobianos
Farmacologia de los antimicrobianosFarmacologia de los antimicrobianos
Farmacologia de los antimicrobianos
 
salmonellas
salmonellassalmonellas
salmonellas
 
Animales TransgéNicos
Animales TransgéNicosAnimales TransgéNicos
Animales TransgéNicos
 
Anemia megaloblastica
Anemia megaloblasticaAnemia megaloblastica
Anemia megaloblastica
 
Presentación respuesta inmune a malaria
Presentación respuesta inmune a malariaPresentación respuesta inmune a malaria
Presentación respuesta inmune a malaria
 
Bacteriófagos y sus aplicaciones en seguridad alimentaria
Bacteriófagos y sus aplicaciones en seguridad alimentariaBacteriófagos y sus aplicaciones en seguridad alimentaria
Bacteriófagos y sus aplicaciones en seguridad alimentaria
 
Antibiotico
AntibioticoAntibiotico
Antibiotico
 
Clase de antibióticos
Clase de antibióticosClase de antibióticos
Clase de antibióticos
 
Sepsis. Dr. Justo Venereo
Sepsis. Dr. Justo VenereoSepsis. Dr. Justo Venereo
Sepsis. Dr. Justo Venereo
 

More from Enrique de la Rosa (20)

Sostenibilidad energética
Sostenibilidad energéticaSostenibilidad energética
Sostenibilidad energética
 
Programa II taller primeros pasos en el emprendimiento científico
Programa II taller primeros pasos en el emprendimiento científicoPrograma II taller primeros pasos en el emprendimiento científico
Programa II taller primeros pasos en el emprendimiento científico
 
Programa ii taller primeros pasos
Programa ii taller primeros pasosPrograma ii taller primeros pasos
Programa ii taller primeros pasos
 
Acta cyt27
Acta cyt27Acta cyt27
Acta cyt27
 
Informe pisa esp
Informe pisa espInforme pisa esp
Informe pisa esp
 
Visión 45 sebbm
Visión 45 sebbmVisión 45 sebbm
Visión 45 sebbm
 
Medicina con ciencia
Medicina con cienciaMedicina con ciencia
Medicina con ciencia
 
La dura vida en la frontera
La dura vida en la fronteraLa dura vida en la frontera
La dura vida en la frontera
 
Nutricion y salud
Nutricion y saludNutricion y salud
Nutricion y salud
 
Evolucion del lenguaje
Evolucion del lenguajeEvolucion del lenguaje
Evolucion del lenguaje
 
Mas alla del higgs
Mas alla del higgs Mas alla del higgs
Mas alla del higgs
 
123 full
123 full123 full
123 full
 
Cambio climático
Cambio climáticoCambio climático
Cambio climático
 
¡Todo es Química!
¡Todo es Química!¡Todo es Química!
¡Todo es Química!
 
Ciencia con chocolate ita
Ciencia con chocolate itaCiencia con chocolate ita
Ciencia con chocolate ita
 
Planeta vivo c briones
Planeta vivo c brionesPlaneta vivo c briones
Planeta vivo c briones
 
El origen de la vida c briones
El origen de la vida c brionesEl origen de la vida c briones
El origen de la vida c briones
 
Vacunas
VacunasVacunas
Vacunas
 
Vacunas
VacunasVacunas
Vacunas
 
Vacunas
VacunasVacunas
Vacunas
 

Recently uploaded

Análisis Importancia de la etica en la psicología.docx
Análisis Importancia de la  etica en la psicología.docxAnálisis Importancia de la  etica en la psicología.docx
Análisis Importancia de la etica en la psicología.docxDulceMaraMrquezBolai
 
Experiencia de Paciente en Atención Intermedia: Patient journey
Experiencia de Paciente en Atención Intermedia: Patient journeyExperiencia de Paciente en Atención Intermedia: Patient journey
Experiencia de Paciente en Atención Intermedia: Patient journeyBadalona Serveis Assistencials
 
presentación solo de prueba de nutrición.
presentación solo de prueba de nutrición.presentación solo de prueba de nutrición.
presentación solo de prueba de nutrición.carlocarrillocacc
 
César Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdf
César Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdfCésar Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdf
César Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdfCsarArnulfoMoralesLp1
 
Pericarditis , tipo , clasificación, generalidades
Pericarditis , tipo , clasificación, generalidadesPericarditis , tipo , clasificación, generalidades
Pericarditis , tipo , clasificación, generalidadesjohanmedina40
 
UROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIA
UROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIAUROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIA
UROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIAJaveriana Cali
 
HIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIA
HIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIAHIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIA
HIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIAELVISGLEN
 
enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.
enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.
enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.ElyUseche1
 
ESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docx
ESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docxESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docx
ESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docxFidelArturoMissRamre
 
(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)
(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)
(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)UDMAFyC SECTOR ZARAGOZA II
 
Herramientas tecnológicas para los abogados.pptx
Herramientas tecnológicas para los abogados.pptxHerramientas tecnológicas para los abogados.pptx
Herramientas tecnológicas para los abogados.pptxaliciagarcia710
 
NOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantes
NOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantesNOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantes
NOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantesRicardo Alan Ramírez
 
(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)
(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)
(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)UDMAFyC SECTOR ZARAGOZA II
 
César Arnulfo Morales López - Grado Maestría
César Arnulfo Morales López - Grado MaestríaCésar Arnulfo Morales López - Grado Maestría
César Arnulfo Morales López - Grado MaestríaCsarArnulfoMoralesLp1
 
ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...
ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...
ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...Ricardo Alan Ramírez
 
Infecciones Micoticas Oculares y sus principales carácter
Infecciones Micoticas Oculares y sus principales carácterInfecciones Micoticas Oculares y sus principales carácter
Infecciones Micoticas Oculares y sus principales carácterecografistaintegral
 
examencarbohidratos ycuestionario d.pptx
examencarbohidratos ycuestionario d.pptxexamencarbohidratos ycuestionario d.pptx
examencarbohidratos ycuestionario d.pptxexecutor3001
 
(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)
(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)
(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)UDMAFyC SECTOR ZARAGOZA II
 
Trastornos infecciosos Tracto urinario e ITS
Trastornos infecciosos Tracto urinario e ITSTrastornos infecciosos Tracto urinario e ITS
Trastornos infecciosos Tracto urinario e ITSJaveriana Cali
 
Soporte básico de vida(rescata y salva vidas)
Soporte básico de vida(rescata y salva vidas)Soporte básico de vida(rescata y salva vidas)
Soporte básico de vida(rescata y salva vidas)MoralesChirillaYohan
 

Recently uploaded (20)

Análisis Importancia de la etica en la psicología.docx
Análisis Importancia de la  etica en la psicología.docxAnálisis Importancia de la  etica en la psicología.docx
Análisis Importancia de la etica en la psicología.docx
 
Experiencia de Paciente en Atención Intermedia: Patient journey
Experiencia de Paciente en Atención Intermedia: Patient journeyExperiencia de Paciente en Atención Intermedia: Patient journey
Experiencia de Paciente en Atención Intermedia: Patient journey
 
presentación solo de prueba de nutrición.
presentación solo de prueba de nutrición.presentación solo de prueba de nutrición.
presentación solo de prueba de nutrición.
 
César Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdf
César Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdfCésar Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdf
César Arnulfo Morales López - CNEIP Premio Nacional Psicología.pdf
 
Pericarditis , tipo , clasificación, generalidades
Pericarditis , tipo , clasificación, generalidadesPericarditis , tipo , clasificación, generalidades
Pericarditis , tipo , clasificación, generalidades
 
UROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIA
UROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIAUROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIA
UROLITIASIS 2024 MDMF JAVERIANA CALI COLOMBIA
 
HIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIA
HIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIAHIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIA
HIDROCELE CONCEPTOS GENERALES Y FISIOPATOLOGIA
 
enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.
enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.
enfoque-cognitivo.pdfterapeuta Ocupacional María Lucía Santacruz - 2002.
 
ESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docx
ESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docxESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docx
ESCRITO DEL IMSS N 47 DE FIDEL ARTURO MISS RAMIREZ.docx
 
(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)
(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)
(2024-02-20). AEROSOLTERAPIA EN AP Y URGENCIAS (PPT)
 
Herramientas tecnológicas para los abogados.pptx
Herramientas tecnológicas para los abogados.pptxHerramientas tecnológicas para los abogados.pptx
Herramientas tecnológicas para los abogados.pptx
 
NOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantes
NOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantesNOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantes
NOTAS DE PEDIATRIA. pdf en el cual puedes revisar las nogtas mas importantes
 
(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)
(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)
(2024-02-27). DOCTOR, ME AYUDAS A DEJAR DE FUMAR (DOC)
 
César Arnulfo Morales López - Grado Maestría
César Arnulfo Morales López - Grado MaestríaCésar Arnulfo Morales López - Grado Maestría
César Arnulfo Morales López - Grado Maestría
 
ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...
ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...
ADMINISTRACIÓN DE LOS SERVICIOS DE ENFERMERÍA-MARÍA DE LA LUZ BALDERAS PEDRER...
 
Infecciones Micoticas Oculares y sus principales carácter
Infecciones Micoticas Oculares y sus principales carácterInfecciones Micoticas Oculares y sus principales carácter
Infecciones Micoticas Oculares y sus principales carácter
 
examencarbohidratos ycuestionario d.pptx
examencarbohidratos ycuestionario d.pptxexamencarbohidratos ycuestionario d.pptx
examencarbohidratos ycuestionario d.pptx
 
(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)
(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)
(2024-02-20). Terapia inhalatoria. Manejo desde AP y urgencias (DOC)
 
Trastornos infecciosos Tracto urinario e ITS
Trastornos infecciosos Tracto urinario e ITSTrastornos infecciosos Tracto urinario e ITS
Trastornos infecciosos Tracto urinario e ITS
 
Soporte básico de vida(rescata y salva vidas)
Soporte básico de vida(rescata y salva vidas)Soporte básico de vida(rescata y salva vidas)
Soporte básico de vida(rescata y salva vidas)
 

Peptidos y proteinas antibioticos

  • 1. Nuestras otras defensas: Proteínas propias con acción antibiótica Luis Rivas luis.rivas@cib.csic.es
  • 2. PROTEÍNAS Y PÉPTIDOS ANTIMICROBIANOS: ¿Qué son?
  • 3. ADN -> ARN-> Proteína Proteína está hecha de aminoácidos (20 diferentes) Qué es un péptido PÉPTIDO: UNA PROTEÍNA O UN TROZO DE PROTEÍNA PEQUEÑO
  • 5. Inducción de actividad microbicida en la hemolinfa de la larva de la mosca de la carne (Phormia terranovae) Cociancich et al,(1994) Parasitol. Today 10:132 Tiempo (h) 0 3 6 9 12 24 48 Actividad Bactericida (Zona de Inhibciión (mm)) 0 2 4 6 8 10 12 14 Bacteria Injury Control
  • 6. Inmunidad innata Inmunidad antígeno específica Preservación de los péptidos antibióticos en la evolución
  • 7. Qué tiempo requieren los anticuerpos para “aparecer”? Escherichia coli se divide cada 20 min Los anticuerpos tardan en aparecer con memoria: 3 días . E.coli se ha duplicado: 288 veces El número de bacterias que habría en 3 días : 2 288 ~ 5 x1086 500 x 1000 x1000 x1000 x1000 x1000 x 1000 x1000 x1000 x1000 x1000 X 1000 x1000 x1000 x1000 x1000 x 1000 x1000 x1000 x1000 x1000 X 1000 x1000 x1000 x1000 x1000 x 1000 x1000 x1000
  • 8. 106 proteínas y péptidos antibióticos Tipos: Constitutivos De inducción rápida Localización de los péptidos antimicrobianos
  • 9. LL-37 [LL-37, 37 aa] Péptidos a-helicoidales Ricos en un aminoácido específico Indolicidina. ILPWKWPWWPWRR-NH2 Péptidos circulares RTD-1 GFCRCLCR R R TC I CRCVG H ßD- 1 . DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Péptidos cíclicos (disulfuro) Principales grupos de péptidos antibióticos
  • 10. Alta carga positiva Anfipaticidad Escasas modificaciones postraduccionales Codificados por genes Características comunes a los péptidos antibióticos
  • 12. Cómo es una membrana biológica
  • 13. Duelas de barril Tapizado Dos estados Poro Toroidal Agujero de gusano Principales modelos de permeabilización de membrana por PAM
  • 15. E.coli L. donovani 9.3 20 23.8 Fosfatidilinositol Fosfatidilserina Fosfatidilglicero Cardiolipina Ácido fosfatídico Hepatocito Fosfolípidos con carga negativa en la membr. plasmática (%)
  • 16. Citoplasma Medio Extracelular + + + + + + + + + + + + EUCARIOTAS SUPERIORES PROCARIOTAS EUCARIOTAS INFERIORES ¿CÉLULAS TUMORALES? ¿Cómo se enteran los péptidos de si es patógeno o célula propia?
  • 18. Comparación antibiótico clásico-Péptido antimicrobiano Antibiótico clásico Péptido Antimicrobiano
  • 19. -EL MECANISMO LETAL ES UNA INTERACCIÓN ESTEQUIOMÉTRICA, Y NO LA INHIBICIÓN DE UN SISTEMA BIOLÓGICO. - LA ESPECIFIDAD DE MEMBRANA IMPONE LÍMITES PARA EL DISEÑO DE AMPs ( > μM) -INDUCCIÓN DE RESISTENCIAS EXTREMADAMENTE ESCASA CONCLUSIONES -UN MISMO PÉPTIDO ANTIMICROBIANO ES POTENCIALMENTE ACTIVO FRENTE A UNA AMPLIA VARIEDAD DE PATÓGENOS.
  • 20. H Chu et al. Science 2012;337:477-481 Nano-redes (HD6)
  • 21. Entrada autopromovida de los PAMs en bacterias Gram- bacteria
  • 24. H2N COOH R1 Síntesis de Péptidos Un dipéptido requiere 6 reacciones químicas : H2N COOH R2 HN R1 Prot O Act HN COOH R1 Prot Protección del N-amino Activación del COOH Protección del COOH H2N R2 O O-Prot 1 2 3 4 5-6 Acoplamiento ( formación del enlace Peptídico) H2N NH COOH R1 O R2 HN N O-Prot R1 O R2 O Prot H Desprotección de amino y carboxilo
  • 25. Síntesis en fase sólida de péptidos. Modificaciones disponibles HN NH HN NH HN H2 C NH HN NH O O O O H2N O O NH2 O NH2 S O H3C CH3 O O HO OH OH OH O O Flu H3C O O O3P 2 Residuos D Fosforilación sulfatación lipidación glicosilación Residuos no-naturales Marcaje fluorescente Marcaje isotópico Bloqueo de extremos Isopéptido peptoides
  • 26. Bruce E. Merrifield Hans G. Boman David Andreu Péptido quimera
  • 27. KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 CECROPINA A MELITINA GIGAVLKVLTTGLPALISWIKRKRQQ-NH2 CA(1-8)M(1-18) KWKLFKKI-GIGAVLKVLTTGLPALIS-NH2
  • 28. Actividad leishmanicida de CA(1-8)M(1-18) 0.5 μM 1.0 μM 2.0μM -3 -20 -40 -100 Tiempo (s) 0 100 200 300 Fluorescencia (u.a.) 0 2 4 6 Adición de Péptido Despolarización de la membrana plasmática Microscopía electrónica
  • 29. K+ K+ K+ K+ Na+ Distorsión de membrana -Cecropinas -Magaininas -Defensinas de mamíferos Diana intracelular Histatina -Buforin a -Pirrocorricina K+ K+ K+ Na+ Na+ Na+ Na+ Na+ Na+ Na+ K+ K+ K+
  • 30. Control 12 mM L-Hst5 3 mM Dhvar4 Histatina 5, un péptido antibiótico humano de la saliva actúa sobre la mitocondria de Leishmania L-Hst5 (DSHAKRHHGYKRKFHEKHHSHRGY)
  • 31. GSH TSH TSH GSH TSH TSH TSH SH HS HS SH S -S DIANA
  • 32. MILTEFOSINA (HEXADECILFOSFOCOLINA) -Desarrollada inicialmente como fármaco antitumoral -Primer fármaco oral con éxito frente a la Leishmaniasis -Carente de efectos secundarios graves -Efectiva contra la LV y la LC?? - Efectiva contra aislados resistentes a antimoniales . . . -Efectiva sobre otros patógenos : Acanthamoeba, hongos, T. cruzi O P O N O O Miltefosina (MT)
  • 33. LdmT y el transporte de Miltefosine Pérez-Victoria, F.J. Et al, 2006, Drug Resist Update ;9:26
  • 34. Miltefosina fluorescente (F.Amat, A.U.Acuña) 7.5 μM B-C11-MT WT R40 Hornillos, V et al. (2008) Bioorg. Med.Chem.Lett. 18, 6336
  • 35. Reactivo [mM] 0 5 10 15 20 25 30 Inhibición de la proliferación (% del control) 0 25 50 75 100 BODIPY-HePC HePC-BODIPY-S-S-Tat HePC-BODIPY-S-Tat Tat Tat + BODIPY-HePC Reversión de la nula incorporación de Miltefosine en R40 L.donovani promastigotes por conjugación a Tat 5 μM en MT-R40 L.donovani promastigotes. BODIPY-HePC HePC-BODIPY-SS-Tat HePC-BODIPY-S-Tat Luque-Ortega (2012)J Control Release. 161:835 Miltefosina Péptido Penetrante
  • 36. PÉPTIDOS ANTIMICROBIANOS: IMPORTANCIA y PATOLOGÍA INFECCIOSA
  • 38. PAMs y declive de poblaciones de anfibios
  • 39. Sapo arlequín de Limosa(Atelopus limosus), PAMs y declive de poblaciones de anfibios Batrachochytrium dendrobatidis
  • 40. Mycobacterium 1895.-Niels Finsen (Nobel, 1903) Vitamina D, TUBERCULOSIS y péptidos antimicrobianos
  • 41. Zasloff, M (2006) Nat.Med. 12, 389 CRAMP GFP-Salmonella Merge Rosenberger, C et al (2004) PNAS, 101,2422 Péptidos antimicrobianos y patógenos intracelulares
  • 42. Ileitis distal Colitis -Wnt defectuoso Menor nº de copias para hBD-2 - Mutación en NOD2 & hbD-3 -Diferenciación defectuosa de las células dePaneth -Bajo HD5& HD6 Bajo hBD-2 & hBD-3 Alta carga bacteriana 106-107 /g 1011-1012/g Incremento drástico de bacterias invasoras Microbiota anormal Estimulación inmune muy alta Inflamación
  • 43. Fallos en la inmunidad innata de la piel:psoriasis
  • 44. ¿DÓNDE SE BUSCAN NUEVOS PÉPTIDOS ANTIMICROBIANOS?
  • 45. PÉPTIDOS DE PROTEÍNAS ALIMENTARIAS : LACTOFERRINA BOVINA
  • 47. Los wallaby retrasan la aparición de su sistema inmune hasta 100 días postparto Dependencia exclusiva de la leche de la madre Identificación de la proteína AGG101
  • 49. Q-defensinas y retrociclina Péptido circular Presente en macacos pero no en los grandes monos Abundancia de pseudogenes
  • 50. Expresión de retrociclina en células humanas
  • 52. UTILIDAD DE LOS PÉPTIDOS ANTIMICROBIANOS
  • 53. Maggot therapy:an alternative for wound infection Dorothy Bonn The Lancet, (2000) 356, 1174
  • 54. ¿Puedo encontrar péptidos antimicrobianos en la farmacia? De origen bacteriano: Bacitracina, gramicidinas A-D yS, polimixina B, estreptogramina, teicoplanina y vancomicina.
  • 55. Nos-Barberá et al (1995) Cornea Queratitis experimental por Pseudomonas aeruginosa Control (-) Control(+) CA(1-7)M(2-9)
  • 56. EL INCREMENTO DE LA ESTABILIDAD METABÓLICA DE LOS PAES ES ESENCIAL PARA SU ACTIVIDAD Papo et al (2006) Cancer Res 66, 5371 D-K6L9 LKLLKKLLKKLLKLL-NH2,
  • 58. Patatas transgénicas con la defensina antifúngica. Infección con el hongo Verticillium dahliae
  • 60. Péptidos antimicrobianos como revestimiento en dispositivos clínicos
  • 61. Lupetti A et al, (2003) Trends biotechnol, 21, 70. Localización de focos infecciosos in vivo
  • 62. Qué hay en la cocina? -Prueba de concepto PAMs y PPCs en la quimioterapia de Leishmania - Permeabilización de membrana - Dianas intracelulares - Reversión de la resistencia por acumulación defectuosa de fármaco. -Biodisponibilidad: - Estabilidad metabólica - Lesiones cutáneas no-diseminadas Favorecer la accesibilidad del fármaco Permite uso de péptidos más agresivos. -Especificidad: -Péptido.- Incorporación de motivos de reconocimiento celular específicos Direccionamiento intracelular. - Molécula cargo: Explotar divergencia hospedero-parásito
  • 63. Y el Microbioma……. Selección de especies “benignas” Inductores de péptidos antimicrobianos Y llamáis a esto vivir?