Pioneer dehradun-english-edition-2021-06-27

20?BD;4
B7>>C8=6F2)8=380F8=
B8;E4A 08A?8BC;
bXYTZ2a^PcXP) 2^]cX]dX]V
cWTXaX_aTbbXeTad]cWT8]SXP]
Sd^ÛBPdaPQW2WPdSWPahP]S
P]d1WPZTaR[X]RWTScWT
bX[eTaTSP[X]cWT PXa
_Xbc^[XgTScTPTeT]c
?=BQ =4F34;78
The India Meteorological
Department (IMD) on
Saturday said that the monsoon
is unlikely to progress to Delhi,
Chandigarh, Haryana, remain-
ing parts of Rajasthan, west
Uttar Pradesh, and Punjab for
the next 7-10 days. Meanwhile
a private weather forecaster
Skymet said that they do not
expect the progress of mon-
soon further until July 6-7.
Therefore northwest India,
including Delhi, Haryana,
Punjab, Rajasthan and west
UP, will continue with hot and
humid weather.
“Prevailing meteorological
conditions, large scale atmos-
pheric features and the forecast
wind pattern by dynamical
models suggest that no
favourable conditions are like-
ly to develop for further
advance of southwest mon-
soon into remaining parts of
Rajasthan, west Uttar Pradesh,
Haryana, Chandigarh, Delhi
and Punjab during next seven
days”, the IMD said in its bul-
letin on Saturday.
It added that subdued rain-
fall activity is very likely to pre-
vail over northwest, central
and western parts of Peninsular
India during next five days.
“Isolated/scattered thunder-
storm activity accompanied
with lightning rainfall is
likely over these regions during
this subdued monsoon activi-
ty period,” it said.
As per the IMD data, there
was 43 per cent excess rain in
northwest India, 36 per cent in
central India, 3 per cent in the
east and northeast India, and 7
per cent in the south peninsu-
la.
Out of 36 subdivisions,
seven recorded large excess
rain (60 per cent or more
above normal), 14 recorded
excess rain (20 to 59 per cent
excess), seven recorded normal
rain (-19 per cent to 19 per
cent) and eight recorded defi-
cient rain (-20 per cent to -59
per cent).
The IMD further stated
that subsequently, moist east-
erly winds are likely to pick up
in strength, causing enhanced
rainfall activity all along the
Himalayan foothills regions of
north Bihar, north Uttar
Pradesh, Uttarakhand and
Himachal Pradesh around July
1 and 2 leading to increased
inflow into the rivers originat-
ing/flowing over these regions.
A0:4B7:B8=67Q =4F34;78
Amid a weakening footprint
of Naxal violence and a
“marked” improvement in the
security situation on the
ground, the Centre has
removed 20 districts out of 90
districts and one State out of 11
affected States from the cover-
age of Central funding under
the Security Related
Expenditure (SRE) scheme for
conducting focused operations
against the ultras to contain the
menace.
The number of most affect-
ed districts in terms of Naxal
violence has also come down
from 30 to 25. These districts
account for 85 per cent of the
violence perpetrated by the
Naxals.
Uttar Pradesh is out of the
coverage of SRE as its three dis-
tricts — Chandauli, Mirzapur
and Sonebhadra — no longer
require targeted interventions
for containing naxalism, offi-
cials said.
Under the SRE scheme, the
Centre reimburses the bulk of
the expenditure incurred by the
Naxal-hit State, including ex-
gratia payment to civilians and
security personnel killed by the
ultras besides the expenses on
mobility, logistics and com-
munication as also ammuni-
tion used for operations against
the ultras by Central paramil-
itary and police forces, among
others.
The move follows a com-
prehensive review of the Naxal-
hit States. The number of dis-
tricts covered under the SRE
scheme has now come down
from 90 in 11 States to 70 in 10
States. SRE districts and the
most affected districts were
last revised in 2018.
The review of the Naxal-hit
districts was undertaken by the
Union Home Ministry in con-
sultation with the affected
States after which 23 districts
have been excluded from the
SRE scheme and two new dis-
tricts have been added amid an
improving security scenario
across the so-called Red Zone.
Additionally, one more dis-
trict has been added as it was
carved out of a district under
the SRE scheme.
Based on the criteria of
Maoist violent incidents, a sep-
arate category of “Most
Affected Districts” was created
in 2015 with 35 districts to
ensure focused deployment of
resources. Subsequently, fol-
lowing a review in 2018, the
number of districts was
brought down to 30.
A fresh review of these dis-
tricts was undertaken recently
in which nine districts were
dropped and four districts
added to determine 25 Most
Affected Districts.
Separately, a new category
of the “Districts of Concern”
has been added to counter
Naxal spread to new areas and
to stop resurgence in the areas
where the CPI (Maoist)-led
violence is waning. The move
has been taken to address
resource gaps and consolidate
gains in these areas.
The list of the 70 districts
to be covered under the SRE
scheme includes five districts in
Andhra Pradesh — East
Godavari, Srikakulam,
Visakhapatnam, Vizianagaram
and West Godavari — and 10
districts in Bihar —
Aurangabad, Banka, Gaya,
Jamui, Kaimur, Lakhisarai,
Munger, Nawada, Rohtas and
West Champaran.
In Chhattisgarh, 14 dis-
tricts will be covered under
SRE — Balrampur, Bastar,
Bijapur, Dantewada, Dhamtari,
Gariyaband, Kanker,
Kondagaon, Mahasamand,
Narayanpur, Rajnandgaon,
Sukma, Kabirdham and
Mungeli.
In Jharkhand, SRE will be
applicable in 16 districts which
is the highest number of dis-
tricts in any State and surpass-
es even Chhattisgarh which
used to be the worst affected.
BC055A4?AC4AQ =4F34;78
Amid controversy over the
interim report of the
Supreme Court-appointed
audit panel on Delhi’s inflated
oxygen demands during
Covid-19 second wave, AIIMS
Director Dr Randeep Guleria,
who led the panel, said on
Saturday that it was an interim
report and oxygen require-
ments are dynamic and change
from day-to-day. Trying to
play down the controversy,
Delhi Chief Minister Arvind
Kejriwal called for everyone to
work together to ensure there
is no shortage of oxygen in the
next Covid wave.
“The virus will win if there
is a fight among stakeholders”,
Kejriwal tweeted.
“May we work now if your
fight over oxygen is finished?
Let us together make a system
so no one faces shortage of oxy-
gen in the third wave,” Kejriwal
said in his tweet in Hindi.
“There was an acute short-
age of oxygen in the second
wave. It should not be so in the
third wave. Corona will win if
we fight with each other. The
nation will win if we fight
together,” he added.
Earlier, Guleria said, “It is
an interim report. The oxygen
needs are dynamic and change
from day to day. The matter is
subjudice.”
The sub-group constituted
by the Supreme Court to audit
oxygen consumption in hospi-
tals in the national Capital
during the second wave said
the Delhi Government “exag-
gerated” the consumption of
oxygen and made a claim of
1,140 MT, four times higher
than the formula for bed capac-
ity requirement of 289 MT.
?=BQ :0=?DA
Awoman entrepreneur died
when the car in which she
was being taken to hospital got
stuck in a traffic jam triggered
by police’s traffic control to pro-
vide a free way to President
Ram Nath Kovind.
The Kanpur Police has
apologised for the death of
Vandana Mishra, president of
Indian Industry Association,
Kanpur chapter.
On Saturday morning,
Police Commissioner Aseem
Arun apologised for the inci-
dent on Twitter and reached
the house of the deceased to
express condolences.
According to reports
Vandana Mishra was ill for the
past several days. On Friday
morning, her husband Sharad
Mishra took her to Regency
Hospital. She was given med-
ication and was allowed to go
home.
But in the evening her
condition further deteriorated
and her family members decid-
ed to take to the hospital again.
“While on the way to the
hospital, our car got stuck in a
traffic jam. We were told that
traffic is blocked because of
President’s arrival in Kanpur,”
Sharad Sharma said.
The relatives allege that the
police personnel were
informed about the patient’s
condiotion but they refused
help citing the arrival of the
President.
?=BQ =4F34;78
With Ram temple con-
struction set to be major
issue in the Uttar Pradesh
Assembly polls next year,
Prime Minister Narendra
Modi on Saturday reviewed
the “future vision” of
Ayodhya’s development in a
virtual meeting with UP Chief
Minister Yogi Adityanath.
The BJP has set the Ram
temple construction and the
“new development agenda” for
the Ayodhya City at the centre
of its poll strategy for UP
which may also have cross-
country appeal among mil-
lions.
The PM said, “Ayodhya
should manifest the finest of
our traditions and the best of
our developmental transfor-
mations.” Yogi presented a plan
for Ayodhya which included
modernisation, roads, express-
way way, railway station, inter-
national airport and several
other pending projects.
Around 500 acre has been
approved for the new Ayodhya
city. Speaking at the virtual
meeting, Modi described
Ayodhya as a city that is etched
in the cultural consciousness of
every Indian, Government
sources quoted him as saying.
Modi said Ayodhya is spir-
itual and sublime and that the
human ethos of the city must
be matched by futuristic infra-
structure, which is beneficial
for everyone, including tourists
and pilgrims, according to the
sources. The coming genera-
tions should feel the desire to
visit Ayodhya at least once in
their lifetime, Modi under-
stood to have said.
The PM said the way Lord
Ram had the ability to bring
people together, the develop-
ment works of Ayodhya should
be guided by a spirit of healthy
public participation, especial-
ly the youth.
He pointed that develop-
mental works in Ayodhya will
continue in the foreseeable
future.
The PM said, “It is our col-
lective endeavour to celebrate
the identity of Ayodhya and
keep its cultural vibrancy alive
through innovative ways.”
He called for skills of tal-
ented youth to be leveraged in
this development: Govt sources
from Ayodhya Development
plan meet.
C=A067D=0C70Q D108
Aday after his two resi-
dences in Mumbai, one
home in Nagpur and another
property, were raided by the
Enforcement Directorate (ED),
a Special PMLA court sent two
aides of Maharashtra’s former
Home Minister Anil
Deshmukh to the ED’s custody
till July 1 in connection with an
alleged money laundering case
registered against him.
Deshmukh’s personal sec-
retary Sanjeev Palande and
personal assistant Kundan
Shinde were arrested late on
Friday night.
Additional Sessions Judge
UJ More remanded Palande
and Shinde in ED’s custody for
seven days, after the agency
told the court that both of them
were not co-operating with
the investigators during the first
round of questioning that last-
ed for nine hours.
0?Q F0B78=6C=
Along-awaited US
Government report on
UFOs released on Friday
makes at least one thing clear:
The truth is still out there.
Investigators did not find
extraterrestrial links in review-
ing 144 sightings of aircraft or
other devices apparently flying
at mysterious speeds or trajec-
tories. But they drew few other
conclusions and instead high-
lighted the need for better data
collection about what’s increas-
ingly seen by Democrats and
Republicans as a national secu-
rity concern.
In all but one of the sight-
ings investigated, there was
too little information for inves-
tigators to even broadly char-
acterise the nature of the inci-
dent. There were 18 cases in
which witnesses saw “unusual”
patterns of movement or flight
characteristics, the report said,
adding that more analysis was
needed to determine if those
sightings represented “break-
through” technology.
Long the domain of
science fiction and so-
called ufologists, the
subject of UFOs has
in recent years drawn
serious study from the
Pentagon and intelligence
agencies.
The prospect of an adver-
sary spying with unknown
technology has alarmed law-
makers in both parties.
Congress last year required
the creation of the report deliv-
ered Friday. While its lack of
conclusions has already been
made public, the report still
represents a milestone in the
study of the issue.
US officials who briefed
reporters on condition of
anonymity said there were “no
clear indications” that the
sightings could be linked to
alien life.
There is also no
definitive linkage of
sightings to potential-
ly unknown technol-
ogy of an adversary like
Russia or China.
“It’s clear that we need to
improve our capacity to further
analyze remaining UAP obser-
vations, even as we accept that
there are some limits to our
capacity to characterize and
understand some of the obser-
vations that we have,” one offi-
cial said.
?`ceY:_UZRe`hRZeR
W`ce_ZXYeW`c^`_d``_
'HOKL3XQMDE
+DUDQDZHVW
835DMDVWKDQ
PDVHHUDLQV
DIWHU-XO
FPcTa[^VVX]VPccWT1WPaPc8]bcXcdcTÛ0Ta^]PcXRbPUcTaWTPehaPX]X]?Pc]P^]BPcdaSPh ?C8
1D[DOVORVHVZDLQGLVWV
4V_ecV]Z^ZedR_eZR`ZdeWf_UZ_Xe`(!UZded,FA`fe`WT`gVcRXV
Hyderabad: Fearing the spread
of coronavirus among Maoist
cadres, a Maoist-couple sur-
rendered before the police in
Bhadradri Kothagudem dis-
trict of Telangana on Saturday.
7VRcZ_X4`gZU
R`ZdeT`fa]V
dfccV_UVcd
'HOKL2 GHPDQGUHSRUW
LQWHULP $,,06'LUHFWRU
@ijXV_cVbfZcV^V_ed
Uj_R^ZTR_UTYR_XV
Wc`ÛRjeÙRjdRjd
RfUZeaR_V]TYZVW
Kolkata: Actor-turned-TMC
MP Mimi Chakraborty on
Saturday fell ill, a few days after
she was administered a fake
Covid vaccine, sources said.
However, the doctor who
attended to the Jadavpur MP
said it was too early to link her
illness with the fake jab that she
had taken four days ago, they
said.
5RjdRWeVceRZ_X
WRVgRiRTe`c
Z^ZWR]]dZ]]
AReZV_edfTTf^SdRdTRc
eRZ_XYVce`Y`daZeR]
defTZ_AcVk^`gV^V_e ?VieXV_VcReZ`_
dY`f]UWVV]UVdZcV
e`gZdZe2jÙYjR
Re]VRde`_TVZ_
]ZWVeZ^V+ ÙZ
0h^SWhPbW^d[SP]XUTbc
UX]TbcÛ^dacaPSXcX^]b)?
?aXTX]XbcTa=PaT]SaP^SXaTeXTfbcWT0h^SWhPSTeT[^_T]c_[P]cWa^dVW
eXST^R^]UTaT]RX]VX]=Tf3T[WX^]BPcdaSPh ?C8
3TbWdZWPXSTb
X]43 Rdbc^ShX]
WXb?;0RPbT
8)2VH[LVW86LQWHOOLJHQFHMXULVVWLOORXW
CWTXPVTUaêXST^_aêXSTSQhcWT3T_PacT]cÛ3TUT]bT[PQT[[TS6XQP[
Ua^! $P]d]Tg_[PX]TS^QYTRcXbbTT]PcRT]caTPbXcXbcaPRZTSPbXcb^PabWXVW
P[^]VcWTR[^dSbcaPeT[X]VPVPX]bccWTfX]S 0?
4`gZU*
:?:?5:2
CC0;20B4B) !!!!!
#(%
340C7B)($ !$!
A42E4A43) !(!#$$
$!
02C8E4)$' $!!
070)%!%'#(' !
:4A0;0)!'(( ! '
:Ć0:0)!' !%#!!
C=)!#%#$# $
34;78) #%$'$
?dQ[XbWTS5a^
34;78;D2:=F 17?0;
17D10=4BF0A A0=278
A08?DA270=3860A7
347A03D=7H34A0103
E890HF030
;PcT2Xch E^[ $8bbdT #
0XaBdaRWPaVT4gcaPXU0__[XRPQ[T
4bcPQ[XbWTS '%# 51,1R5HJQ877(1*5(*'1R8$'2''1
fffSPX[h_X^]TTaR^
DA@CE)
:8F8BA4CDA=74
F8C7822024
H@C=5'
74;82?C4A20AAH8=6
2;180B?A4I0CC02:43
@?6J(
=?;0C1435
DA10=2?10=:B)A18
347A03D=BD=30H9D=4!!! *?064B#'C
/CWT3PX[h?X^]TTa UPRTQ^^ZR^SPX[h_X^]TTa
7`]]`hfd`_+ X]bcPVaPR^SPX[h_X^]TTa

347A03D=kBD=30H k9D=4!!! UX[bce!
3ULQWHGDQGSXEOLVKHGE$MLW6LQKDIRUDQGRQEHKDOIRI0.3ULQWHFK/WGSXEOLVKHGDW8QLJDWH*HQHUDO0HGLD3YW/WG2OG1HKUXRORQ2SS8WWDUDNKDQG-DO6DQVWKDQ'KDUDPSXU'HKUDGXQ3K0RE DQGSULQWHGDW$PDU8MDOD3XEOLFDWLRQV/WG6KHG1R 3DWHO1DJDUR2SHUDWLYH,QGXVWULDO$UHD
'HKUDGXQ8WWDUDNKDQG(GLWRUKDQGDQ0LWUD$,5685+$5*(RI5H(DVWDOFXWWD5DQFKL%KXEDQHVZDU1RUWK/HK:HVW0XPEDL $KPHGDEDG6RXWK%DQJDORUH KHQQDLHQWUDO.KDMXUDKR'HOKL2IILFH1R%HKLQG*XODE%KDZDQ %DKDGXU6KDK=DIDU0DUJ1HZ'HOKL 3KRQHRPPXQLFDWLRQ2IILFH)6HFWRU
12,'$*DXWDP%XGK1DJDU83
3KRQH /XFNQRZ2IILFHWK)ORRU6DKDUD6KRSSLQJHQWUH)DL]DEDG5RDG/XFNQRZ7HOHSKRQHV
$OWKRXJKHYHUSRVVLEOHFDUHDQGFDXWLRQKDVEHHQWDNHQWRDYRLGHUURUVRURPLVVLRQVWKLVSXEOLFDWLRQLVEHLQJVROGRQWKHFRQGLWLRQDQGXQGHUVWDQGLQJWKDWLQIRUPDWLRQJLYHQLQWKLVSXEOLFDWLRQLVPHUHOIRUUHIHUHQFHDQGPXVWQRWEHWDNHQDVKDYLQJDXWKRULWRIRUELQGLQJLQDQZDRQWKHZULWHUVHGLWRUVSXEOLVKHUVDQGSULQWHUVDQGVHOOHUVZKRGRQRWRZHDQUHVSRQVLELOLWIRUDQ
GDPDJHRUORVVWRDQSHUVRQDSXUFKDVHURIWKLVSXEOLFDWLRQRUQRWIRUWKHUHVXOWRIDQDFWLRQWDNHQRQWKHEDVLVRIWKLVZRUN$OOGLVSXWHVDUHVXEMHFWWRWKHH[FOXVLYHMXULVGLFWLRQRIFRPSHWHQWFRXUWDQGIRUXPVLQ'HOKL1HZ'HOKLRQO5HDGHUVDUHDGYLVHGDQGUHTXHVWHGWRYHULIDQGVHHNDSSURSULDWHDGYLFHWRVDWLVIWKHPVHOYHVDERXWWKHYHUDFLWRIDQNLQGRIDGYHUWLVHPHQWEHIRUH
UHVSRQGLQJWRDQFRQWHQWVSXEOLVKHGLQWKLVQHZVSDSHU7KHSULQWHUSXEOLVKHUHGLWRUDQGDQHPSORHHRIWKH3LRQHHU*URXS
VZLOOQRWEHKHOGUHVSRQVLEOHIRUDQNLQGRIFODLPPDGHEWKHDGYHUWLVHUVRIWKHSURGXFWV VHUYLFHVDQGVKDOOQRWEHPDGHUHVSRQVLEOHIRUDQNLQGRIORVVFRQVHTXHQFHVDQGIXUWKHUSURGXFWUHODWHGGDPDJHVRQVXFKDGYHUWLVHPHQWV
µ,KDGWRGRDORWRI
KRPHZRUNIRUWKHUROH¶
DB1070B78b_TPZbfXcWB0D30=BDA8fW^_[Phb1P[PAPX]CE³b
4ZPWP]PhPZ3a1A0QTSZPaPQ^dcWXba^[TW^fPRcX]VWP__T]TSc^WXPcPh^d]V
PVTP]STg_TaXT]RTÛQTX]VP_PacÛêXTb[XZT0iWPa0[XUP]S6^[PP[0VPX]
QWhat is your role in Ek
Mahanayak Dr B.R.
Ambedkar?
I play Bala Ram, the elder
brother of Dr BR Ambedkar.
He is a loving character, but
has his ways of expressing it.
He is overreactive at times. He
believes in himself and his
thoughts. He loves his brother
and his family. He is a playful
character.
QWhat made you come on
board the show?
The name of the show.
The script, the director and, of
course, my role. I knew, I will
get to learn a lot from this
show.
QWhat all did you get to
learn through the show?
The initial episodes were
shot in Gorakhpur, there we
learnt how homework is done,
which basically means how
you prepare for a role. It is not
always about reading the
script and dialogues. One has
to learn the character and
nature of what he is playing.
That is what I did. I read a lot
about my character. Not that
my director didn’t help, but
there are somethings that you
learn on your own. I have
been into the industry for
many years now, but it was not
until this show that I learnt the
importance of homework.
Also, it is not only the actors
who have to do their
homework, it is the need of
several other departments too
that are involved in the
project.
The other thing was the
language. I am able to learn
shudh Hindi. Earlier, I wasn’t
that confident about speaking
pure Hindi, but now I am. The
language that we speak here in
the show is a mixture of shudh
Hindi, Sanskrit, Parsi and a bit
of Urdu too.
QWhat homework were you
required to do?
Our director used to give
us a script and ask us in how
many different ways can we
enact the scene and what all
variations can be made.
QYou started acting at 5.
How did that happen?
Initially, I was into
dancing. Someone suggested
my mother that I should try
modeling as well. Luckily, it
worked and I did a few
garment shoots. Then, another
well wisher of mine suggested
that I should get enrolled in an
acting class as it will help me
boost my confidence. I did
that and developed a passion
for it. Then, through a co-
ordinatior in Ahmedabad,
where I lived during my
childhood, I was able to pull
out a few contacts from the
industry. I sent my audition
clips to them. This is how I
was able to make it into the
industry. It seems acting was
in my destiny.
QDid your parents ever feel
that acting was not the way
forward?
Never. The reason I am
here today is because of their
unconditional support and
love. They wanted me to
pursue whatever I like. They
knew it way before than I did,
that acting was my calling,
after all who knows a child
better than his parents.
QYou have been a part of
movies like Alif, Golmaal
Again and Azhar. How was
the experience?
I was new to movies. I
started with Azhar and was
amazed to work with
Kulbhushan Kharbanda sir.
There, I learnt the basics of
shooting and the equipments
used. It was so fascinating, and
it is even today. It was my first
time in Ramoji Film Studion.
In Alif, it was more about
acting and learning how
calmly we can shoot. Zaigham
Imam sir (director) is too
cool to shoot with. During the
shoot, in between my breaks
I used to fly kites or do
whatever I wanted to, then
somebody used to call me to
inform that my shot was
ready. It was such a pleasant
environment. He taught me
how to stay natural while
acting. It was that movie from
which I got to know the
impact of good storytelling.
The next was Golmal
Again. It was a different world.
There, I learnt about the
technicalities and got to delve
deep into the craft.
QWhat next?
There are a couple of
things in the pipeline, but I
can’t talk about it right now.
A]R_J`fcDf_URj
=
^cWX]VXbQTccTacWP]b_T]SX]Vh^da
fTTZT]SbfXcWh^daUPX[hâUaXT]SbP]S
R^^ZX]VPTP[âcfÛâcWT
4b_TRXP[[hXUXc³bPbcPhPcW^TfTTZT]SUâ
h^dSdTc^cWT_P]STXR
B^XUcWTaT³bb^TcWX]Vh^dfP]cc^R^^Z
Uâh^da[êTS^]TbfTWPeTV^ch^dabâcTS
B8?;402=2744B4
8]VaTSXT]c @dP]cXch
1dccTa cQb_
[XeT^X[ cQb_
6Pa[XRR[êTb !RW^__TS
1aTPSRadQb Rd_
8C2PbcTa2WTU2PbWTf
]X^]6aPeh _PRZTc
PRa^]X Rd_
dbcPaSbPdRT cQb_
CdaTaXR_^fSTa cb_
?P_aXZP2WX[[X_^fSTa cb_
;T^]YdXRT cQb_
BP[c0baT`dXaTS
?T__Ta 0baT`dXaTS
2WTTbT_PaTbP]RWTSSPaTcR
_cX^]P[
4C73)
?aT_PaTcWT_PbcPPRRâSX]Vc^_PRZPVT
SXaTRcX^]b
! 8]P_P]Saha^PbcQaTPSRadQBP]SZTT_
PbXST
1[T]S8C2PbcTa2WTU2PbWTf]X^]
6aPeh[T^]YdXRTfPcTabP[cRWX[[X
_^fSTaVPa[XRcdaTaXRP]SdbcPaSd]cX[
XcXbbX[Zhb^^cW
# ]RTcWTPRPa^]XXbcT]STaSaPX]P]S
aX]bTXc
$ 0SS cQb_QdccTaP]S cQb_^[XeT^X[c^P]
êT]bPUT_P]êTaTSXdWTPcPSS
RW^__TSVPa[XRP]SbPdc|CaP]bUTabPdRTc^
cWT_P]
% 0SSPRPa^]XP]SbcXac^R^QX]Td]cX[P[[
cWTPRPa^]XXbR^PcTSfXcWbPdRT
XgQaTPSRadQbbP[cP]S_T__Tac^cPbcT
X]PbP[[Q^f[B_aX]Z[TêTacWTc^_ÛcWT
PRP]SRWTTbTRêTaX]VXcR^_[TcT[h
' 1PZTUâ $X]dcTb/ '2d]cX[PRP]S
RWTTbTXbbTccWT]Qa^X[UâPUTfX]dcTb
d]cX[c^_XbV^[ST]Qa^f]
( ATêTUa^êT]P]SP[[^fc^R^^[
b[XVWc[hBTaeTP]ST]Y^h
¯2WTU0ZP]ZbWP:WPcaX8C2PbcTa2WTU
8=6A4384=CB
C^R^^Z?PbcP)
8]VaTSXT]c @dP]cXch
FPcTa 0baT`dXaTS
6aTT]RWX[XTb !
1PbX[[TPeTb_cX^]P[ #$
8C2PbcTa2WTU2PbWTf]X^]6aPeh
_PRZTc
C^_aT_PaTcWTQaTPSRadQbXgcdaT)
8]VaTSXT]c @dP]cXch
1aTPSRadQb Rd_
6Pa[XR_^fSTa cQb_
XgTSSahWTaQb cQb_
ATS_T__TaU[PZTb cQb_
2WTTbT_^fSTa_cX^]P[ Rd_
CÛah_PbcP)
8]VaTSXT]c @dP]cXch
X[Z Rd_a^^cT_TaPcdaT
X[ 5âUahX]V
4C73
?aT_PaTcWT_PbcPPRRâSX]Vc^_PRZPVT
SXaTRcX^]b
! FWX[TcWT_PbcPXbR^^ZX]VQ[T]S8C2PbcTa
2WTU2PbWTf]X^]6aPeh_P]TTaVaTT]
RWX[XTbP]SQPbX[c^Pb^^cW_PbcTPZTP
_X_TPQ[TR^]bXbcT]Rh
CaP]bUTacWTPQêTXgcdaTc^cWT_X_X]VQPV
P]SZTT_PbXST
# ]RT_PbcPXbP[ST]cTSaPX]P]SaX]bTXc
$ 5X[[cWT_PbcPfXcW_P]TTaRPbWTfXgP]S
UaTTiT
% XgQaTPSRadQbVPa[XR_^fSTa^]X^]
_^fSTaXgTSSahWTaQbRWX[XU[PZTbP]S
RWTTbTUâQaTPSRadQbXgcdaT
0SSX[Zc^PQ^f[
' 3X_TPRW_PbcPX]X[ZP]ScWT]a^[[XcX]
_aT_PaTSQaTPSRadQbXgcdaT
( 5ahTeT][h^]Q^cWbXSTbcX[[cWThcda]V^[ST]
CWThPaTQTbcT]Y^hTSfWT]bTaeTSW^cfXcW
b^Tb_XRhPh^BaXaPRWPXgTSfXcW
PhâTVd[Pac^Pc^ZTcRWd_âPaX]PaP
bPdRT^]cWTbXST
¯2WTU0ZP]ZbWP:WPcaX8C2PbcTa2WTU
VVeeYVSfSS]j
R_UTYRc^Z_X9f_Rc
Y
ou will be playing a solo
lead in your next show.
Mark my words and
remember today’s date.’
This was what Ragini
KhannatoldHunarHalionthesets
of Sasural Genda Phool. Khanna’s
words came true and Hali landed
her first solo lead show, Chhal -
Sheh Aur Maat, right after doing
Sasural...
“Ragini and Arti Singh are
two people whom I adore the
most and will continue to do it.
They have helped me grow and
taught me something or the other over
the years,” Hali, who played Meeta in
SET’s popular show Patiala Babes, says.
She adds that it was on the sets of
Grihastithatshelearnthowonehastofeel
the scenes and the emotions of the
character. “I remember Arti used to pull
off all the emotional scenes without a
drop of glycerine. Whereas me, on the
other hand, required tons of glycerine.
It was then when I asked her how she
does it that well. She replied: ‘You just
have to feel the scene’. I have tried to
imbibe that quality in me and now I do
mostofsuchscenesnaturally,”Hali,who
has recently recovered from COVID,
tells you.
Hali’s COVID journey was one of
arollercoasterride,butitwasonlyafter
recovery that she realised that post-
COVID care is a must.
“Once I recovered, I thought it’s
over and started binging on pizzas,
pastries, cakes and what not. That is
when the problem began. I started
facing stomach issues and my doctor
told me that it was all because of the
diet that I had taken. It was bad, but
thankfully I realised it on time and
started taking proper precautions. I am
doing good now, but will continue to take
extra precautions for some more time,”
Hali tells you.
Hali has always been on a lookout for
roles that she can relate to, this has been
her priority for picking up projects.
“Whenever I am offered a role, I want
to know what the story is and how my
characterwillcontributetothestory.Ipick
and choose roles that I can relate to. I can’t
play a character that I don’t resonate with.
It has to click with me and if does I don’t
care if it’s a cameo, a supporting role or a
lead. It is as simple as that. And this is one
of the reasons why I don’t play bold
characters,” she says.
Haliaddsthatofflate,allthewebseries
thatwereofferedtoher,exceptforacouple,
had bold scenes in it. “I can’t kiss a boy
whomIdon’tlove.Ihavetobeemotionally
attached to a person in order to do bold
or intimate scenes with him. How can I
do such scenes with a boy whom I have
no connection with. Hence, I always turn
down such roles. Had these scenes been
with my husband as the hero, I would be
ever ready to do it,” Hali says.
As to if people questioned her choices
of rejecting even good web series because
of the bold scenes, she says, she is not the
kind of person who gets affected by such
people. “There were people who raised
questions, but I didn’t care about it. I stand
by my decisions and, after all, it is my life
and my choices. Now that people know
me, there aren’t many people out there
who question my choices, and even if
some do, I am not at all affected by it and
why should I?,” asks Hunar.
While, Hunar definitely believes in
keeping to herself and her work, there are
a few things that does makes her feel
uncomfortable on the sets. First of all is
lack discipline. “Lack of discipline on the
sets definitely makes me feel
uncomfortable. The second is when I am
in between a shot, I am no more Hunar,
I am the character and the same goes for
the person I am shooting with. So, if a
person starts shouting during the shot or
does anything that is not related to that
particular scene, it disturbs me. This way,
Iamunabletoconcentrateonmyshotand
performance,” she tells you.
The other thing, she says, is that some
actors today don’t value things. “I have
been fortunate enough to have worked
with strict directors. So much so that even
if I had done a re-take, they used to shout
and scold that why can’t we pull it off in
a single take. We were scared of them. But,
now directors are no more that strict and
some actors take advantage of this. They
don’t value their work. And I just see them
and think, how would they have survived
had they worked with the strict directors
back then,” Hunar opines.
+81$5+$/,ZKRZDVVHHQLQVKRZVOLNH3DWLDOD%DEHV
3DUDPDYDWDU6KUL.ULVKQDKKDO6KHK$XU0DDWWHOOV
086%$+$6+0,DERXWKHUSRVW29,'H[SHULHQFH
NLQGVRIUROHVWKDWGRQ¶WDSSHDOWRKHUDQGWKLQJVWKDWPDNH
KHUXQFRPIRUWDEOHRQWKHVHWV
TELLYTALE
?aXcWeXaPYBdZdPaP]XbPfT[[Z]^f]
P[PhP[PPRcâP]SSXaTRcâfW^WPb
R[XQTScWTbcPXabÛbdRRTbbP]SbcPaS^
fXcWWXb`dX]cTbbT]cXP[a^[TbP]Sd]X`dT
PRcX]VcP[T]c7TXbUP^dbUâcaPeT[[X]VcWT
a^PS[TbbcPZT]P]SWPbST[XeTaTSPbTaXTbÛ
_^fTa_PRZTSQ[^RZQdbcTabêTa!hTPabX]
cWTP[PhP[PUX[X]Sdbcah
FXcWWXbTgRT_cX^]P[[h_WT]^T]P[
PRcX]VX]ePaX^dbUX[bP]SQ[^fX]V^da
X]SbX]RTbbP]c[h?aXcWeXaPYb]TgcUX[P]
0Pi^]?aXTEXST^³bâXVX]P[¯2^[S
2PbT0[^]VfXcWcWTbd_TabcPacWTUX[
bcPab0SXcX1P[P]P]SBdRWXcaP?X[[PXfWXRW
XbP[[cWTâTaTPb^]fWhcWTP]cXRX_PcX^]
P]STgRXcTT]cP^]VbcUP]bUâcWTCP]d
1P[PZSXaTRcTSUX[XbPcXcbeTah_TPZ0[[bTc
câT[TPbT^]9d]T!! TgR[dbXeT[h^]
0Pi^]?aXTEXST^cWTêXTP[b^bTTb
?aXcWeXaPYPZTWXbSTQdc^]PSXVXcP[
_[PcUâ
5a^_[PhX]VPR^_[Tga^[TÛP
W^^bTgdP[R^_c^TbbPhX]VP_[TcWâPÛ
SXUUTaT]cRWPaPRcTabP[^]VfXcWSXaTRcX]VP
Q[^RZQdbcTaUX[[XZT;dRXUTacWTbcPab_TPZb
PQ^dcWXbP]hSXbcX]RcXeTa^[TbP]SPZX]V
WXb^f]fPhX]cWTP[PhP[PUX[X]Sdbcah
7TbPhb°8P[^bcUX]SXc^Q[XVPcâhcWPc
fWT]P]^__âcd]XchR^TbhfPh8dbT
hb^RP[[TS°bcPaS^±cÛPRX[XcPcTR^]cT]c
cWPcXb^dcÛcWTQ^g5âV^^SRX]TP8RP]
S^P]hcWX]V±
7PeX]VfâZTSX]cWTP[PhP[PUX[
X]SdbcahUâcf^STRPSTb?aXcWeXaPY
BdZdPaP]bWPaTSP]X]cTaTbcX]VX]bXVWc
PQ^dcWXbRPaTTa°CWT[PbcêXTcWPcfPb
bW^c^]²UX[X]cWTP[PhP[PUX[
X]SdbcahfPbX]TP]ScWTUXabcUX[bW^c
^]SXVXcP[fPbP[b^X]T8Pb^V[PScWPc
8[XeTScWa^dVWcWPc_WPbTP]SXc³beTah
TgRXcX]Vc^T±
ATTQTaX]VcWTfâZWTSXSP]S
cPZX]VP[^^ZQPRZPcWXbY^da]ThWTUdacWTa
PSSb)°CWTaTXb^][h^]TfâScWPc
STbRaXQTbfWPc8UTT[P]ScWPcXbVaPcXUhX]V8
WPeTQTT]aTP[[h[dRZhc^VTc^__âcd]XcXTb
c^fâZfXcWb^TÛcWTUX]TbcSXaTRcâb
P]SfaXcTabX]cWTP[PhP[PUX[X]Sdbcah8
WPeTQTT]P_PacÛcWTfWXcT_P]cbP]S
fWXcTbW^TbP]SSP]RX]VcXTÛP[PhP[P
RX]TPP]S8PaTP[[h_a^dSÛXc8U^d]S
bdRRTbbPbP]PRcâP]ScWT]8PWTaT
c^SPhfâZX]VfXcW]TfPVTUX[SXaTRcâb
P]ScahX]V^dcP]TfR^]RT_cP]SXc³bc^cP[[h
PPiX]V±
]cP[ZX]VPQ^dcWXbbcaPcTVhPbP]PRcâ
P]SSXaTRcâP]SRW^^bX]Va^[TbcWPcPaT
d]_aTSXRcPQ[TBdZdPaP]T]cX^]TS)°8
WPeTcaXTScWPchXPVTPbP]PRcââ
SXaTRcâS^Tb]³caTPX]R^]bXbcT]c8f^d[S
[XZTc^QT[XTeTcWPcS^X]VUX[b[XZTdQPX
?^[XRT fX[[RaTPcTPbT]bTÛd]_aTSXRcPQX[Xch
PQ^dcT8Uh^dV^P]SPbZUa^_T^_[T
fWPcXb?aXcWeXaPYV^X]Vc^S^]Tgch^dfX[[
VTcSXUUTaT]caTb_^]bTbUa^SXUUTaT]c_T^_[T
P]S8[XZTcWPc±
2;32
20B4
5?
?A8C7E8A09
64CB4C5A2;84= ?8HDB7A48=3B67085BA:
CWXbfTTZT]ST]cTacPX]T]c
W^VP Ud[[^]P]ScT]bX^]fX[[
QTP[[V^]TPb_XRcdaTbQaX]Vb
c^h^dabRaTT]bPR^_[TcT
S^bTÛ[PdVWcTaP]SUd]fXcW
Xcb_aTXTaTÛ2^^[XT=^
c^SPhPc !]^^]3XaTRcTSQh
cWTâXVX]P[PbcTaÛR^TSh
3PeXS3WPfP]cWXbd[cXPcT
[PdVWaX^cUTPcdaTbT]TaVTcXR
EPad]3WPfP]VâVT^dbBPaP
0[X:WP]P]SR^TShZTZX]Vb
¯?PaTbWAPfP[9PPeTS
9PPUTaXAPY_P[HPSPeP]S
9^W]]h;TeTa0[^]VfXcWXcb
T]VPVX]V]PaaPcXeT
bWT]P]XVP]bP]SR^XRcXX]V
cWTUX[³bdbXRV^cTeTahQ^Sh
Va^êX]VP]SQTRPTX]bcP]c
Ra^fS_d[[Tab[XZTXaRWX;PVX
C^W7db]]7PXBdWP]Pâ
CTaX1WPQWX
CP[ZX]VPQ^dccWTUX[
EPad]3WPfP]bPXS)°CWTY^hÛ
bXccX]VX]Ua^]cÛcWTCEfXcW
h^daUPX[hP]SUaXT]Sb
fPcRWX]VV^^SUX[bP]S
d]RWX]V^]V^^SU^^SXbcWT
d[cXPcTUd]UX[[TSTg_TaXT]RT
CWTaTXb]^cWX]VâT
bPcXbUhX]VcWP]QTX]VP_PacÛ
cWTêXTcWPcRPcTabc^bdRW
^T]cb8cWPbP[b^QTT]
VaTPcUd]fâZX]VP[^]VbXST
bdRWQaX[[XP]cP]STg_TaXT]RTS
PRcâb4PRWÛcWTXbP]
X]bcXcdcX^]X]cWTbT[eTbcWTaT
Xbb^dRWc^[TPa]Ua^cWT
8PbdaTcWTeXTfTabf^d[S
WPeTPbdRWUd]fPcRWX]VcWT
êXTPbfTWPSfWX[TPZX]V
Xc1TbPUTPcW^TP]SQTP
_PacÛcWTUd[[^]T]cTacPX]T]c
fXcW_XRcdaTb_aTXTaTbÛ
2^^[XT=^ ±
CWTUX[aTe^[eTbPa^d]S
cWTWX[PaX^dba^[[TaR^PbcTaaXST
Û2^^[XTAPYdfW^
X_Tab^]PcTbPaXRW_aX]RTc^
VTccWT[êTÛWXb[XUTBPaPW
QdcTeTahcWX]VV^TbUâPc^bb
fWT]WXbaTP[XST]cXchXb
Tg_^bTS
CWdbbcPacbPUd[[^]
R^TShÛTaaâb2^^[XT=^
XbPc^cP[UPX[hT]cTacPX]TacWPc
fX[[ZTT_h^d^]cWTTSVTÛ
h^dabTPcbfXcWXcbUd[[^]
R^XRcXX]V
CWXbfTTZT]S2^[âb³3P]RT
3TTfP]TfX[[QTRT[TQaPcX]V
cWTV[âX^dbfâZÛcWTeTcTaP]
SXaTRcâP]SUX[VdadBdQWPbW
6WPXfW^WPbQTT]X]bcadT]cP[
X]VTccX]V^dahTbcTahTPaWTa^Tb
câ^P]RTP]SVPeTdbb^TÛ
cWTQTbcêXTbX]cWT'bP]S
(bCWTT_Xb^STfX[[QTUX[[TS
fXcWX]cTaTbcX]VbcâXTbPb 3P]RT
3TTfP]TYdSVTPSWdaX3XgXc
fX[[QTbTT]]PaaPcX]Vb^T
Tg_TaXT]RTbÛfâZX]VfXcWcWT
[TVT]SPahUX[PZTa
3daX]VcWTT_Xb^STAPVWPe
fX[[bW^fRPbTb^Td]bTT]
U^^cPVTÛcWTXR^]XR]dQTa
2W^[X:T?TTRWT:hP7PXUa^
:WP[]PhPZ [TPeX]VQ^cWPSWdaX
P]SBdQWPbW6WPX]^bcP[VXR
CWTT_Xb^STfX[[P[b^bTT
b^TcPSPZcTQWPSPZcTSP]RT
_TaUâP]RTb^]b^]VbUa^cWT
XR^]XRêXTbÛBdQWPbW6WPX
fWXRWfX[[bda_aXbTWX]T
bdRW_TaUâP]RTfX[[QTQhcWT
bTR^]SVT]TaPcX^]R^]cTbcP]c
?XhdbW6daQT[TfW^WPbP
R^_[TcT[hSXUUTaT]ccPZT^]IPaP
CPbeTTaBTUa^BdQWPbW6WPX³b
UX[?PaSTb CWTPRcfX[[QT
QPbTS^]P_bhRW^ZX[[TaP]S
_^bbTbbXeT[êTacWPcfX[[
X_aTbbBdQWPbW6WPXb^dRW
cWPcWTfX[[bW^fTaWXfXcW
_aPXbTb
FWX[T_aPXbX]V?XhdbW
BdQWPbW6WPXbPhb)°8S^]c
WPeTfâSbc^Tg_aTbbh
UTT[X]VbPUcTabTTX]VcWXbPRcH^d
fTaTPe^[RP]^ÛT^cX^]bP]S
8PeTahX_aTbbTSfXcWh^da
PRc8f^d[S[XZTc^WdVP]SVXeT
h^dhSXaTRcâbWPcH^da
_TaUâP]RTaTX]STSTÛ
BWPWAdZW:WP]PbTeT]WTXb
TgcaTT[h_PbbX^]PcT8
aTTQTaSdaX]VcWTbW^^cX]V
ÛcWTb^]VBWPWAdZW:WP]
WPScÛP[[^]cWTU[^âeTahWPaS
P]SWTSXS#!cPZTbfXcW^dc
R^_[PX]X]V8f^d[SP[b^ÛUTa
h^dPbRW^[PabWX_X]hUX[
bRW^^[Uâh^daUdacWTaTSdRPcX^]
Pb8RP]bTTh^dPaTTgcaTT[h
cP[T]cTS±
820=C:8BB01H
F783=C;E4
870E4C14
4C8=0;;H
0CC02743C0
?4AB=8=A34A
C31;3A
8=C80C4B24=4B
F8C77874=248
0;F0HBCDA=
3F=BD27A;4B
2A8B?H5A843?0BC0

dccPaPZWP]S
347A03D=kBD=30H k9D=4!!!
Pushpa Dhami
For many who complain we
do not have time for self-
reflection, Covid-19 in hind-
sight has offered that hard to
find time for exercising our cre-
ativity and dig down the mud
of our pressing schedules and
claim the unique gift we forgot
we were born with. Yes, we are
all born with a gift that will help
us live our life with utmost joy
and satisfaction. This gift is our
passion and it is unique for
each one of us yet often we fail
to recognise its uniqueness
and bury it inside the mud of
every day’s engagements that
comes with the unfiltered
external conditioning of the
fast-paced world.
The external conditioning
compels us to tightly schedule
our days and get consumed in
the work to the point that we
fail to realise we have a gift that
needs to be unpacked for a bet-
ter world. Every day we also get
bombarded with a lot of dis-
tractions, negativity, pretense
and unwarranted addictions
that try to steal our conscious-
ness and push our inherent gift
even deeper into the mud of
non-existence.
Our consciousness in soli-
tude, therefore, acts as a shov-
el that digs out these layers of
mud and allows our suffocat-
ing passion to breathe in the life
it deserves. It helps us to rede-
fine our attitude which know-
ingly or unknowingly has been
maligned by our
u n f i l t e r e d
thoughts. Buddha
said, “Our attitude
in life is shaped by
our thoughts: we
become what we
think. When the
mind is pure, joy
follows like a
shadow that never
leaves.” Where
other than in soli-
tude could our
mind be so pure?
We human beings
are 70 per cent
water and it is the
tendency of water
is to take the
shape of anything
it comes in con-
tact with and this
is the reason, it
has been echoing
in eternity that we
should choose our
sur roundings
wisely because
with two-third of our compo-
sition as water, we can easily
take up the attitude and behav-
ior of people we come in con-
tact with. In solitude, we expe-
rience a direct connection with
the higher source of creation.
When connected deeply, we
can easily redefine the attitude
that is not serving us and oth-
ers in any way.
Remember, the gift of pas-
sion we are all born with often
gets unpacked by challenging
circumstances of life that direct
us in solitude for self-reflec-
tion. So, whenever we face
challenges in life, which we
inevitably will, which the entire
humanity is now facing in the
form of Covid, remember it is
there to unpack our gift, our
passion, and once we claim it,
this gift will bring utmost sat-
isfaction to us and this state
of mind will bring joy all
around us.
Aristotle said, “Whoever
is delighted in solitude is
either a wild beast or god.” So,
use this Covid imposed soli-
tude to translate what has
been dormant into some-
thing dominant that can
change your whole perspec-
tive about life and leave you
with a redefined attitude to
find blessings in disguise in
everything you encounter
with.
(The author is a spiritual
seeker who is a PhD research
scholar in food nutrition,
climate change disaster
management)
?=BQ 347A03D=
Amid decrease in the inten-
sity of the second wave of
contagion of Covid-19, the
state health department has
sounded a caution about the
delta plus variant of the virus
in Uttarakhand. The delta plus
variant has been dubbed as a
new variant of concern by the
health experts. Though no case
of the new variant has been
reported yet in the state, the
director general (DG) of state
health services, Dr Tripti
Bahuguna has issued an advi-
sory to all the chief medical
officers (CMOs) about the new
variant. In the letter the DG has
asked the CMOs to make nec-
essary preparation for preven-
tion and control of the delta
plus variant of the Covid-19.
The DG said that the virus of
Covid-19 is constantly chang-
ing its structure and the delta
plus variant of the virus has
been found in many states. She
said that the new variant is
characterised by increased
transmissibility, stronger bind-
ing to the receptors of the
lung cells and potential reduc-
tion in the monoclonal anti-
body response.
The DG in her letter has
emphasised that all the activi-
ties and practices of prevention
of Covid-19 should continue.
She said that patients with
Covid-19 symptoms should be
identified in time and the sur-
veillance system should be
strengthened.
The DG said that the sys-
tem of testing of the virus
should be strengthened and the
necessary facilities for treat-
ment of Covid-19 patients in
Covid hospitals ( DCH,
DCHC, DCCC) should be
ensured. She directed that the
awareness campaigns on adop-
tion of Covid-19 appropriate
behaviour by the general pub-
lic should be undertaken by the
department.
It is worth mentioning here
that the delta plus variant of
Covid 19 has been dubbed as
a new variant of concern by the
health experts. A total of 51
cases in 12 states of the coun-
try have so far been detected.
?=BQ 347A03D=
An e -symposium was
organised by the
Government Doon Medical
College (GDMC) here on the
occasion of the international
day against drug abuse and
illicit trafficking on Saturday.
Speaking on the occasion, the
Principal of GDMC, Dr
Ashutosh Sayana said that the
future of the youth is getting
doomed due to substance
abuse. He said that the college
has launched a helpline num-
ber 1800110031 for any type of
assistance and counselling
regarding drug abuse.
The head of department
(HoD) of Psychiatry, Dr J S
Rana informed about the drug
abuse, their effect and preven-
tive measures on the occasion.
He said that this evil of the soci-
ety can be cured by public
awareness campaigns only.
In his address the head of
department (HoD) of com-
munity medicine, Dr Devvrat
Rai threw light on the history
of the drugs, the causes of their
abuse and ill effects on health.
He also spoke about the reha-
bilitation of the younger gen-
eration caught in the trap of
drug abuse.
The programme was
attended by the faculty mem-
bers, senior residents, junior
residents, interns and students
of MBBS of the college. The
programme was coordinated
by Assistant Professor com-
munity medicine, Dr
Madhulika Sisodia.
?=BQ 347A03D=
The health department of
Uttarakhand reported 164
new cases of the novel
Coronavirus (Covid -19) and
two deaths from the disease in
the state on Saturday. The
authorities also reported 272
recoveries from the disease on
the day. The cumulative count
of patients in the state has now
increased to 3,39,537 while
the death toll from the disease
increased to 7086.
A total of 3,24,127 patients
have recovered from the dis-
ease in the state. The recovery
percentage from the disease is
now at 95.46 and the sample
positivity rate is at 6.24 percent
in the state.
Death of one patient each
was reported from Military
Hospital (MH) Roorkee,
Haridwar and HNB base hos-
pital Pauri Garhwal on the
day. The department also
reported one death on Saturday
which had occurred in the
past but was not reported ear-
lier.
Dehradun district report-
ed 41, Pithoragarh 40,
Haridwar 21, Nainital 17,
Almora and Rudraprayag seven
each, Tehri six, Udham Singh
Nagar and Chamoli five each,
Bageshwar, Champawat and
Pauri four each and Uttarkashi
three new cases of the disease
on the day.
The state now has 2,510
active patients of the disease.
Dehradun district is at top of
the table in the list of active
cases with 708 cases while
Haridwar is in the second posi-
tion with 299 active cases.
Pithoragarh has 294,
Bageshwar 196, Pauri 168,
Nainital 160, Almora 147,
Rudraprayag 113, Chamoli 101,
Champawat 95, Tehri 93,
Udham Singh Nagar 86 and
Uttarkashi 50 active cases of the
disease.
The state reported three
new cases of Mucormycosis
(Black fungus) on Saturday
after which it now has 486
patients of the disease. A total
of 90 patients have so far died
from this disease while 76 have
recovered.
In the vaccination drive
70,006 people were vaccinated
in 745 sessions held on the day.
A total of 7,67,749 people have
been fully vaccinated while
34,21,627 people have been
partially vaccinated in the state.
F¶YR_Ud`f_UdR]Vce`_
5V]eRa]fdgRcZR_e`W4`gZU
CWT7TP[cW36
XbbdTbPSeXbâhc^
2bPbZX]VcWT
câTPX]_aT_PaTS
UâcWT]TfePaXP]c
RYLGQHZ
FDVHVWZRGHDWKV
UHSRUWHGLQ8¶NKDQG
DbTb^[XcdSTcâTSTUX]TPccXcdST
8´]P[SPhPVPX]bcSadVPQdbT*
632âVP]XbTbbh_^bXd
?=BQ 347A03D=
As part of efforts to better
deal with the Covid-19
situation, chief minister Tirath
Singh Rawat virtually inaugu-
rated oxygen generation plants
in five hospitals in different
parts of the state on Saturday.
The oxygen plants inaugurat-
ed by the CM include a 250
LPM plant at Bageshwar dis-
trict hospital, 100 LPM plant at
Champawat district hospital,
200 LPM plant at Pithoragarh
district hospital and 1,000 LPM
capacity plants each in
Himalayan Hospital, Jolly
Grant and Coronation Hospital
in Dehradun.
These five plants will gen-
erate a total of 4.76 metric
tonnes of oxygen per day.
Rawat thanked Azim Premji for
the 600 LPM oxygen plant
being set up in Pithoragarh
with the help of Azim Premji
Foundation and social worker
Gopal Goswami for facilitating
CSR funding for the Bageshwar
plant. The oxygen plants set up
in Champawat, Pithoragarh
and Dehradun have been pro-
vided for by the Government of
India through the PM CARES
fund.
Speaking on the occasion,
the chief minister referred to
the considerable work done to
enhance health facilities in the
state during the past three
months. All necessary arrange-
ments have been made con-
sidering the possible third
Covid wave with a considerable
rise in the numbers of ICUs,
ventilators and oxygen sup-
ported beds.
He further said that Covid
care centres are being estab-
lished at the community health
centre (CHC) level too. Rawat
informed that currently 17
oxygen generation plants are
operating in the state while 17
plants are under construction.
In addition to this, approval has
been received for 11 more oxy-
gen generation plants from the
Centre. The chief minister fur-
ther said that the hospitals in
the state have 5,675 oxygen
concentrators and 14,349 oxy-
gen cylinders. The state will
soon receive 2,494 oxygen con-
centrators and 6,231 oxygen
cylinders.
Expressing his views on the
occasion, the Education min-
ister Arvind Pandey said that
the state government is making
all possible efforts to enhance
medical treatment facilities.
He said that these oxygen gen-
eration plants will provide con-
siderable relief during the third
Covid wave. The minister also
exhorted the citizens to con-
tribute to environmental con-
servation by planting trees on
the occasion of Harela.
3=Y^QeWebQdUc%]_bU?
WUÛbQdY_^`Q^dcY^CdQdU
?=BQ 347A03D=
The Uttarakhand Police has
set up a three member
high level committee on the
contentious issue of grade
pay of police personnel.
The Deputy Inspector
General (DIG) law and order,
Nilesh Anand Bharne said
that police headquarters has
set a committee headed by
Additional Director General
(ADG) of police
(Administration) Abhinav
Kumar on the grade pay issue.
The Inspector General
(IG) intelligence and securi-
ty, Sanjay Gunjyal and IG
personnel, Pushpak Jyoti are
the members of the commit-
tee.
The committee would
hold talks with the Jawans and
present their case effectively
before the state administra-
tion. The resentment is sim-
mering in the ranks of the
Uttarakhand police on the
issue of grade pay.
Under the new plan a
Grade pay of Rs 1800 would
be given to Sepoy on com-
pletion of 20 years of service.
Earlier a grade pay of Rs
4600 was given to Sepoy on
completion of 20 years of
service.
D³ZWP]S_^[XRT
bTcbd_R^XccTT
^]VaPST_PhXbbdT
?=BQ 347A03D=
The Bharatiya Janata Party
leaders will discuss the
Covid-19 situation in
Uttarakhand, efforts undertak-
en to tackle it and preparations
for a possible third wave during
the three-day Chintan Shivir to
be held at Ramnagar from
today.
The BJP State president
Madan Kaushik said that the
party’s road map for 2022 will
also be deliberated upon during
the three-day meet in
Ramnagar. Detailed discussions
will also be held on the prepa-
rations for the possible third
wave of Covid-19. The meet will
also include discussion on
works done by the party as part
of its Seva Hi Sangathan pro-
gramme and suggestions of
senior party leaders. Hesaid that
the party members had reached
the needy across the state and
provided all possible assistance
to them during the Covid pan-
demic. The party set up Covid
call centres in each district
which were linked down the
booth level to facilitate hospital
beds, oxygen cylinders and
organise blood donation camps.
Kaushik said that more efforts
will have to be made in the
future and for this the prepara-
tions will be discussed in the
Chintan Shivir. The party lead-
ers will also discuss the
Assembly by-elections and the
2022 elections. Ideas will be
deliberated upon for check the
spread of the virus and all
major issues of public interest
will be discussed as part of the
party’s road map. The BJP
national general secretary
(organisation) BL Santhosh,
statein-chargeDushyant Kumar
Gautam, co-in-charge Rekha
Verma, Kaushik, state general
secretary (organisation) Ajey
and other senior office bearers
of the party will also participate
in the three-day meet which will
be held from June 27 to 29.
19?c^SXbRdbb!!!a^PSP_
ePaX^dbPb_TRcbÛ2êXSX]
SPh2WX]cP]BWXeXa
?=BQ 347A03D=
Achieving success against
organised cyber crime, the
Special Task Force (STF)
Uttarakhand bust an opera-
tion in which two accused were
arrested in Dehradun for
allegedly defrauding American
citizens while posing as cus-
tomer care service providers for
their computers.
The deputy inspector gen-
eral (Law and Order/STF)
Nilesh Anand Bharne informed
that the STF had been receiving
information for some time
about a fake call centre being
operated from the Patelnagar
area of Dehradun. The STF
team raided a flat from which
the racket was being operated
near SGRR PG College at night.
On being questioned, the two
persons found in the flat said
that they used to pose as cus-
tomer care officers and offer to
repair technical glitches in the
computers of American citizens.
Two toll-free numbers had been
procured for the purpose which
were connected to a software
which displayed these numbers
when an US citizen made a
Google search for system/device
repair. The operators in
Dehradun used to contact such
people and make them install
remote access software on their
devices after which they used to
charge between US $ 100 to US
$ 900 for repairing the device.
Some of the people targeted
used to pay by cheques which
were deposited in the account of
their US resident accomplice
named Melissa who used to
deduct her commission and
send the remaining amount to
their bank account in Delhi. The
two accused nabbed by the
STF in Dehradun- Vaibhav
Gupta and Sood Khan were
found to have about Rs 1.10
crore in total in three different
bank accounts. After probing
this and communicating with
the bank officials, the STF got
the money frozen. The STF is
also communicating with the
Enforcement Directorate and
other agencies regarding the
amount. In addition to this,
communication will be under-
taken through the Interpol
regarding the involvement of US
based Royal Credit Union and
Quibical Technical Services.
The accused in Dehradun spent
their ill gotten gains to buy a Rs
60 lakh unit in Queens Court
Apartment near ISBT and a Kia
Seltos car costing Rs 16 lakh
apart from splurging on other
activities and items. A case has
been registered in the Patelnagar
police station under IPC sec-
tions 420, 120 B and IT Act sec-
tions 66D and 75. It is pertinent
to mention here this is the
third such racket bust by the
STF this year. The STF has been
focusing specially on fake inter-
national call centres being used
by cyber criminals to target
people in different locations.
67)EXVWVLQWHUQDWLRQDOFDOOFHQWUH
GHIUDXGLQJ$PHULFDQVIURP'RRQ
0RRdbTSdbTSc^
Sd_TDBRXcXiT]b
_^bX]VPbbÛcfPaT
Rdbc^TabTaeXRT
_aÛTbbX^]P[b
*8(672/801
?=BQ 347A03D=
Light to moderate
rain/thundershowers are
likely to occur at a few places
in the mountains and at iso-
lated places in the plains of
Uttarakhand today.
Along with this, the state
meteorological centre has also
issued a warning regarding
the possibility of thunder-
storm accompanied with
lightning and intense showers
occuring at isolated places in
Dehradun, Tehri, Pauri,
Nainital, Champawat, Almora
and Pithoragarh districts of
the state on Sunday. The pro-
visional state capital
Dehradun is likely to experi-
ence mainly clear to partial-
ly cloudy sky.
Light rain/thunder show-
er are likely to occur in some
areas while the maximum
and minimum temperatures
are likely to be about 34
degrees Celsius and 23
degrees Celsius respectively
on Sunday.
Meanwhile, the maxi-
mum and minimum temper-
atures recorded at various
places in the state on Saturday
were 33.9 degrees Celsius and
20.5 degrees Celsius respec-
tively in Dehradun, 34.5
degrees Celsius and 25.2
degrees Celsius in Pantnagar,
23.5 degrees Celsius and 13.8
degrees Celsius in
Mukteshwar and 24.4 degrees
Celsius and 14.2 degrees
Celsius respectively in New
Tehri.
9^dU^cUcX_gUbc
Y[UiY^cUfU^
TYcdbYSdcd_TQi

347A03D=kBD=30H k9D=4!!! ]PcX^]#
?=BQ 270=3860A7
Thousands of farmers from
Punjab and Haryana on
Saturday took out protest
marches against the Centre's
three farm laws even as police
used a water cannon to disperse
cultivators as they broke bar-
ricades at the Chandigarh-
Mohali border.
Farmers had planned to
march towards Punjab and
Haryana Raj Bhavans and sub-
mit a memorandum to mark
the completion of seven
months of their agitation
against the three central agri-
marketing laws on June 26. A
heavy police force was
deployed in and around
Chandigarh to stop protesters
from heading towards Punjab
and Haryana Raj Bhavans.
Barricades were put up at
many places to prevent farm-
ers coming from Mohali and
Panchkula to go towards
Chandigarh. However, agitat-
ing farmers, coming from the
Mohali side, entered
Chandigarh after forcing their
way through barricades put up
at the Chandigarh-Mohali bor-
der while facing water cannons.
A protester could be seen
climbing to the top of a water
cannon vehicle. Earlier, a large
number of farmers from sev-
eral parts of Punjab assembled
at Gurdwara Amb Sahib in
Mohali before moving towards
the Punjab Governor House.
Similarly, farmers from
several parts of Haryana also
gathered at Gurudwara Nada
Sahib in Haryana's Panchkula.
They headed towards Haryana
Raj Bhavan. Farmers in
Panchkula forced their way
through a layer of barricades
but they were not allowed to
enter Chandigarh and stopped
at the Chandigarh-Panchkula
border where Haryana police
had deployed water cannons
and trucks.
Farmers coming from the
Mohali side were led by farmer
leader Balbir Singh Rajewal
while protesters from the
Haryana side were led by
Haryana BKU (Chaduni)
leader Gurnam Singh Chaduni
and Samyukt Kisan Morcha
member Yogendra Yadav.
Carrying farmer outfits’
flags and raising slogans against
the BJP-led government, farm-
ers, including women and
youths, coming from Mohali
marched towards Chandigarh
on tractors, vehicles and walked
on foot. They were stopped
near sector 17 by police where
some buses were parked on the
road to prevent protesters from
heading towards Punjab Raj
Bhavan. Rajewal there sub-
mitted the memorandum to the
Chandigarh Deputy
Commissioner for giving it to
the Punjab Governor. Similarly,
Gurnam Singh Chaduni and
Yogendra Yadav gave a mem-
orandum to another official to
submit it to the Haryana gov-
ernor. After the submission of
memorandums, farmer leaders
appealed to protesters to return.
Though traffic was divert-
ed to alternative routes, com-
muters in Chandigarh faced
inconvenience. The majority of
farmers were without masks
and not following Covid-
appropriate behaviour.
Chandigarh Senior
Superintendent of Police
Kuldeep Chahal praised the
police personnel for handling
the situation with patience and
maturity and not allowing the
situation to go out of hand.
Meanwhile, gangster-turned-
activist Lakha Sidhana, who
was booked for his alleged
involvement in violence that
ensued at the Red Fort on
Republic Day, could also be
seen participating in the farm-
ers' protest programme.
Earlier addressing the gath-
ering at Gurdwara Amb Sahib,
Rajewal slammed the Modi-led
government over the three
farm legislation and alleged
that the Central government
intended to “hand over farm-
ing” to corporate houses.
Independent MLA from
Haryana Sombir Sangwan,
who was present at Gurudwara
Nada Sahib, said the farm laws
will “destroy” the farming com-
munity. Farmers have been
protesting against the Farmers'
Produce Trade and Commerce
(Promotion and Facilitation)
Act, 2020; Farmers''
(Empowerment and
Protection) Agreement on
Price Assurance and Farm
Services Act, 2020; and the
Essential Commodities
(Amendment) Act, 2020. They
have been camping at Delhi
borders since November last
year demanding the with-
drawal of these three laws and
that a new law be made to guar-
antee minimum support price
(MSP) for their crops.
A`]ZTVfdVdhReVcTR__`_eÙZdaVcdVRXZeReZ_XWRc^Vcd
?=BQ 270=3860A7
Punjab Chief Minister Capt
Amarinder Singh on
Saturday reiterated his demand
for a National Drug Policy to
tackle the scourge and under-
lined the need for more syner-
gy between the STF, the Police
and the Intelligence wing to
eliminate drugs from the state.
Calling for the support of all
stakeholders to fight the men-
ace, which he termed a global
problem, the Chief Minister
said while the neighbouring
states of Haryana, Rajasthan,
Himachal Pradesh, Delhi had
agreed to put in place an effec-
tive mechanism for tackling
drug smuggling, no significant
progress had been made.
Asserting his government’s zero
tolerance to drugs, he attributed
the problem to the strong nexus
between smugglers, gangsters
and terrorists to promote narco-
terrorism in the State, as well as
Pakistan. Interacting with the
people on the International
Day against Drug Abuse and
Illicit Trafficking, the Chief
Minister said most of the drugs,
especially heroin, are smug-
gled into Punjab from
Afghanistan via Pakistan bor-
dering States like Haryana, J
K, Rajasthan, Delhi and even
Nepal.
Expressing concern over a
recent incident of large drug
seizure in Canada, the Chief
Minister said it was shameful
that the involvement of few
Punjabi youth in the crime had
not only defamed Punjab but
also brought disrepute to other
Punjabis living peacefully across
the globe. On the progress
made in the fight against drugs,
the Chief Minister also said
Punjab had successfully got
two A category gangsters
deported - Sukhpreet Budhha
from Armenia in 2019 and
Sukh Bhikhariwal from UAE in
2021. Gaurav Patiyal was in the
process of being deported from
Armenia while Ramanjit Romi,
a handler of gangsters, was
being brought back from
Hongkong. On the Buddy
Programme, which was
launched on October 2, 2018,
with the aim of educating chil-
dren about the ill-effects of
drug abuse, Capt Amarinder
said it has so far been imple-
mented in 16,000 educational
institutions (Government and
Private), with 7.5 Lakh Buddy
Groups, comprising more than
37 lakh students and 1.30 lakh
Senior Buddies, formed.
DSW$PDULQGHUFDOOVIRU
1DWLRQDO'UXJ3ROLFWR
WDFNOHVFRXUJH
?=BQ 270=3860A7
ASpecial Investigation Team
probing the 2015
Kotkapura police firing inci-
dent questioned Shiromani
Akali Dal President Sukhbir
Singh Badal on Saturday for
around four hours
Badal reached the Punjab
Police Officers' Institute at
Sector 32 here around 11 am
following summons by the SIT.
He was the deputy chief min-
ister and holding the home
portfolio when incidents of
desecration of religious texts
and the subsequent police fir-
ing at people protesting against
it had taken place in Faridkot
in 2015.
Several senior Shiromani
Akali Dal (SAD) leaders,
including Bikram Singh
Majithia, Balwinder Singh
Bhundar, N K Sharma and
Daljit Singh Cheema, reached
the Punjab Police Officers’
Institute in a show of support
to Badal. After his question-
ing, Badal came out of the
institute at 3.10 pm and then
waved at the Akali Dal work-
ers from his vehicle.
On Tuesday, the SIT led
by Additional Director
General of Police (Vigilance
Bureau) L K Yadav had ques-
tioned Shiromani Akali Dal
patriarch and former Punjab
chief minister Parkash Singh
Badal for over two hours. The
Punjab government had
formed the new SIT to probe
the Kotkapura police firing
incident following the direc-
tions of the Punjab and
Haryana High Court.
The new SIT is investi-
gating the two FIRs registered
on October 14, 2015 and
August 7, 2018 in connection
with the Kotkapura incident.
The High Court had on April
9 this year quashed a report
by an earlier Punjab Police SIT
into the firing at people protest-
ing in Kotkapura in 2015 over
the alleged desecration of the
Guru Granth Sahib in Faridkot
district. Police had also opened
fire at a similar demonstration
in Behbal Kalan, also in
Faridkot, where two people
were killed. A separate probe is
underway in that case.
Meanwhile, Akali Dal
leader Maheshinder Singh
Grewal told reporters, “It is a
malicious investigation.
Earlier in the day, Congress
leader Navjot Singh Sidhu
slammed Sukhbir Singh Badal
and said the new SIT inches
closer to justice for Punjab's
soul.
Sidhu tweeted, 6 Yrs since
sacrilege of Guru Granth Sahib
Ji. No Justice in 2 yrs of your
rule. No Justice in the follow-
ing 4.5 yrs.. Today, New SIT
inches closer to Justice for
Punjab''s Soul you cry of
political interference. Political
interference was that which
delayed Justice by 6 yrs.
:^cZP_PdaP_^[XRTUXaX]V)B8C`dTbcX^]bBdZWQXa1PSP[
BdZWQXaBX]VW1PSP[fPbcWTST_dch
RWXTUX]XbcTaP]SW^[SX]VcWTW^T
_âcU^[X^fWT]X]RXST]cbÛ
STbTRaPcX^]ÛaT[XVX^dbcTgcbP]ScWT
bdQbT`dT]c_^[XRTUXaX]Vc^^Z_[PRT
X]5PaXSZ^cX]! $
=8B7D07090=Q
270=3860A7
In a bid to boost the purchase
of electric vehicles in the
state, Haryana Government
has proposed to waive off road
tax, registration fee, state toll
tax and provide an incentive of
upto at least Rs one lakh for
new vehicles.
The draft electric vehicle
policy chalked out by the State
Government to provide the
much needed impetus to the
electric mobility sector and
reduce carbon emissions, is
also aimed at generating
employment in Haryana.
The electric vehicle (EV)
draft policy has proposed 100
percent exemption of road
tax on EVs purchased within
Haryana state, applicable over
the period of the validity of
policy. The state will also
exempt SGST on purchase of
EVs manufactured within the
state under certain condi-
tions.
Apart from this, other
proposed incentives include
100 percent interest free loans
to the State Government
employees for purchase of
EVs in the state, exemption
from paying state toll tax, 30
percent subsidy on road price
of EVs in form of reimburse-
ment directly to the buyer in
the state on purchase of EVs
and to the financer, if the elec-
tric vehicle is hypothecated,
the dealers of EVs (non-trans-
port) will be exempted from
submitting of bank guarantee
of Rs one lakh for Online
Dealer Point Registration in
the state and the EVs will also
be registered on priority basis
with a minimum token fee of
Rs 100.
Under its ambitious poli-
cy, the State Government has
proposed to convert 100 per-
cent of bus fleet owned by
State Transport Undertakings
in Haryana into electric buses
(battery electric vehicles or
fuel cell EVs) by 2029, with
the first phase of 100 percent
conversion of bus fleet in
Gurugram and Faridabad by
2024. It also proposed phasing
out all fossil fuel based com-
mercial fleets and logistics
vehicles in Gurugram and
Faridabad by 2024 and all
cities by 2030.
All forms of government
vehicles, including vehicles
under government
Corporations, Boards and
government ambulances etc.
are proposed to be converted
to electric vehicles by 2024, as
per the draft policy.
The Deputy Chief
Minister Dushyant Chautala
had recently held a meeting
with the representatives of
automobile manufacturers
regarding the formulation of
'e-vehicle policy'. The gov-
ernment had also announced
a discount of 25 percent to 600
farmers who book an e-trac-
tor by September 30 in the
state.
A senior officer of
Haryana Government while
talking to The Pioneer said, “A
draft on e-vehicle policy has
been prepared after a series of
consultations with stakehold-
ers and various government
Departments. The policy aims
to make Haryana a global
hub for electric mobility
development and manufac-
turing of EVs besides creating
an eco-friendly environment
by promoting EVs through
exemption in taxes, permit fee
etc and providing incentives.
The policy will be finalized
soon and rolled out by the
State Government.”
The officer said that test
rides in collaboration with
various vehicle manufacturers,
green days in the capital
region and other cities will be
promoted to take the new
technology to the common
man. Phase wise or city wise,
promotional discounted tariffs
will also be offered for charg-
ing battery EVs, he said.
The government has also
planned to prepare an electric
mobility blueprint for the
entire state for a phase wise
transition to EVs. It is also
proposed to provide online
registration of EVs, the officer
added.
For developing charging
infrastructure, the draft poli-
cy has planned installation of
charging infrastructure at least
every 50 km on highways,
other major roads in the state.
The government buildings will
prepare a roadmap to set up
charging or swapping stations
in all of its parking spaces
while all petrol pumps will be
asked to have charging stations
and battery banks.
An extra incentive for a
period of six months from the
date of issuance of policy is
proposed to be provided to the
buyers who intend to purchase
e-rickshaw or carts, electric
cars below Rs 10 lakh and
above Rs 10 lakh. It has been
proposed to issue these buyers
incentive coupons of upto at
least Rs one lakh.
Not only this, the govern-
ment has also proposed special
incentives for mega integrated
automobile projects and ultra-
mega battery as well as to lithi-
um battery manufacturing
plants on a case to case basis.
For development of elec-
tric mobility industrial parks,
the government has proposed
to allocate 100 to 200 acres of
land for developing such parks
with plug and play internal
infrastructure, common facil-
ities and necessary external
infrastructure. An incubation
center for handholding star-
tups will also be planned in the
EVs park, the draft policy
stated.
To boost investments from
private infrastructure devel-
opers, the government has
planned allocation of land
across major cities for setting
up charging, battery banks or
battery swapping stations in a
form similar to a contempo-
rary fuel station as per statu-
tory clearances. Also, the exist-
ing private buildings such as
malls and other commercial
buildings will be incentivized
to set up charging, battery
banks or battery swapping
stations, as per the draft
policy.
7PahP]P6êc_a^_^bTbPccaPRcXeTX]RT]cXeTbc^_a^^cTT[TRcaXReTWXR[Tb
?=BQ 270=3860A7
The Punjab government
has urged the Centre to
sanction a third Sainik school
for the state in Bathinda dis-
trict. The first Sainik School
is at Kapurthala and the sec-
ond is to come up at
Gurdaspur.
In a letter to Defence
Minister Rajnath Singh, Chief
Minister Capt Amarinder
Singh said the state govern-
ment would sign the
Memorandum of Agreement
(MoA) for the third Sainik
School as soon as the
approval of the Defence
Ministry is received.
The CM said the state
government has already allot-
ted 40 acres of land at Dalla
Gorian in Gurdaspur to
establish Punjab's 2nd Sainik
School and the MoA has also
been signed and submitted to
the department of ex-ser-
vicemen welfare in the
Ministry of Defence.
However, he said this
shall not, in his opinion, suf-
fice to meet the aspirations of
the Punjabi youths.
Emphasizing the need
for at least one Sainik School
each in the Malwa, Doaba
and Majha regions, the three
natural geographical divi-
sions of the state, he said it
was felt that a third Sainik
School in Bathinda will suit-
ably cater to this require-
ment.
?d]YPQ2faXcTbc^
3TUT]RTX]Xbcahc^
bP]RcX^]aSBPX]XZ
BRW^^[X]1PcWX]SP
?=BQ 270=3860A7
Haryana Chief Minister
Manohar Lal Khattar on
Saturday met Union Minister
for Road Transport and
Highways Nitin Gadkari in
Manali and discussed 11 pro-
jects worth Rs 6,393.32 crore
with regard to development of
National Highways in the State.
An official spokesperson
said that all the projects were
accepted by the Union
Minister. The Chief Minister
assured the Union Minister
that necessary support for tak-
ing possession of land at village
Khatiwas in Charkhi Dadri
District for construction of
Isamailabad Narnaul
Expressway will be provided.
He also assured to remove
encroachments on Faridabad
bypass so that construction of
DND-Sohana Expressway is
expedited.
The spokesperson said that
during the meeting, on the
proposed project of the
Construction of Vehicular
Underpass (VUP) on Panipat
- Jalandhar National Highway
No. 44 (Old NH-1) at km
117.905 near Kambopura vil-
lage in Karnal district, the
union minister directed NHAI
to construct the VUP at the
earliest. On the proposed pro-
ject of declaration of Pehowa-
Kurukshetra- road upto NH-
44 as National Highway and
construction of Kurukshetra
Bypass, the member (Projects)
NHAI intimated that the cor-
ridor was declared as “in-prin-
ciple” National Highway and is
yet to be declared as NH due
to pending policy decision on
“in-principle” NHs. The Union
Minister directed NHAI to
include the project in
Bharatmala Phase-II including
Kurukshetra bypass.
On the project of
Construction of a new
National Highway starting
from Faridabad bypass and
ending at EPE interchange
near Chainsa village, Gadkari
directed NHAI to examine the
feasibility of construction of
this new road. He further said
that on the proposed East-West
Expressway from Dabwali to
Panipat project, Gadkari
directed NHAI to examine
feasibility of Expressway on
priority.
On the proposed project of
the construction of service
road along Delhi-Vadodara
Expressway (NH-148N) for
connecting Nuh-Mandkola-
Palwal road with Western
Peripheral Expressway,
Gadkari directed NHAI to
provide land for construction
of service lanes by State
Government. State PWD was
also asked to construct the ser-
vice lanes.
On construction of inter-
change on Eastern Peripheral
Expressway to link Palwal-
Aligarh National Highway
(NH-334D) in Palwal district,
the Union Minister directed
NHAI to construct the inter-
change at the earliest. On con-
struction of underpasses at
Bilaspur Chowk, Kapdiwas,
Bawal Chowk and near
Rathiwas Budkha on NH-48
(Old NH-8), Gadkari directed
NHAI to construct the VUP at
the earliest. On construction of
underpass at km 51.300 of
Delhi Agra National Highway-
44 (Old NH-2) near village
Bhagolafor connectivity to Dry
Port Zone of Prithla Industrial
Area, the Union Minister
directed NHAI to construct the
VUP at the earliest. The State
Chief Minister agreed to bear
50% of the cost of the project.
On an underpass on Panchkula
- Yamunanagar National
Highway at the road dividing
Sector-26 27 as a standalone
project, Gadkari directed
NHAI to construct the VUP at
the earliest. On the proposed
project of the construction of
Vehicular Underpass (VUP)
on Panipat - Jalandhar
National Highway No. 44 (Old
NH-1) at km 117.905 near
Kambopura village in Karnal
district, the Union Minister
VUP at the earliest. On the
construction of underpass on
Panchkula - Yamunanagar
National Highway at the road
dividing Sector-26 27 as a
standalone project, Gadkari
VUP at the earliest.
7QT[QbYcQ^SdY_^c!!
`b_ZUSdc_VC#)##
Sb_bUV_b8QbiQ^Q
?=BQ 270=3860A7
The Chandigarh
Administration on
Saturday said that 50 random
samples of city residents for
period May and June were
sent to National Centre for
Disease Control (NCDC) lab,
New Delhi on June 4 for Whole
Genomic Sequencing (WGS).
As per reports, Variant of con-
cern (VOC) has been detected
in 35 samples. One Alpha vari-
ant (B.1.1.1.7), 33 Delta variant
(B.1.617.2) and one Delta plus
variant (AY.1) has been report-
ed in the samples sent for
WGS, according to an official
statement.
The sample of a 35- year-
old resident of Vikas Nagar
Mauli-Jagran who tested pos-
itive for Covid-19 on May 22
has been detected with Delta
plus variant (AY.1). Samples of
4 direct high-risk family con-
tacts who tested positive in
May were sent to NCDC for
WGS on Saturday. Also, 29
samples for the period of June
have already been sent to
NCDC on June 22 the results
of which are awaited.
The 35- year- old and all
the family members which
included two elderly and a
small child had mild disease.
None of them were hospitalized
and have fully recovered.
2QH'HOWD
SOXVYDULDQWRI
YLUXVGHWHFWHG
LQKDQGLJDUK
8=1A845
C74A73D=8E4AB8CHA08B4B0F0A4=4BB
0608=BCBD1BC0=2401DB4
Dehradun: The Haridwar senior superintendent of police
Senthil Avudai Krishna Raj S expressed concern at the rising
tendency towards substance abuse especially among the
younger generation. He was speaking at an online programme
organised by Motherhood University on International Day
Against Drug Abuse on Saturday. Informing the gathering
about the ill effects of substance abuse on individuals and
society, the SSP exhorted all to abstain from substance abuse.
He also spoke about the various measures being taken by the
police to check the menace of substance abuse. Other police
officers, the university’s vice chancellor Narendra Sharma,
director of administration, Deepak Sharma along with faculty
members and university officials were also present on the
occasion.

[P]SPaZ$
347A03D=kBD=30H k9D=4!!!
?=BQ =4F34;78
Chief Justice of India N V
Ramana has written to
Law Minister Ravi Shankar
Prasad seeking steps to
resolve the poor digital con-
nectivity in rural, tribal,
remote and hilly areas that is
“adversely impacting the pace
of justice delivery”. The CJI
referred to the digital divide
and said that “a whole gener-
ation of lawyers is being
pushed out of the system” due
to the technological inequal-
ity.
He was speaking during
the release of a book,
‘Anomalies in Law and
Justice’, authored by former
Supreme Court Judge Justice
R V Raveendran in a virtual
function here.
During the course of the
panel discussion that followed
the launch of the book, he
informed that the matter of
connectivity figured promi-
nently in the two-day confer-
ence of Chief Justices of High
Courts that he had held
recently.
“The poor connectivity in
rural, tribal, remote and hilly
areas is adversely impacting
the pace of justice delivery
and is also depriving thou-
sands of young lawyers across
the country of their liveli-
hood. …A whole generation
of lawyers is being pushed out
of the system due to digital
divide,” the CJI said.
Justice Ramana also said
that he recently wrote to the
Minister of Law,
Communications and IT
highlighting these issues and
requested him to initiate
steps on priority to bridge the
digital divide and also to
evolve a mechanism to help
the advocates who have lost
livelihood due to the Covid
pandemic and who are in
dire need of financial assis-
tance.
The CJI also highlighted
the need to declare the legal
professionals and
associated functionaries as
frontline workers and the
need to vaccinate them all on
priority.
4;:dVVdZ_¶d
YV]aeà]fX
UZXZeR]UZgZUV
?=BQ =4F34;78
After holding talks with
Jammu and Kashmir-
based parties, the Centre has
now invited parties and civil
society members from Kargil
and Ladakh for talks on July 1.
This meeting will be chaired by
Minister of State for Home
Affairs G Kishan Reddy, at his
residence, according to offi-
cials.
Public representatives, for-
mer MPs and members of civil
society have also been invited
to the meeting, slated to be held
on July 1 at 11am.
The meeting will take stock
of the development, monitor-
ing of the ongoing projects and
social issues of the area.
Modi had on Thursday chaired
a three-and-half-hour-long
meeting with 14 political lead-
ers from Jammu and Kashmir.
In the meeting, the Prime
Minister and Home Minister
Amit Shah made it clear to the
Kashmir leaders of Gupkar
alliance that election to the
assembly will be conducted
after the ongoing Delimitation
process.
“We are committed to
ensure all round development
of JK. The future of Jammu
and Kashmir was discussed
and the delimitation exercise
and peaceful elections are
important milestones in restor-
ing statehood as promised in
Parliament,” said Shah.
The meeting was the first
between the Centre and main-
stream Jammu and Kashmir
politicians after the abrogation
of Article 370 and the division
of the erstwhile State into two
Union Territories in August
2019.
Prior to PM Modi’s meet
with Jk leaders, Ladakh MP
Jamyang Tsering Namgyal had
said in a tweet that the Gupkar
alliance did not have the right
or authority to speak on behalf
of the people of Ladakh.
2T]caTX]eXcTb
_PacXTbUa^
:PaVX[;PSPZWUâ
cP[Zb^]9d[h
?=BQ =4F34;78
US pharma firm Johnson
Johnson’s single shot vac-
cine is likely to be made avail-
able in India from as early as
July, though it will be limited to
a few thousand doses initially.
However, it is not likely to
find many takers here as
experts say that one dose of JJ
shot will not be effective to deal
with delta variants that are
spreading fast in India. They
said a booster dose will be
needed to make it more effec-
tive.
The Covid-19 vaccine
developed by Johnson
Johnson will likely be available
in India in small quantities by
July this year, sources said.
They said the Association
of Healthcare Providers (India)
is in the process of privately
procuring the vaccine directly
from the US-based manufac-
turer.
The one-shot vaccine will
be priced at USD 25 in India.
Under the government’s
new rules, vaccines approved
by US drug regulator do not
need to conduct bridging trials
in India.
JJ had recently also start-
ed discussions with the coun-
try’s apex vaccine testing labo-
ratory in Kasauli, the Central
Drugs Laboratory (CDL),
through its Indian partner
Biological E. With this, the vac-
cine is expected to be approved
for use in India in the coming
months.
One of the first single-
shot coronavirus vaccines
developed so far, JJ’s Janssen
vaccine was cleared for emer-
gency use in the US and most
recently in the UK. According
to the WHO, the vaccine’s effi-
cacy is 66.3 per cent for mild to
moderate Covid-19 and 76.3
per cent for severe to critical
infections.
9^W]b^]9^W]b^]´bbX]V[TbW^cYPQ
[XZT[hc^QTPePX[PQ[TX]8]SXPQh9d[h
?=BQ =4F34;78
In the run-up to the
Assembly polls to six States,
including Uttar Pradesh, early
next year , BJP President J P
Nadda on Saturday held a
high-powered meeting of
senior party leaders, including
several senior Union
Ministers and discussed at
length political and gover-
nance issues linked to these
States.
The Covid-19 manage-
ment in these election-bound
states, five of which - UP,
Uttarakhand, Goa, Gujarat
and Manipur- are BJP-ruled,
also came-up for scrutiny.
Punjab, which has a Congress
government, too will go to
polls, early next year.
Party leaders reviewed
BJP’s Covid19 management
under its programme ‘Seva hi
Sanghthan’.
Besides Nadda, Union
Ministers Amit Shah, Rajnath
Singh, Nirmala Sitharaman,
Narendra Singh Tomar, Smriti
Irani, and Kiren Rijiju were
among those who attended
the meeting,
Successful management
of Covid19 after the centre
and several BJP-ruled state
governments faced criticism
for them being caught off-
guard during the second
Coronavirus wave seemed to
be a top priority for the BJP,
wary of its fallout in the
assembly elections.
“Preparation for the
assembly polls was the main
agenda of the meeting,” said
BJP leaders after the meet at
party headquarters here.
UP figured prominently
in the meet as it has been in
the focus for last several
months. Prime Minister
Narendra Modi is personally
monitoring developments in
UP and his virtual review of
development plan in Ayodhya
with Chief Minister Yogi
Adityanath during the day
was a pointer to this.
Yogi had this month vis-
ited the national Capital and
met Modi and all top-line BJP
leaders.
Besides, UP, the BJP lead-
ers also factored anti-incum-
bency working against its gov-
ernments in Uttarakhand,
Goa, Manipur and Gujarat.
In Uttarakhand, while the
BJP brought in a new Chief
Minister Tirath Singh Rawat
apparently to beat the anti-
incumbency against his pre-
decessor Trivendra Singh
Rawat, it also faces a big chal-
lenge to retain power in
Gujarat where it had an extra-
ordinary-run of 25 years and
the Congress, though still
unorganised, is seeing a polit-
ical opportunity to break the
BJP citadel even as the AAP is
slowly gaining ground in dis-
tricts like Surat.
1DGGDKROGV%-3
PHHWDKHDGRI
SROOVLQ6WDWHV
?=BQ =4F34;78
BJP president JP Nadda on
Saturday named Bhabesh
Kalita and Sharda Devi as
presidents of its Assam and
Manipur units respectively.
Kalita, a sitting MLA in the
Assam assembly, will replace
Ranjeet Kumar Dass, who
was inducted as a Minister in
the Himanta Biswa Sarma-led
Government in the State.
19?RWXTU]PTb
0bbPP]X_da
_aTbXST]cb
?=BQ =4F34;78
Amid demand for vaccina-
tion of kids and school stu-
dents, Pune based vaccine
major Serum Institute of India
(SII) is all set to start phase 2
and 3 paediatric trials of
Covovax on 920 children —
460 each in the 12-17 and 2-11
age groups — from next
month.
The recombinant nanopar-
ticle protein-based vaccine —
NVX-CoV2373 — developed
by American biotechnology
firm Novavax has been brand-
ed as Covovax in India. It will
be the fourth Covid-19 vaccine
to undergo clinical trials for
children in India.
SII, partnering with
Novavax, expects to launch
Covovax for adults in India by
September and for children by
the end of this year.
“We plan to begin the pae-
diatric trials in 920 children
across 10 sites next month
after seeking permission from
the DCGI (Drug Controller
General of India),” as per the
statement from the company.
B88c^bcPac_WPbT!caXP[bÛ
2êêPg^]ZXSbUa^]Tgc^]cW
?=BQ =4F34;78
Modi on Saturday held a
review meeting with top offi-
cials to monitor the progress of
vaccination and Covid situa-
tion in the country and direct-
ed officers to work with the
States to ensure that the pace of
testing does not go down.
He said testing remains a
very important weapon to track
and contain rising infections in
any region.
Officials gave a detailed
presentation to the Prime
Minister on progress of vacci-
nation in the country. He was
briefed about the age wise vac-
cination coverage and about the
vaccine coverage among
healthcare workers, frontline
workers and general population
in various states.
Officials apprised Modi
about the vaccine supply in the
upcoming months and efforts
being made to increase pro-
duction.
The Prime Minister was
informed that 3.77 crore doses
have been administered in the
last 6 days which is more than
the entire population of coun-
tries like Malaysia, Saudi
Arabia and Canada.
It was also discussed that
128 districts in the country
have vaccinated more than
50% of the 45+ population and
16 districts have vaccinated
more than 90% of the 45+ pop-
ulation.
The PM expressed satis-
faction at the rising speed of
vaccinations in this week and
stressed that it is important to
carry this momentum forward,
according to a statement from
the Prime Minister’s Office.
30WDNHVVWRFNRIMDEGULYH
RYLGVLWXDWLRQLQFRXQWU
New Delhi: The Pinarayi
Vijayan Government has
moved the Supreme Court
seeking its nod to withdraw
cases against CPI(M) leaders,
including Kerala Education
Minister V Sivankutty, for
vandalism inside Assembly
in 2015, when the current
regime was not in power.
The Kerala High Court, in
an order passed on March 12,
had refused to give its nod to
the same saying that the elect-
ed representatives were
expected to uphold prestige of
the House or face conse-
quences.
The MLAs had vandalised
the Speaker’s dais, uprooted
his chair, pulled out mike
system, computer etc.
The special leave petition
filed by the state government
said: “When Article 105(3),
194(3) of the Constitution of
India confers certain privi-
leges and immunities to the
members of the Parliament
and State Legislature, is it
proper for the Secretary of
Legislative Assembly to file
cases against the MLAs with
regard to an incident that
happened on the floor of the
House during the protest
made by the opposition mem-
bers, that too without the
consent of the Speaker of the
Assembly?”
The state government
contended that the high court
failed to appreciate the fact
that the alleged offences under
Section 447 and 427 of IPC
and Section 3(1) of the
Prevention of Damage to
Public Property Act, hap-
pened on the floor of the
Legislative Assembly during
the Budget Session of the leg-
islature as a part of the protest
by opposition members
against the budget
presentation by the then
Finance Minister due to the
then prevailing political rea-
son.
“The FIR registered by
the Secretary Legislative
Assembly without the consent
of the Speaker is wrong and
therefore the application filed
under section 321 Cr.P.C. is
liable to be allowed.
“The act of the accused
persons being in relation to
their function to protest as
members of the legislative
assembly the MLAs who are
accused in this FIR, entitled to
get protection under the
Constitution,” argued the state
government.
The Kerala High Court
had dismissed the state’s peti-
tion against an order of rejec-
tion by the Chief Judicial
Magistrate’s court in
Thiruvananthapuram, seek-
ing permission to withdraw
prosecution against accused,
including sitting ministers.
The government argued
that Article 105(3), 194(3) of
the Constitution confers cer-
tain privileges and immunities
to the members of the
Parliament and state
Legislature.
“Therefore, it is not prop-
er for the Secretary of
Legislative Assembly to file
cases against the MLAs with
regard to an incident hap-
pened on the floor of the
House during the protest
made by the opposition mem-
bers, that too without the
consent of the Speaker of the
Assembly,” added the plea,
seeking stay on the high court
order. IANS
New Delhi: Prime Minister
Narendra Modi on
International Day against Drug
Abuse and Illicit Trafficking
said that drugs bring with it
darkness, destruction and dev-
astation and we should save
lives and realize the vision of
drugs free India.
In his message Prime
Minister Modi said, “Today, on
International Day against Drug
Abuse and Illicit Trafficking, I
laud all those working at the
grassroots to eliminate the
menace of drugs from our
society. Every such effort to
#SaveLives is vital. After all,
drugs bring with it darkness,
destruction and devastation.”
“Let us reiterate our com-
mitment to
#ShareFactsOnDrugs and
realise our vision of a Drugs
Free India. Remember - addic-
tion is neither cool nor a style
statement. Sharing an old
#MannKiBaat episode which
contained many aspects of
overcoming the drugs menace.”
he added.
While Government agen-
cies like NCB is on toes to
detect and stop the drug rack-
et in the country, the agency on
Thursday busted an interna-
tional drug smuggling racket
with the arrest of a wanted drug
smuggler linked to a Pakistan
Lahore-based operative in con-
nection with the recovery of 56
kg of heroin from the India-
Pakistan border in Rajasthan.
IANS
;Tc³baTP[XbT
^daeXbX^]Û
PSadVbUaTT
8]SXP)?
New Delhi: EESL’s wholly
owned subsidiary Convergence
Energy Services Limited has
resumed distribution of ‘LED’
bulbs as part of its Gram Ujala
Scheme in villages of Uttar
Pradesh and Bihar.
Accordingly, under the
‘Gram Ujala’ programme, ‘7
watt and 12-Watt’ led bulbs
with 3-years warranty are given
to rural consumers against
submission of working incan-
descent bulbs at an affordable
cost of Rs 10 per bulb.
“So far, CESL has distrib-
uted 2,52,069 LED bulbs in
Arrah and Buxar districts of
Bihar, whereas in UP, nearly
1,08,470 LED bulbs have been
sold in Varanasi, Prayagraj,
Kaushambi, Pratapgarh and
Bhadohi areas.”
The scheme was launched
in March this year and has
helped save costs of around
Rs 17 crore per year along-
with 5,06,35,066.68 kWh
energy per year.
“Any consumer from a
rural household with a valid
electricity connection from
‘DISCOM’ can avail LED
bulbs under the initiative.”
“Operations under the
programme had begun before
the pandemic induced
restrictions were imposed in
the country in April. Now,
with the unlock in Uttar
Pradesh and Bihar, distribu-
tion and awareness building
about ‘Gram Ujala’ has
restarted.”
The company uses carbon
credits to offset the cost of
these LED bulbs.
“One consumer can
exchange a maximum of 5
bulbs under this initiative.
These bulbs consume 88 per
cent less electricity as com-
pared to their incandescent
counterparts.”
“They contribute signifi-
cantly to reducing carbon
emissions, energy savings and
monetary savings.”
In addition, the company
added that these lights come
with a three-year free replace-
ment warranty and better
shelf life.
“Switching to these
affordable LED lights can
help in saving up to 13 units
per bulb per month.” IANS
New Delhi: As the farmers are
intensifying their protest over
the three farm laws on the
completion of seven months of
their agitation at the borders of
the national capital, Congress
leader Rahul Gandhi on
Saturday came out in their
support saying we are with the
“farmers”.
In a tweet in Hindi, Rahul
Gandhi said, “It’s simple - We
are with Satyagrahi Annadata
(farmers).”
The Congress Lok Sabha
MP from Kerala’s Wayanad
tweeted with the hashtag
#Farmersprotest. On the com-
pletion of seven months of their
protest at several points on the
borders of the national capital,
the farmers under the banner
of Samyukt Kisan Morcha
(SKM) are observing ‘Kheti
Bachao, Loktantra Bachao
Diwas”.
Farmers will also visit the
Raj Bhavan (the Governor
House) in several states.
The farmers from Punjab,
Haryana and western Uttar
Pradesh have been protesting
demanding the
withdrawal of three farm laws
and ensuring MSP for their
produce since November 26
last year. IANS
:e¶ddZâ]V
hVRcVhZeY
WRc^Vcd+CRYf]
24B;aTbdTbSXbcaXQdcX^]
Û;43Qd[QbX]D?1XWPa
New Delhi: The Narcotics
Control Bureau (NCB) on
Saturday said that it has bust-
ed a drug trafficking syndicate
operating over darknet and
arrested eight persons who
were involved in the
trade.
NCB Deputy Director
K.P.S. Malhotra said that
the drug law enforcement
agency launched a special
drive against psychotropic
drugs trafficking
especially those using the
darknet and internet phar-
macy route.
He said that the agency
seized 22 lakhs of
psychotropic drugs, 70,000
Codeine Based Cough Syrups
(CBCS) and 245 kg of
psychotropic drugs and arrest
of eight persons.
The official said that the
agency carried out
searches in various parts of
Delhi NCR, Uttar Pradesh,
Uttarakhand and Himachal
Pradesh. IANS
32RecdcY^dUb^QdY_^QTbeW
ci^TYSQdUQSdYfU_fUbTQb[Ûd
New Delhi: After Union
Information Technology
Minister Ravi Shankar Prasad
and Congress MP Shashi
Tharoor were temporarily
locked out of their Twitter
accounts on Friday, the latter
said that he would seek an
explanation from the
microblogging platform for its
actions.
“As Chairman of the
Parliamentary Standing
Committee on Information
Technology, I can state that we
will be seeking an explanation
from @TwitterIndia for the
locking of @rsprasad’s my
accounts the rules proce-
dures they follow while oper-
ating in India,” Tharoor said in
a tweet.
In an earlier tweet, the
Congress MP from
Thiruvananthapuram had said:
“And @Twitter locked me out
again because to explain the
problem, the first tweet in this
thread included the offending
copyrighted video. Locking is
a foolish response to a DCMA
notice; disabling the video
(which they’ve now done)
should be enough. @Twitter
has a lot to learn.”
Earlier in the day, Prasad
was denied access to his Twitter
account for almost an hour
over alleged violation of the US’
Digital Millennium Copyright
Act.
After being temporarily
blocked, Prasad said in a series
posts on Koo, the India-made
micro-blogging platform:
“Twitter’s actions were in gross
violation of Rule 4(8) of the
Information Technology
(Intermediary Guidelines and
DigitalMediaEthicsCode)Rules
2021wheretheyfailedtoprovide
meanypriornoticebeforedeny-
ing me access to my own
account.”
Prasad, who has been at the
forefront of the government’s
drive to bring in more compli-
ance and stricter norms for
socialmediaplatforms,added:“It
is apparent that my statements
calling out the high handedness
and arbitrary actions of Twitter,
particularly sharing the clips of
my interviews to TV channels
and its powerful impact, have
clearly ruffled its feathers.”
“No matter what any plat-
formdoes,theywillhavetoabide
by the new IT Rules fully and
thereshallbenocompromise on
that,” he added.
?Pa[_P]T[c^bTTZTg_[P]PcX^]Ua^CfXccTaUâ[^RZX]VPRR^d]cb)CWPa^â
2XcX]V³_aXeX[TVTb´:TaP[P6êcêTb
B2c^Sa^_bdXcbPVPX]bc;TUc[TPSTab

Pioneer dehradun-english-edition-2021-06-27

Pioneer dehradun-english-edition-2021-06-27

Recommended

Recommended

More Related Content

What's hot

What's hot (14)

Similar to Pioneer dehradun-english-edition-2021-06-27

Similar to Pioneer dehradun-english-edition-2021-06-27 (20)

More from DunEditorial

More from DunEditorial (20)

Recently uploaded

Recently uploaded (20)

Pioneer dehradun-english-edition-2021-06-27