Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.
Upcoming SlideShare
What to Upload to SlideShare
What to Upload to SlideShare
Loading in …3
1 of 98

Dinar Kebaya



Download to read offline

Graphic Standart Manual of Dinar Kebaya Logo Design

Related Books

Free with a 30 day trial from Scribd

See all

Dinar Kebaya

  1. 1. G r a p h i c S t a n d a r d M a n u a l dinar kebayaspesialis kebaya & make up
  2. 2. G r a p h i c S t a n d a r d M a n u a l
  3. 3. DAFTAR ISI Daftar Isi Kata Pengantar Identitas Logo Elemen Pembentuk Logo Logo Primer & Sekunder Konsep Logo & Teks Lampiran (tagline) Konsep Warna Background Ilustrasi Ukuran Standar Skala Minimal Konfigurasi Clearspace Gridlines Typeface Co Branded Logos Target Penempatan Logo Logo 3d 1 2 5 6 10 15 16 17 19 21 23 25 31 33 37
  4. 4. DAFTAR ISI Media Aplikasi Logo Stationery and administrative Web sites PR / IR Communications Letterheads Envelope Name Card Fax Cover Sheet Notepad Bill / Nota Mailing label Presentation Slide Map Brosur Sertifikat CD Case Leaflet 38 40 41 43 44 45 46 47 48 49 51 52 53 55
  5. 5. DAFTAR ISI Penutup Marketing / Sales Identity Introduction Pricelist Poster Banner X Banner Seragam Gift/ Merchandise HR Communications Facilities Signs Vehicles Recruitment Ad Form Neon Box Alternatif Grafis Channel Letter Umbul-umbul 65 67 70 72 73 76 63 56 57 60 61 62
  6. 6. SalamSejahtera, Pertama, saya sangat bersyukur kepadaT uhanYME karena buku panduan ini telah selesai denganlancar.Dengan rasabanggadanbahagiasayamempersembahkan pedomanaplikasilogo atau Graphic Standart Manual Dinar Kebaya. Dalam revisi logo yang baru ini saya berharap peningkatan citra positif yang muncul secara internal dan eksternal. Selain itu, buku ini juga diharapkandapatmelindungipenggunaan logosecarabaikdantepatdemitercapainyaVisidanMisi perusahaan. Pedoman aplikasi logo ini berisi tentang penjelasan dan panduan dalam aplikasi logo secaratepatdan benar. Hal ini ber tujuan menjaga estetika dan fungsional logo sebagai simbol yang mewakili perusahaan. Selain juga agar tidak terjadi kesalahpenggunaan diluar dari peraturan- peraturanperusahaan. Semoga buku ini dapat bermanfaat bagi pihak yang bersangkutan terutama perusahaan Dinar Kebaya. Hal-hal yang mungkin perlu revisi di dalam buku ini, penyusun menerima kritik dan saran. Pada akhirnya buku ini bertujuan untuk membantu mewujudkan Visi dan Misi Perusahaan Dinar Kebaya. Demikian dari saya. T erima kasih atas dukungan dari semua pihak yang terkait. Semogabermanfaat.
  7. 7. PROFIL PERUSAHAAN Dinar Kebaya merupakan sebuah perusahaan yang berdiri pada tahun 2007. Perusahaan inibergerakdibidangjasadanproduksikebaya.Jasayangditawarkanberpupa makeupdantatarias pengantin. Sedangkan untuk produksi kebaya, sebagian besar adalah modifikasi kebaya modern. Pada awalnya, usaha ini bertempat di rumah owner yaitu Dinar Rahadian. Kemudian pada tahun 2010 pindah ke ruko kalpataru dan kemudian berpindah lagi di ruko grahm utero soekarno hatta sampai saat ini. Pada perkembangannya, Dinar Kebaya mulai menambah jasa yang ditawarkan yaitu dengan menambahkan jasa wedding organizer.Tidak hanya make up dan rias pengantin saja, tetapi jugaadaperawatanprawedding,fotowedding,paketwisuda,dsb. Untuk produksi kebaya sendiri masih terus dikembangkan dengan inovasi yang tiada henti. Karena sebagian besar konsumen Dinar Kebaya adalah anak muda, maka modifikasi kebaya yang dilakukan adalah dengan gaya modern dan gaya baju anak muda yang ter update. Namun terdapat benang merah sendiri dari modifikasi kebaya ini, yaitu dengan tidak meninggalkan identitas tradisional kebaya itu sendiri. Dinar Kebaya memiliki visi untuk mengembangkan bisnis usahanyadanmengenalkankebayasampaikeranahinternasonal. GRAPHIC STANDART MANUAL
  8. 8. Produk Dinar Kebaya berupa modifikasi kebaya modern dan tradisional. Sebagian besar adalah produk kebaya modern. Yang dimaksud dengan modifikasi kebaya modern ini adalah kebaya yang fashionable, perpaduan unsur etnik dan modern, dan juga permainan detail dari struktur kebaya itu sendiri(bisadaridetailborder,renda,payet,dsb). PRODUK PERUSAHAAN GRAPHIC STANDART MANUAL
  9. 9. LOGO
  10. 10. dinar kebayaspesialis kebaya & make up
  11. 11. ELEMEN PEMBENTUK LOGO Cyan, Magenta, Yellow, Black (CMYK) Sistem warna yang lazim digunakan dalam proses cetak. Typeface (Font) : Nama jenis huruf yang digunakan didalam logo ini, antara lain Barkentina 1 dan Myriad Pro Picture Mark Text Mark Tagline Logo Pesan berupa teks yang diposisikan di bawah identitas logo Area sekitar logo yang sengaja dikosongkan dengan skala yang telah ditentukan untuk menghindari tabrakan dengan elemen desain lain, termasuk teks dan foto. Warna Teks (Type) Tagline Area Kosong (Clearspace) GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 1
  12. 12. VERSI LOGO PRIMER & SEKUNDER Identitas logo Dinar Kebaya mempunyai dua komponen dasar, yaitu logogram (picture mark) dengan bentuk bulat dan logotype (text mark) dengan teks dinar kebaya . kedua elemen tersebutdiletakkandalamposisiratatengah. sebagai aturan pokok perusahaan, identitas ini wajib dipergunakan sebagai penanda perusahaan dalam produkdanatributperusahaan. Versi Primer / utama GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 2
  13. 13. VERSI LOGO PRIMER & SEKUNDER Logo sekunder ini sebagai alternatif penempatan posisi logo selain dalam posisi rata tengah. posisi logo pada logo sekunder ini yaitu dengan arah horizontal. Dimana logogram diletakkan disebelahkiridanlogotypedisebelahkanannya. Dalam penerapannya, logo dalam versi primer lebih diutamakan. penempatan logo primer harus dimaksimalkan dan jika memang kurang sesuai dengan bidang yang dikomposisikan barulah diperbolehkan memakailogosekunder. Versi Sekunder Alternatif posisi GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 3
  14. 14. Logo Sekunder Picturemark Pada perkembangannya, diharapkan pemakaian logo bisa sampai pada aplikasi logo picturemark saja. Yaitu berupa bentuk bulat. Sedangkan pada textmark tidak perlu dipakai. Setelah brand bisa kuat, teringa di pikiran target audiens, barulah logo picturemark ini bisa dipakai. Dengan pemakaian ini diharapkan brand dapat lebih diingatdandapatmenjagaefektivitaslogopadapeng-aplikasiannya. Perlu dilakukan penelitian lanjut mengenai ke-efektivitas logo picturemark ini. Diperlukan juga survei mengenai kekuatan logo dinar kebaya pada perkembangannya. Oleh karena itu, pemakaian logo picturemark ini harus setelah ada keputusan dari perusahaan mengenaikapanbisadipakai.! atau GRAPHIC STANDART MANUAL 4 VERSI LOGO PRIMER & SEKUNDER
  15. 15. KONSEP LOGO DAN TEKS LAMPIRAN (TAGLINE) Berupa bentuk dasar bulat yang didalamnya terdapat bentuk salah satu sayap kupu-kupu. Sayap tersebut membentuk huruf D . Ide untuk mengambil bentuk sayap kupu-kupu dikarenakan Dinar Kebaya ingin ber kembang dan bermetamorfosa dari perusahaan yang kecil menjadi perusahaan yang besar. bentuk bulat sebagai dasarnya yaitu karena Dinar Kebaya memiliki visi untuk memperkenalkan produknya sampai ke ranah International. dari visi tersebut terpikirkanbentukbumi,sebagaitandaglobal. Logogram Logotype Dinar Kebaya berupa text Dinar Kebaya dengan menggunakan jenis huruf barkentina. jenis huruf ini berkesan etnik sehingga cocok dengan karakter Dinar Kebaya. spesialis kebaya & make up adalah taglin euntuk memperjelas identitasperusahaan. Logotype GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 5
  16. 16. KONSEP WARNA Warna logo Dinar Kebaya adalah gradasi dari merah jambu menuju ungu, kemudian ada merah muda pastel disalah satu bagiannya. Merah jambu melambangkan feminim, kewanitaan kemudian ungu mewahsedangkanmerahmudapastelmelambangkananakmuda.secara keseluruhan,warnayangada pada logo ini adalah melambangkan tentang feminim, kewanitaan, anggun, mewah dengan spirit anak muda. warna sekunder untuk logo dinar kebaya yaitu putih, hitam dan silver. Warna ini digunakan untuk kebutuhantertentu(dibahasdibagianberikutnya). Konsep Warna GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 6
  17. 17. C : 38 M : 99 Y : 2 K : 0 R : 169 G : 56 B : 144 C : 9 M : 87 Y : 27 K : 0 R : 221 G : 82 B : 128 WARNA KORPORAT GRAPHIC STANDART MANUAL r kebaya C : 2 M : 26 Y : 0 K : 0 R : 243 G : 200 B : 222 C : 0 M : 0 Y : 0 K : 100 R : 55 G : 52 B : 53 Untuk kebutuhan media cetak dan digital, desain logo dinar kebaya telah dipatenkan agar menjaga konsistensibranddinarkebaya. Warna primer dipakai dalam semua aplikasi media dan atribut perusahaan. kecuali untuk kondisi tertentu logo dinar kebaya diperbolehkan memakai warna sekunder. (dijelaskan di bab warna sekunder) Warna Warna Primer 7
  18. 18. WARNA KORPORAT Warna sekunder dipakai sebagai alternatif dalam kebutuhan desain agar lebih bervariasi dan sesuai dengan estetika dan fungsionalnya. Warna Sekunder Warna Putih Warna putih digunakan pada desain grafis dengan variasi warna warna muda dan pastel. warna logo putih ini ditujukan untuk mendukung kesan muda, bersih dan cerah. penggunaan logo putih dengan background cerah pada prosentasi terntentu agar logo tetap bisa terlihat. warna logo putih ini bisa digunakan seagai alternatif terakhirjikasemuawarnakurangcocokuntukdikomposisikandenganwarnaprimerlogodinarkebaya. Warna Silver Warna silver digunakan pada desain grafis dengan variasi warna yang didominasi putih atau hitam. hal ini bertujuanuntukmemberikesaneleganpadatampilangrafisyangbuat. Warna Hitam Warna hitam bisa difungsionalkan seperti warna putih yang netral yaitu jika warna primer sudah tidak cocok dipakaiuntukkebutuhankomposisiwarnapadatampilangrafis. C : O M : 0 Y : 0 K : 0 R : 255 G : 255 B : 255 C : O M : 0 Y : 0 K : 60 R : 132 G : 134 B : 136 C : O M : 0 Y : 0 K : 100 R : 55 G : 52 B : 53 GRAPHIC STANDART MANUAL 8
  19. 19. MODE SINGLE COLOR WARNA KORPORAT MODE PRIMER MODE GRAYSCALE MODE SINGLE COLOR penambahan line untuk single color logo GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up MODE BLACK & WHITE dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up MODE DOUBLE COLOR dinar kebayaspesialis kebaya & make up MODE DOUBLE COLOR dinar kebayaspesialis kebaya & make up GRAY SINGLE COLOR dinar kebayaspesialis kebaya & make up warna gray single color mulai black 60 sampai 30. 9
  20. 20. BACKGROUND Background dapat menjadi penentuan dalam pemakaian logo. Apakah memakai logo primer atau sekunder. ataukah memakai warna primer atau sekunder. Background yang bervariasi tentunya memiliki pertimbangan- pertimbangansendiridalamaplikasilogo. Positive Reserved Reserved B / W Background foto Background foto Backround logo primer harus warna putih atau abu-abu 10 %. logo black dengan background putih, begitu juga sebaliknya. Background Background sebaiknya menggunakan warna warna yang ada dalam logo primer warna background foto yang cenderung gelap menggunakan logo single color putih, sedangkan warna background yang cenderung cerah menggunakan logo single color hitam. GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 10
  21. 21. BACKGROUND Ornamen khusus ini berupa visualisasi gambar bunga yang sering digunakan untuk bordir dan payet kebaya. Dibuatuntukmemenuhikebutuhangrafistampilanbranddinarkebaya.backgroundinitidakharusselaludipakai, bisa disesuaikan dengan fungsionalnya. namun untuk menjaga konsistensi brand dinar kebaya, sebaiknya setiap mediayangakandipakai,jikamemungkinkanornameninibisadipakaimeskipunhanyasebagaiaksen. Ornamen Khusus! warna ornamen tidak boleh menonjol dari logo atau objek yang ada di atasnya. kecuali ornamen ini ditujukan sebagai wallpaper .! GRAPHIC STANDART MANUAL 11
  22. 22. BACKGROUND Ornamen Khusus! GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 12
  23. 23. BACKGROUND Alternatif Perpaduan Warna GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Warnabackgroundyangdipakaiharussenadasekitarwarnamerahmuda,ungu,danmerahmudapastel.selainitu jika tidak ada pilihan dapat menggunakan warna background putih, abu-abu muda (k:10), hitam, atau foto. foto punharusdenganprosentasegelapterangyangdapatmemudahkanlogotetapterbaca. 13
  24. 24. BACKGROUND Perpaduan Warna yang Salah GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 14
  25. 25. ILUSTRASI Untuk memaksimalkan karakter perusahaan, maka tema ilustrasi dari semua grafis identitas harus seragam Ilustrasi berupa foto dan ornamen korporat ilustrasi dalam bentuk lain kurang diperkenankan diaplikasikan Tema yang Seragam Muda Modern Profesional Feminim 15
  26. 26. UKURAN MINIMAL, CLEARSPACE & GUIDELINES Ukuran logo pada setiap aplikasinya tidak boleh lebih kecil dari ukuran yang telah ditetapkan. Hal ini berguna agar logo tetap dalam proporsi yang baik dan tetap mudahdikenalidanataudibaca. dinar kebayaspesialis kebaya & make up 30 mm 7 mm 22 mm 6.7 mm 4 mm 7 mm 30 mm 16 mm 9 mm 5.5 mm 9.4 mm Untuk ukuran terkecil ini boleh tidak menggunakan tagline. karena kemungkinan akansulituntukdibaca. GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 16 Ukuran standar
  27. 27. UKURAN MINIMAL, CLEARSPACE & GUIDELINES dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up SKALA MINIMAL LOGO 100 % 75 % 60 x 31 mm 45 x 23 mm dinar kebaya 50 % 30 x 16 mm ukuran terkecil maksimal GRAPHIC STANDART MANUAL 17
  28. 28. UKURAN MINIMAL, CLEARSPACE & GUIDELINES SKALA MINIMAL LOGO picturemark 10 x 10 mm ukuran terkecil hanya dapat dipakai untuk picturemark saja diharapkan ukuran ini digunakan dengan baik karena mempengaruhi redibility dari textmark. untuk picturemark masih bisa terlihat walau dalam ukuran terkecil sekalipun. pada penggunaannya kalau bisa tidak sering memakai ukuran terkecil ini. untuk skala maksimal tidak dibatasi sampai ukuran berapapun yang terpenting adalah ukuran dengan skala yang proporsional. GRAPHIC STANDART MANUAL 18
  29. 29. UKURAN MINIMAL, CLEARSPACE & GUIDELINES KONFIGURASI LOGO GRAPHIC STANDART MANUAL 19 x 0.5x 0.5x 4x 2.4x1.7x 12.5x 4x Konfigurasi berfungsi sebagai anatomi logo. Ketetapan konfigurasi simbol dan tulisan identitas menggunakan acuan skala karakter huruf. Satuan karakter yang dipakai dalam skala ini diambil dari komponen huruf 'X
  30. 30. UKURAN MINIMAL, CLEARSPACE & GUIDELINES KONFIGURASI LOGO Konfigurasi berfungsi sebagai anatomi logo. Ketetapan konfigurasi simbol dan tulisan identitas menggunakan acuan skala karakter huruf. Satuan karakter yang dipakai dalam skala ini diambil dari komponen huruf 'X dinar kebayaspesialis kebaya & make up 1.8x 1.9x 1x 1.2x1.2x 8.5 x0.3 x 0.15x 0.18x GRAPHIC STANDART MANUAL 20
  31. 31. x Zona yang bersih atau kosong diciptakan untuk memastikan logo masih menonjol dan tampak jelas. Ruangan yang kosong diukur dengan X. Ruangan kosong di sekitar logo berguna untuk menonjolkan penampilan logo Dinar Kebaya dibandingkan elemen gambar atau lainnya. UKURAN MINIMAL, CLEARSPACE & GUIDELINES CLEARSPACE / AREA KOSONG GRAPHIC STANDART MANUAL 21
  32. 32. Area kosong diberikan disekitar logo dengan skala yang telah ditentukan. Elemen visual lain tidak diperkenankan masuk dalam area ini. Hal ini bertujuan agar tidak mengganggu readibilitas dan estetika logo. UKURAN MINIMAL, CLEARSPACE & GUIDELINES CLEARSPACE / AREA KOSONG GRAPHIC STANDART MANUAL 22 xdinar kebayaspesialis kebaya & make up
  33. 33. UKURAN MINIMAL, CLEARSPACE & GUIDELINES GRIDLINES / GARIS BANTU Gridlines adalah sekumpulan garis bantu yang berfungsi menjaga konsistensi visual logo sehingga pada penerapannya tidak terjadi kesalahan pada proporsi bentuk logo. GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 23
  34. 34. UKURAN MINIMAL, CLEARSPACE & GUIDELINES UKURAN POSISI YANG SALAH GRAPHIC STANDART MANUAL dinar kebaya spesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 24
  35. 35. TYPEFACE Myriad Pro BARKENTINA The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 25
  36. 36. TYPEFACE BARKENTINA Myriad Pro Jenis font ini dipilih karena berkesan etnik dan elegan. Sebagai jenis huruf serif, Barkentina meiliki bentuk yang luwes dan dinamis. Setiap ujung kaitnya juga seperti bentuk sulur yang luwes, sangat cocok dengan karakter perusahaan DinarKebayayangluwesdanterkesanfeminim. Jenis font ini dipilih untuk diaplikasikan pada tagline Dinar Kebaya. bentuk huruf ini tegas dan jelas dibaca, mengimbangi font logo yang terkesan luwes. meskipun jenis huruf ini terkesan tegas namun ukurannya diperkecil untuk menghindarikesan kaku. Penggunaan jenis huruf ini adalah paten / wajib. text mark utama adalah memakaijenishurufini.tidakdiperbolehkanmemakaijenishurufapapun. Penggunaan jenis huruf ini adalah paten / wajib karena sudah disesuaikan dengantextmarkutama. PointdariTextMarkiniadalahReadibilitydansesuaidengankarakterperusahaan yang luwes,elegan,danetnik.Aplikasitextmarkinisesuaidenganperaturanyang sudahdibuat(skala,jarakminimaltepi,dll). ! GRAPHIC STANDART MANUAL 26
  37. 37. Untuk font primer. dianjurkan untuk menggunakan jenis huruf yang berkait (serif). haliniditujukankarenahurufdengankaitakanterlihatluwes. FontPrimeryangdigunakanmisalnya: FONT PRIMER Selainfontuntuklogo.Terdapatjugapanduanuntukfont yangdiaplikasikandalamsemuamediaDinarKebaya yangmenggunakanhuruf. Untuk font sekunder bisa menggunakan jenis huruf tanpa kait (san serif). pemakaian font sekunder ini dipakai ketika font primer dirasa kurang cocok dengan halyangakandiaplikasikan.Namunpenggunaanfont primertetapdiutamakan. FontSekunderyangdigunakanmisalnya: FONT SEKUNDER Times New Roman Californan FB Adobe Hebrew dll. meskipun terdapat banyak pilihan, namun sebagai panduan, huruf serif yang digunakan harusreadibility. TYPEFACE Franklin Gothic Kozuka Gothic Pr6N M Browallia New dll. Selain jenis huruf yang dicontohkan, dianjurkan tidak terlalu jauh beda dengan jenis huruf yang dicontohkan. GRAPHIC STANDART MANUAL 27
  38. 38. spectacular event @ MOG 22 -24 Juni 2013 rias pengantin paket wisuda spesialis kebaya prawedding FONT PRIMER Paket Wisuda + Foto Wisuda dinar kebayaspesialis kebaya & make up FONT SEKUNDER contoh penggunaan jenis huruf serif sehingga lebih berkesan luwes dan mendukungnuansaklasik. contoh penggunaan jenis huruf san serif membuat kesan yang tegas dan moderen. Dinar Kebaya tidak harus berkesan klasik dan etnik, bisa juga berkesan moderen tetapi tetap harus dicantumkanlogo. Dalam setiap media yang digunakan Dinar Kebaya, tidak harus selalu berkesan etnik dan klasik karena Dinar Kebaya sendiri juga memiliki karakter moderen dan dinamis. Atau perpaduan dari keduanya karena Dinar Kebaya adalah industri kreatif yang bergerak dibidangmodifikasiKebayamoderen. TYPEFACE ! GRAPHIC STANDART MANUAL 28
  39. 39. TYPEFACE. PENERAPAN FONT YANG SALAH dinar kebaya s p e s i a l i s k e b a y a & m a k e u p dinar kebayaspesialis kebaya & make up DINAR KEBAYAspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up GRAPHIC STANDART MANUAL 29
  40. 40. PENERAPAN FONT YANG SALAH K e b a y a a d a l a h b l u s tradisional yang dikenakan oleh wanita Indonesia yang terbuat dari bahan tipis yang dikenakan dengan sarung, batik, atau pakaian rajutan tradisional lainnya seperti songket dengan motifwarna-warni. Mengenai Dinar Kebaya Kebaya adalah blus t r a d i s i o n a l y a n g dikenakan oleh wanita Indonesia yang terbuat dari bahan tipis yang d i k e n a k a n d e n g a n sarung, batik, atau p a k a i a n r a j u t a n tradisional lainnya seperti songket dengan motif warna-warni. Mengenai Dinar Kebaya Kebaya adalah blus t r a d i s i o n a l y a n g dikenakan oleh wanita Indonesia yang terbuat dari bahan tipis yang d i k e n a k a n d e n g a n sarung, batik, atau p a k a i a n r a j u t a n tradisional lainnya seperti songket dengan motif warna-warni. Mengenai Dinar Kebaya bentuk font terlalu kaku font ini memberi kesan anak-anak. tidak sesuai dengan karakter perusahaan kerterbacaan kurang! ! ! TYPEFACE GRAPHIC STANDART MANUAL 30
  41. 41. dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up CO BRANDED LOGOS CO BRANDED LOGOS. Logo dengan text mark Posisi co-brandedlogodisertai textmarkdantagline. Spasi minimum (jarak terdekat) antar logo mengacu pada 1/4 rataratapanjang logo. Hal ini juga diterapkan jika co-branded logodisusunsecaravertikal. ASDFGQWERTY z ASDFGQWERTY z Spasi Minimum A B A B 1/4 [(A=B):2] GRAPHIC STANDART MANUAL 31
  42. 42. Z CO BRANDED LOGOS. Logo dengan text mark CO BRANDED LOGOS Z Posisico-brandedlogotanpatextmarkdantagline. logoDinarKebayadanLogolainmemilikiukuranyangsama. Sedangkan spasi antar logo mengacu pada panjang dan lebar masing-masinglogo. GRAPHIC STANDART MANUAL 32
  43. 43. TARGET PENEMPATAN LOGO Jika logo disertai tagline dan text mark, maka ukuran logo serta batas dengan ukuran area yang telah ditentukan mengacu pada Clean area logo. mengenai skala ukuran logo sudah dijelaskan di penjelasan skala minimal,dll.haliniberlakuuntuksemuaukuranApaper. area margin clear space ukuran A Paper Target Penempatan Logo GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 33
  44. 44. TARGET PENEMPATAN LOGO AreaselainA Paper,tetapmenggunakanacuanskalalogodanclearspacearea. tidak dianjurkan memakai area bidang non geometris / tidak beraturan! GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 34
  45. 45. TARGET PENEMPATAN LOGO Penempatan Logo yang tidak sesuai clear space keluar area clear space masuk ke dalam area margin tidak menghiraukan clear space dan area margin GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 35
  46. 46. Penempatan Logo yang tidak sesuai TARGET PENEMPATAN LOGO GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 36
  47. 47. LOGO 3D Logo dalam bentuk tiga dimensi GRAPHIC STANDART MANUAL 37
  48. 48. Media & Aplikasi
  49. 49. STATIONERY AND ADMINISTRATIVE Letterheads kop surat untuk Dinar Kebaya dibagi menjadi dua pilihan. yaitu untuk kertas berukuran A4 dan ukuran F4. untuk ukuran A4 alamat di letakkan diatas kop surat. sedangkan untuk ukuran F4 diletakkan diibawah. Untuk pemakaian disesuaikan dengan kebutuhan. jika membutuhkan space yang banyak dapat menggunakan ukuran F4. GRAPHIC STANDART MANUAL 38
  51. 51. STATIONERY AND ADMINISTRATIVE Envelopes ukuran 23 x 11.5 cm alamat selalu dibelakang amplop dengan font lucida bright label ditempelkan disini alamat & kontak d : 2.5 cm 1.2 cm1.2 cm 2.6 cm 0.6 cm 10 cm 2.5 cm 1.5 cm 3.5 cm 1 cm 3 cm 2.5 cm dinar kebayaspesialis kebaya & make up 7 cm 5.5 cm2 cm GRAPHIC STANDART MANUAL 40
  52. 52. STATIONERY AND ADMINISTRATIVE Business Card centre GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 email : f : Name Position Contact Person 1.6 cm 3 cm 1 cm 1.5 cm dinar kebayaspesialis kebaya & make up 4 cm 2 cm promotion 3 cm 3.5 cm 3.5 cm 3.5 cm 2 cm 1 cm1 cm ukuran 9 x 5.5 cm BELAKANGDEPAN Kartu nama 2 sisi (eksklusif) sisi belakang dapat digunakan untuk promo. untuk kartunama eksklusif harus memakai laminasi dof GRAPHIC STANDART MANUAL 41
  53. 53. dinar kebayaspesialis kebaya & make up GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 email : f : 0.5 cm 1.3 cm 1.5 cm 0.5 cm Nama Jabatan Contact Person 1 cm 0.7 cm 1.5 cm 1.5 cm 1.5 cm 5 cm 2.5 cm 2.5 cm1 cm Kartu nama 1 sisi ukuran 9 x 5.5 cm STATIONERY AND ADMINISTRATIVE Business Card GRAPHIC STANDART MANUAL 42
  54. 54. STATIONERY AND ADMINISTRATIVE ukuran 21 x 29.7 cm Fax Cover Sheet dinar kebayaspesialis kebaya & make up 1.5 cm 1.5 cm 2.6 cm 5 cm 2.5 cm2.5 cm FAXCOVER SHEET To : Company : Fax : Phone : Pages : From : Fax : Phone : NOTES: 3 cm GRAPHIC STANDART MANUAL 43
  55. 55. STATIONERY AND ADMINISTRATIVE Note pads ukuran A5 dinar kebayaspesialis kebaya & make up 1.8 cm 2 cm 1.5 cm 3.5 cm uk. 10.5 x 14.8 cm notes ...... , .......................... Jl. Soekarno Hatta 2B - Malang 65141 Telp. 0341 - 5446071 / 081803813154 space untuk lem 0.7 cm 0.8 cm 1.3 cm 0.8 cm 0.7 cmSampul Isi GRAPHIC STANDART MANUAL 44
  56. 56. STATIONERY AND ADMINISTRATIVE Bills isi depan GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur Telp. 0341 - 5446071 / 081803813154 email : dinar kebayaspesialis kebaya & make up Nota pembayaran 0.6 cm 0.8 cm 2.1 cm 1.4 cm 8.3 cm 3.1 cm 1.1 cm 4 cm 0.9 cm 3.9 cm 0.4 cm 1 cm 5.5 cm Nota/ bill uk. 10.5 x 16.4 cm GRAPHIC STANDART MANUAL 45
  57. 57. STATIONERY AND ADMINISTRATIVE Mailing Label Kepada : text 0.8 cm Ny. Mutiara Larasati Jl. Wijayakusuma, Tegal mindi, Sinduadi, Sleman, Yogyakarta 54451 Kepada : centre text Mailing label uk. 6.7 x 3.2 cm GRAPHIC STANDART MANUAL 46
  58. 58. STATIONERY AND ADMINISTRATIVE Presentation Slide dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Produk Kami ukuran disesuaikan dengan kebutuhan secara garis besar ada tiga macam style yang dapat digunakan. background putih background full warna korporat, dan background ornament. dianjurkan untuk memakai ornament dan abstrak bentuk logo untuk memperkuat identitas perusahaan. contoh aplikasi dengan konten GRAPHIC STANDART MANUAL 47
  59. 59. WEB SITES Web Sites tampilan interface yang simple. mengutamakan foto. dinar kebayaspesialis kebaya & make up artikel spoiler dinar kebayaspesialis kebaya & make up Make Up Home Profile Gallery Contact dinar kebayaspesialis kebaya & make up Home Profile Gallery Contact dinar kebayaspesialis kebaya & make up photo menu menu menu menu Dinar Kebaya adress menu menu menu menu Dinar Kebaya adress text Template desain website Contoh aplikasi desain website GRAPHIC STANDART MANUAL 48
  60. 60. PR / IR COMMUNICATIONS Press Kit Folder dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, JawaTimur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail 49 CM 22 CM 5 CM 34 CM map tampak luar dilipat kedalam GRAPHIC STANDART MANUAL 49
  61. 61. PR / IR COMMUNICATIONS Press Kit Folder dinar kebayaspesialis kebaya & make up 9 CM map tampak dalam rongga untuk menyelipkan kartunama GRAPHIC STANDART MANUAL 50
  62. 62. PR / IR COMMUNICATIONS Press Kit Folder dinar kebayaspesialis kebaya & make up center 11 cm 21 cm 3.2 cm 2.3 cm center ilustrasi text text text brosur 2 sisi GRAPHIC STANDART MANUAL 51
  63. 63. PR / IR COMMUNICATIONS Certificate dinar kebayaspesialis kebaya & make up Certificateof ........................ This is to certify that name position .............., area alamat dan kontak Dinar Kebaya ukuran 29.7 x 21 cm 10 x 4 cm GRAPHIC STANDART MANUAL 52
  64. 64. PR / IR COMMUNICATIONS Press Kit Folder CD case dinar kebayaspesialis kebaya & make up area alamat dan kontak Dinar Kebaya GRAPHIC STANDART MANUAL 53
  65. 65. PR / IR COMMUNICATIONS Press Kit Folder 13 cm 13 cm 6,5 cm 1,5 cm 13 cm dinar kebayaspesialis kebaya & make up CD case & label GRAPHIC STANDART MANUAL 54
  66. 66. PR / IR COMMUNICATIONS Press Kit Folder leaflet uk. A6 1 sisi (10.5 x 14.8 cm) ilustration text text text ilustration GRAPHIC STANDART MANUAL 55
  67. 67. HR Communications Recruitmen Ad Format Open Recruitmen sebagai karyawati di Dinar Kebaya dengan syarat : wanita 18- 30 tahun berpenampilan menarik keterampilan tata rias & busana diutamakan Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail dinar kebayaspesialis kebaya & make up Kirim lamaran ke : dinar kebayaspesialis kebaya & make up 21 cm 23 cm 2.5 cm 3.2 cm 2.3 cm text contoh aplikasi template GRAPHIC STANDART MANUAL 56
  68. 68. FACILITIES SIGNS Building Signage dinar kebayaspesialis kebaya & make up Building Signage dibagi menjadi dua macam, yaitu neon box dan channel letter. ukuran menyesuaikan bangunan dengan skala yang proporsional dengan logo. building signage sangat penting untuk menandai bahwa bangunan atau tempat tertentu adalah galery atau butik dinar kebaya. ukuran menyesuaikan dengan skala proporsional GRAPHIC STANDART MANUAL 57
  69. 69. FACILITIES SIGNS Building Signage dinar kebaya spesialis kebaya & make up NEON BOX Berupa print backlight dengan lampu dari dalam. jika memakai bahan stiker maka bahan background dari neon box dengan logo memakai warna blok (bukan gradasi). namn lebih diutamakan jika menggunakan logo gradasi. GRAPHIC STANDART MANUAL 58
  70. 70. FACILITIES SIGNS Building Signage dinar kebayaspesialis kebaya & make up VARIASI GRAFIS NEON BOX Neon Box bisa ditambahkan dengan background ornament namun tidak bertumpuk dengan logo. logo harus selalu dengan background putih untuk building signage. tidak diperkenankan menambah apapun pada background kecuali ornament yang telah di contohkan diatas. bila ada promo atau unsur image lain dapat menggunakan media yang terpisah dari building signage ini. hal ini bertujuan untuk menjaga tanda identitas gallery atau butik dinar kebaya Penggunaaan channel letter hany pada logo, sedangkan background tetap dengan print backlight. GRAPHIC STANDART MANUAL 59
  71. 71. FACILITIES SIGNS Building Signage ALTERNATIF SIGNAGE Bentuk signage seperti disamping dapat diaplikasikan bila signage building yang dijelaskan sebelumnya menempati posisi yang kurang bisa dilihat oleh publik. misalkan antara butik dengan jalan raya terlalu jauh. hal-hal lain dapat menjadi pertimbangan untuk dapat menggunakan alternatif signage ini. logo tetap harus dengan background putih neon box tembok dinar kebayaspesialis kebaya & make up alamat website ilustrasi 95 cm 112 cm 51 cm 40 cm 240 cm 130 cm GRAPHIC STANDART MANUAL 60
  72. 72. FACILITIES SIGNS Building Signage CHANNEL LETTER Ketebalan huruf menyesuaikan dengan huruf. warna yang ada disamping harus sama dengan warna yang didepannya. lampu bisa dtempatkan di didalam huruf. dinar kebaya spesialis kebaya & make up dinar kebaya spesialis kebaya & make up dd GRAPHIC STANDART MANUAL 61
  73. 73. FACILITIES SIGNS Umbul-umbul dinar kebayaspesialis kebaya & make up Spesialis Make Up dan Kebaya dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Bentuk yang diperbolehkan panjang : 3.5 m lebar : menyesuaikan GRAPHIC STANDART MANUAL 62
  74. 74. VEHICLE Car Branding Daihatsu Gran Max panjang = 4,045 mm, tinggi = 1,900 (with tires) mm WiFi dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Lampu Lampu N 1111 ilustrasi logo text promo GRAPHIC STANDART MANUAL 63
  75. 75. N 1111 Lampu Lampu dinar kebayaspesialis kebaya & make up Lampu Lampu N 1111 kebaya selalu membuat Anda Cantik! jika Anda tahu bagaimana menemukannya KONSULTASIKAN DESAIN BA JU KEBAYA ANDA TERLEBIH DAHULU, KAMI AKAN MEMBERIK AN YANG TERBAIK dinar kebayaspesialis kebaya & make up contoh aplikasi untuk konten VEHICLE Car Branding Daihatsu Gran Max panjang = 4,045 mm, tinggi = 1,900 (with tires) mm GRAPHIC STANDART MANUAL 64
  76. 76. MARKETING SALES Brochures (Pricelist) text ilustrasi dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up text text text ukuran 21 x 33 cm GRAPHIC STANDART MANUAL 65
  77. 77. MARKETING SALES Brochures (Pricelist) GAYATRIpackage Gayatri I 7 Juta Gayatri II 10 Juta Make Up Pengantin Hijab / Hairdo Akad Resepsi 2 Sepasang Kebaya Ibu Dan Besan Make Up + Sanggul / Hijab (akad) Make Up + Sanggul / Hijab (resepsi) Bapak Dan Besan Basofi / Beskap (resepsi) Kembar Mayang 2 Make Up + Sanggul / Hijab + Kebaya 2 Basofi / Beskap Remaja Putra Mc Akad Resepsi Dekor Akad Nikah BONUS PERAWATAN PREWEDDING Make Up Pengantin Hijab / Hairdo Akad Resepsi 2 Sepasang Kebaya Ibu Dan Besan Make Up + Sanggul / Hijab (akad) Make Up + Sanggul / Hijab (resepsi) Bapak Dan Besan Basofi / Beskap (resepsi) Kembar Mayang 2 Make Up + Sanggul / Hijab + Kebaya 2 Basofi / Beskap Remaja Putra pricelist/peritem MAHISApackage TRIBUANApackage GAYATRIipackage dinar kebayaspesialis kebaya & make up Price List Packages Wedding & PACKAGE PACKAGE PACKAGE PACKAGE dinar kebayaspesialis kebaya & make up TEXT ILUSTRASI UK. 15 X 19 cm contoh dengan konten GRAPHIC STANDART MANUAL 66
  78. 78. MARKETING SALES Poster/ Print Ad ilustrasi foto head text & keterangan alamat & kontak logo komposisi GRAPHIC STANDART MANUAL 67
  79. 79. MARKETING SALES Poster/ Print Ad GRAPHIC STANDART MANUAL 68 ukuran A3. konten poster hanya sebagai contoh Paket Wisuda gratis foto wisuda Desain dan Jahit Kebaya, Traditional & Modern Make up, Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin, Foto & Shooting, Dekorasi Dll GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 email : dinar kebaya @dinarkebaya dinar kebayaspesialis kebaya & make up ilustrasi foto model kebaya dengan background putih atau abu-abu ilustrasi foto model kebaya dengan background putih atau abu-abu alamat Dinar Kebaya dan kontak logo diatas
  80. 80. MARKETING SALES Poster/ Print Ad GRAPHIC STANDART MANUAL 69 ukuran A3. alternatif layout. konten poster hanya sebagai contoh Wedding Exhibition dinar kebaya gracia wedding organizer p r e s e n t tata rias dan busana pengantin, bridal, wedding documentation, decoration, wedding organizer, dll (all about wedding) 5-7 September, Grand Hall MATOS DAPATKAN UNDIAN SEPASANG CINCIN BERLIAN DAN TIKET HONEYMOON KE BALI CONTACT : Gracia WO 081803888222 Dinar Kebaya 0341 5446071 dinar kebaya Gracia ilustrasi foto model kebaya dengan background putih atau abu-abu 29.7 cm 11 cm 3.5 cm 10.5 cm 42cm head text memakai jenis huruf yang berbeda dengan keterangan keterangan alamat Dinar Kebaya dan kontak
  81. 81. MARKETING SALES Banner / Spanduk Head Text dinar kebayaspesialis kebaya & make up sub keterangan alamat dan kontak Dinar Kebaya keterangan Paket Wisuda Gratis Foto Wisuda! dinar kebayaspesialis kebaya & make up Desain dan Jahit Kebaya, Traditional & Modern Make up, Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin, Foto & Shooting, Dekorasi Dll GRAHA UTERO SOEKARNO HATTA 2B - Malang 0341 - 5446071 / 081803813154 contoh aplikasi template dan komposisi banner uk. 2 x 1 m (ukuran dapat diubah namun tetap proporsi) template banner ilustrasi GRAPHIC STANDART MANUAL 70
  82. 82. dinar kebayaspesialis kebaya & make up Wedding Package (Mahisa,Tribuana,Gayatri) Desain dan Jahit Kebaya, Traditional & Modern Make up, Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin, Foto & Shooting, Dekorasi Dll GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Telp. 0341 - 5446071 / 081803813154 dinar kebayaspesialis kebaya & make up Head Text keterangan sub keterangan ilustrasiilustrasi alamat dan kontak Dinar Kebaya template banner/ spanduk contoh aplikasi template dan komposisi banner uk. 4 x 1 m (ukuran dapat diubah namun tetap proporsi) MARKETING SALES Banner / Spanduk GRAPHIC STANDART MANUAL 71
  83. 83. MARKETING SALES X banner dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Text Text ilustration Text Text center ilustration Text uk. 60 x 160 cm GRAPHIC STANDART MANUAL 72
  84. 84. IDENTITY INTRODUCTION Seragam Karyawan Seragam Formal. seragm ini dipakai untuk acara formal. bawahan berupa rok batik. Bordir penambahan bros GRAPHIC STANDART MANUAL 73
  85. 85. IDENTITY INTRODUCTION Seragam Karyawan Seragam Semi formal berupa blazer yang bisa dipadupadankan dengan baju lain. dapat memakai bawahan rok ataupun celana. warna bawahan yang digunakan meliputi warna yang senada dengan blazer, hitam, atau bisa juga dengan memakai jeans. Memakai warna lain tidak diperbolehkan karena dapat mengganggu kejelasan identitas Dinar Kebaya. Bordir Bros GRAPHIC STANDART MANUAL 74
  86. 86. IDENTITY INTRODUCTION dinar kebayaspesialis kebaya & make up dapat dipakai oleh karyawan ketika dalam suasana santai dan bekerja sehari hari. Seragam Karyawan GRAPHIC STANDART MANUAL 75
  87. 87. IDENTITY INTRODUCTION Merchandise / Gifts BROS d: 2 cm d: 2 cm khusus bros boleh memakai warna emas/ warna dari bahan d: 3 cm bahan akrilik bening dinar kebayaspesialis kebaya & make up uk: 5 x 1.5 cm GANTUNGAN KUNCI GRAPHIC STANDART MANUAL 76
  88. 88. IDENTITY INTRODUCTION Merchandise / Gifts dinar kebayaspesialis kebaya & make up Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail dinar kebayaspesialis kebaya & make up Paper Bag GRAPHIC STANDART MANUAL 77
  89. 89. IDENTITY INTRODUCTION Merchandise / Gifts dinar kebayaspesialis kebaya & make up MUG / Gelas Bolpoin diameter logo: 8 cm uk : 4 x 0.9 cm uk : 4 x 0.9 cm GRAPHIC STANDART MANUAL 78
  90. 90. IDENTITY INTRODUCTION Kaos dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up depan belakang GRAPHIC STANDART MANUAL 79
  91. 91. IDENTITY INTRODUCTION Hanger Baju dinar kebaya dinar kebayaspesialis kebaya & make up dinar kebaya 80 cm 16 cm 30 cm GRAPHIC STANDART MANUAL 80
  92. 92. 1.5 x 1.5 cm dinar kebaya 3 x 1 cm dinar kebaya 3 x 1.5 cm baju kebaya baju kebaya IDENTITY INTRODUCTION Label baju GRAPHIC STANDART MANUAL 81
  93. 93. Demikianpenjelasan GraphicStandardManualDinarKebaya. Hal ini tidak akan dapat banyak manfaat kecuali dengan penerapan yang baik dan sesuai. Semoga dengan adanya logo baru Dinar Kebaya ini dapat memberikan semangat kerja bagi karyawansecarapersonal,sertapihak-pihakyangmendukungperusahaanDinarKebaya. Visi perusahaan untuk bertandang di kancah global tidaklah tidak mungkin karena dengan tekad yang kuat dan terus berproses berkembang maju, Dinar Kebaya dapat sukses menggapai visi perusahaan. Pada penerapan media, masih banyak media yang belum dicantumkan pada GSM ini karena media terus berkembang. Namun, benang merah dari acuan media aplikasi corporate identity Dinar Kebaya adalah muda, modern, feminim. Aspek-aspek dari penataan yang baik sesuai denganmediajugaperludiperhatikan. Sukses untuk Dinar Kebaya! PENUTUP
  94. 94. Alamat : GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 branch office : Jl. Aris Munandar no. 105 Malang Telp - 0341 - 7588833 appoinment at 08133309191 email : f : dinar kebayaspesialis kebaya & make up Corporate Identity Design by: Naila Conita email: @2014 woman own ” ”
  95. 95. dinar kebayaspesialis kebaya & make up
