Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

Volume 1 Nomor 16, Januari 2018

39 views

Published on

Jurnal Teknosains

Published in: Engineering
  • Be the first to comment

  • Be the first to like this

Volume 1 Nomor 16, Januari 2018

  1. 1. Bismillahirrahmanirrahim Assalamu’alaikum Wr. Wb. Dengan puji syukur ke hadirat Allah swt. dan salawat serta salam kepada Junjungan Nabi Besar Muhammad saw., terima kasih ke- pada semua pihak yang telah membantu terbitnya jurnal Tekno- sains edisi Januari 2018 ini. Banyak kendala yang dihadapi dalam proses pembuatan jurnal ilmiah edisi ini, akan tetapi dengan dukungan rekan dosen dan lembaga maka jurnal edisi ini dapat hadir. Pada edisi ini memuat 5 (lima) judul artikel salah satunya membahas: Analisa Kerusakan Crankshaft yang Disebabkan Kebocoran Air (Water) dari Flexible Muffler. Harapan redaksi, dengan terbitnya jurnal ilmiah ini akan menciptakan nuansa ilmiah di lingkungan STTM Cileungsi, serta jumlah judul dan kualitas jurnal dapat ditingkatkan. Kepada pembaca kami harap berkenan memberikan masukan, kritik dan saran untuk kemajuan jurnal ilmiah ini di masa mendatang. Semoga jurnal ilmiah ini memberikan manfaat kepada kita semua, amin. Billahitaufik walhidayah, Wassalamu’alaikum Wr. Wb. Redaksi DAFTAR ISI Analisa Kerusakan Crankshaft yang Disebabkan Kebocoran Air (Water) dari Flexible Muffler Wilarso S.T, Pamuji Agustiar Keahlian Bidang Mechanical 3D CAD/CAE/CAM sebagai Alat Daya Saing Memasuki Dunia Enjinering dan Manufakturing Asep Dharmanto, S.T, MT, Wilarso, S.T Perancangan Pressure Vessel Air Receiver Tank 25m³ Vertical Ucok Mulyo Sugeng, Tahi Manurung, Muhamad Ridwan Pendekatan Metode RWL (Recommended Weight Limit) untuk Mengukur Beban Kerja Pengangkatan/ Handling Manual di Mesin Stamping Suwaryo Nugroho Rekayasa Meningkatkan Efektifitas Mesin Die Casting dengan Menggunakan Perhitungan Oee (Overall Equipment Effectiveness) di PT ABCD Susiyanti Nurjanah, Miftahul Imtihan, Suwaryo Nugroho .......... 3 ........ 16 ......... 33 ........ 50 ........ 71 Diterbitkan Oleh: Lembaga Penelitian dan Pengabdian Kepada Masyarakat Sekolah Tinggi Teknologi Muhammadiyah - Cileungsi Alamat Redaksi: Jl.Anggrek I No 86 Perum PT.Semen Cibinong Cileungsi 16820 Telpon : 021-82495502 Fax: 021- 82495502, Website : www.sttmcileungsi.ac.id, e-mail : sttmcls.04@gmail.com Pembina & Pelindung Ketua STT Muhammadiyah Pemimpin Umum/Penanggung Jawab Ir. Awang Surya, M.M Dewan Penyunting Prof. Ir. Amiral Azis, MSc (BPPT) Prof. Abdul Malik Dewan Redaksi Ir. Firmansyah Azharul, MT Ir Suroso, MT Pamuji Agustiar, ST Kristanto Mulyono, ST Djoko Nusanto, S.Pd., MT Ashari Imamudin,S.Kom.,M.Kom Miftahul Imtihan, ST Pria Sukamto, S.Kom., M.kom Aswin Domodite, ST., M.Eng Nafan Suwito, ST Editor Hilman Solih, ST M. Anas Sobarnas, ST Suwaryo Nugroho, ST., MT Sekretaris Redaksi M. Ajiz Husain, ST Susiyanti Nurjanah, ST Tata Letak (Layout) Drs. Slamet Abadi Desain Grafis Agus Sofyan
  2. 2. 3Jurnal Ilmiah Teknosains Volume 1 Nomor 16 ANALISA KERUSAKAN CRANKSHAFT YANG DISEBABKAN KEBOCORAN AIR (WATER) DARI FLEXIBLE MUFFLER Wilarso, S.T Staff Pengajar STTM Cileungsi (wilarso09@gmail.com) Pamuji Agustiar Staff Pengajar STTM Cileungsi (agustiarpamuji@yahoo.com) ABSTRAK Aliran fluida dalam engine berfungsi untuk menyerap panas yang dihasilkan oleh proses pembakaran, proses pelumasan setiap engine mempunyai sistem pendingin, dimana sistem ini adalah alur sirkulasi fluida dalam engine itu sendiri. Fluida cair adalah media yangbaikuntukmenyerappanasdandidalamenginefluidatertutup di semua komponen yang dilaluinya, agar fluida tidak boleh bocor kemana-mana. Dengan kondisi sealing di semua sisi, fluida mengalir sesuai dengan aliran yang dilaluinya. Jika terjadi kebocoran di ruang bakar akan mengakibatkan kerusakan yang cukup fatal pada engine itu sendiri. Pada saat fluida berada di ruang bakar akan mempengaruhi pergerakan piston, dimana dalam dudukan piston terdapat liner. Pergerakan piston pada saat posisi titik mati atas maupun titik mati bawah di antara piston dan liner terdapat pelumasan. Fungsi pelumas ini adalah melumasi pergerakan piston dan liner supaya tidak terjadi gesekan yang akan merusak piston dan liner. Sementara itu, air (water) yang berada di ruang bakar akan membuat piston jammed (stuck) dan bisa mengakibatkan hidrolik lock pada piston. Kebocoran air di ruang bakar biasanya berasal dari celah di antara flexible muffler dengan adapter bellow, karena tidak kencangnya proses pemasangan baut flexible mufler sehingga air mudah mengalir melalui adapter bellow. Kata Kunci: Engine, Air (water), ruang bakar, hidrolick lock.
  3. 3. 4Jurnal Ilmiah Teknosains Volume 1 Nomor 16 1. PENDAHULUAN 1.1. Latar Belakang Sistem pendingin pada mesin diesel (cooling system) menggunakan media air (water) yang baik untuk menyerap panas berasal dari engine.Airyangberadadidalamcylinderblockmaupuncylinderhead tertutup rapat sehingga tidak bocor ke tempat yang lain, kecuali terjadi kerusakan pada komponen cylinder block, cylinder head atau di antara cylinder head dan cylinder block (korosi pada spacer plate atau kerusakan pada seal ferrule). Komponen yang dilewati oleh air sesuai dengan fungsinya, seperti: Oil cooler, after cooler, cylinder block, cylinder head. Bagian yang dibatasi diantaranya: 1. Di bagian luar liner terdapat air dan dibagian atas maupun bawahnya terdapat seal. 2. Di antara cylinder block dan cylinder head aliran air yang menuju ke cylinder head dibatasi dengan seal ferrule. Prinsip dasarnya, air mengalir dari permukaan yang tinggi ke permukaan yang lebih rendah. Apa yang terjadi jika air tersebut masuk ke ruang bakar, efeknya air berada di ruang bakar tersebut akan mengakibatkan kerusakan yang cukup besar. Adapun prinsip kerja dari sistem pendingin engine adalah mensirkulasikan cairan pendingin atau coolant ke seluruh bagian engine untuk menyerap panas yang dihasilkan oleh pembakaran dan gesekan dengan memanfaatkan perpindahan panas. Jika air berada di ruang bakar, maka kinerja pergerakan piston, liner, conrod, crankshaft engine akan terganggu, akibatnya usia engine akan lebih pendek serta berpengaruh terhadap biaya perbaikan dan lamanya perbaikan. Air berada di ruang bakar bisa melalui: 1. Adapter tidak fit terhadap plate bellow (external factor). 2. Flexible muffler tidak tertutup rapat. 3. Cylinder head crack (internal factor). 4. Aftercooler bocor.
  4. 4. 5Jurnal Ilmiah Teknosains Volume 1 Nomor 16 1.2. Tujuan dan Pokok Permasalahan Menganalisa kerusakan komponen crankshaft yang disebabkan terkontaminasi oleh air (water): a. Menganalisa kebocoran air di ruang bakar b. Menentukan penyebab kebocoran air c. Menentukanlangkahperbaikanterhadappermasalahan yang terjadi. • Menganalisa karat pada adapter dan bellow Karat yang terdapat pada adapter dan bellow disebabkan adanya air, penutupan adapter dan bellow yang tidak proper serta baut yang tidak lengkap akan mempengaruhi torque antara adapter dan bellow. Sehingga pada saat hujan air akan mengalir di antara adapter dan bellow. Air dari adapter mengalir ke exhaust manifold --> ruang bakar (membuat karat di liner), --> air mengalir ke menuju connecting rod --> crankshaft, sehingga air menciptakan karat pada crankshaft. • Menentukan penyebab kerusakan yang diakibatkan oleh karat Watermarks pada crankshaft diakibatkan oleh kontaminasi air dengan kondisi unit stanby. Unfitted penutupan adapter dan bellow dapat mengakibatkan air mengalir ke ruang bakar dan menuju crankshaft. 1.3. Batasan Masalah Mengetahui kerusakan yang terjadi pada komponen crankshaft pada mesin diesel 3516 TA, sehingga kerusakan-kerusakan bisa diminimalisasi. Parameter yang diperlukan adalah: a. Fungsi kerja crankshaft b. Flow aliran fluida air (water) pada sistem engine
  5. 5. 6Jurnal Ilmiah Teknosains Volume 1 Nomor 16 c. Analisa kerusakan. Menganalisa kerusakan komponen pada mesin diesel yang disebabkan adanya air pada ruang bakar: 1.4. Metode Penelitian Metode penelitian ini adalah sebagai berikut: a. Identifikasi masalah b. Pengumpulan data (sistem pembangkit, rencana operasi atau produksi tahunan, strategi dan rencana pemeliharaan tahunan, histori kerusakan, strategi tindakan perbaikan, dst. c. Studi literatur d. Analisa 2. LANDASAN TEORI 2.1. Definisi Fluida Fluida adalah zat yang selalu berubah bentuk secara terus menerus bila terkena tegangan geser. Bentuk fluida yang kita kenal yaitu cair dan gas. Fluida cair mempunyai sifat inkompresibel. Pada fluida cair tidak akan mengalami perubahan bentuk atau volume apabila mendapatkan gaya tekan. Sedangkan pada benda padat, gaya geser menyebabkan terjadinya perubahan bentuk atau deformasi statis. Akan tetapi baik fluida viskositas encer maupun kental akan mengalami pergerakan antara satu bagian terhadap bagian lainnya bila ada gaya geser yang bekerja padanya. Jadi, dapat dikatakan bahwa fluida tidak dapat menahan gaya geser. Karat merupakan hasil korosi, yaitu oksidasi suatu logam. Besi yang mengalami korosi membentuk karat dengan rumus Fe2 O3 .xH2 O. Korosi atau proses pengaratan merupakan proses elektrokimia. Pada proses pengaratan, besi (Fe) bertindak sebagai pereduksi dan oksigen (O2) yang terlarut dalam air bertindak sebagai pengoksidasi. Persamaan reaksi pembentukan karat
  6. 6. 7Jurnal Ilmiah Teknosains Volume 1 Nomor 16 sebagai berikut: Anode: Fe(s) --> Fe2+ (aq) ) 2e Katode: O2 (g) + 4H+ (aq) + 4e --> 2H2 O(l) Karat yang terbentuk pada logam akan mempercepat proses pengaratan berikutnya. Oleh sebab itu, karat disebut juga dengan autokatalis. Mekanisme terjadinya korosi adalah logam besi yang letaknya jauh dari permukaan kontak dengan udara akan dioksidasi oleh ion Fe2+ . Ion ini larut dalam tetesan air. Tempat terjadinya reaksi oksidasi di salah satu ujung tetesan air ini disebut anode. Elektron yang terbentuk bergerak dari anode ke katode melalui logam. Elektron ini selanjutnya mereduksi oksigen dari udara dan menghasilkan air. Ujung tetesan air tempat terjadinya reaksi reduksi ini disebut katode. Sebagian oksigen dari udara larut dalam tetesan air dan mengoksidasi Fe2+  menjadi Fe3+ yang membentuk karat besi (Fe2 O3 .H2 O). Mesin diesel 3516 merupakan tipe engine 4 langkah yakni langkah hisap (intake), langkah kompresi (compression), langkah kerja (power) dan langkah buang (exhaust). Setiap langkah piston membutuhkan pergerakan 1800 dari putaran poros engkol, sehingga satu kali siklus penuh dari langkah hisap sampai menghasilkan kerja menjadi 7200 . Setiap langkah masing-masing memiliki peranan sangat penting dalam proses pembakaran yang diperlihatkan pada gambar 2.2. Pada langkah hisap (intake cycle), pergerakan piston ke bawah diikuti katup hisap (intake valve) terbuka, sementara katup buang (exhaust valve) tertutup. Hal ini akan menjadikan kevakuman di dalam silinder yang menyebabkan udara murni masuk ke dalam, lihat gambar 2.2 (a). Langkah kedua adalah terjadinya kompresi (compression stroke). Pada langkah ini, kedua katubnya tertutup (intake valve and exhaust valve) dan piston bergerak ke atas serta menciptakan tekanan pada piston, gambar 2.2 (b). Langkah selanjutnya adalah langkah usaha (power). Selama proses ini, injektor menyemprotkan bahan bakar sehingga terjadi pembakaran yang menyebabkan piston bergerak dari atas ke bawah. Melalui batang torak, gerakan dari piston ini diteruskan ke poros engkol, gambar 2.2 (c). Langkah terakhir adalah langkah
  7. 7. 8Jurnal Ilmiah Teknosains Volume 1 Nomor 16 buang (exhaust stroke), dimana katub hisap tertutup dan katub buang terbuka, sementara piston bergerak ke atas mendorong gas sisa pembakaran keluar dari silinder, gambar 2.2 (d). Gambar 2.2 cara kerja engine 4 langkah, (a) langkah hisap, (b) langkah kompresi, (c) langkah usaha, dan (d) langkah buang. 3. METODE PENELITIAN Metode penelitian ini secara umum merupakan tata cara penelitian yang direalisasikan dalam pengumpulan data, dan analisa. Metodologi yang di gunakan dalam penelitian ini diawali dengan melakukan observasi terhadap kondisi operasi pembangkit, pengumpulan informasi dan pendukung melalui inspeksi lapangan, pengambilan data problem,studi literatur untuk mendukung pembuktian kerusakan dan penyebab kerusakan crankshaft.
  8. 8. 9Jurnal Ilmiah Teknosains Volume 1 Nomor 16 3.1. Diagram Alir Penelitian Proses penelitian kerusakan crankshaft di PT. MIFA Meulaboh- Aceh, terdiri dari beberapa tahapan terlihat pada tabel 3.1a yang menunjukkan diagram alir proses penelitian. Secara garis besar proses penelitian yang dilakukan untuk mendapatkan penyebab utama terjadinya repetitive problem atau kerusakan berulang yang meyebabkan kehilangan produksi adalah sebagai berikut: • Penelitian pendahuluan • Identifikasi dan perumusan masalah • Studi pustaka • Pengumpulan data • Pengolahan data • Analisa fishbone dan Fault Tree • Analisa rencana tindakan perbaikan • Kesimpulan dan saran Observasi,pengambilandatasertadokumentasiataskerusakan yang terjadi dilakukan di lokasi kerja PT. MIFA Meulaboh-Aceh.
  9. 9. 10Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Tabel 3.1: Fault Tree Analysis (kerusakan crankshaft) 3.2. Prosedur Penelitian 3.2.1. Penelitian Pendahuluan Untuk mengetahui gambaran permasalahan yang terjadi, dilakukan penelitian pendahuluan dengan melakukan observasi lapangan, korespodensi dengan pihak manajemen unit pembangkit terhadap produksi daya. Equipment Conditions: • Unit yang mengalami kerusakan tersebut masih dalam proses instalasi dan belum dioperasikan. • Pengecekan sebelum dioperasikan harus sesuai dengan cek list, agar performa unit lebih maksimal. 3.2.2. Identifikasi dan Perumusan Masalah Berdasarkan observasi lapangan dan korespodensi didapat hal-hal yang perlu ditindak lanjuti 3.2.3. Studi Pustaka Studi pustaka dilakukan untuk menambah wawasan dan pengetahuan mengenai permasalahan yang akan dibahas dan menentukanmetodeyangcocokuntukmemecahkanmasalahyang sedang dihadapi unit pembangkit. Studi pustaka ditelusuri melalui literatur berupa buku panduan, jurnal serta pencarian informasi melalui internet. 3.2.4. Pengumpulan Data Pengumpulan data-data yang diperlukan untuk mendukung pemecahan masalah yang timbul berdasarkan fokus penelitian. Data-data yang dikumpulkan tersebut diambil pada rentang waktu tertentu yang ditetapkan peneliti. 3.2.5. Pengolahan Data
  10. 10. 11Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Langkah-langkah pengolahan data sebagai berikut: • Melakukan pengumpulan histori unit selama kurun waktu tertentu. 3.2.6. Analisa Analisa terhadap data dan temuan di lapangan dilakukan dengan mendapatkan kesimpulan apakah telah terjadi kondisi yang sesuai dengan dugaan awal. Analisa dilakukan dengan menggunakan metode tulang ikan atau fishbone analysis untuk mendapatkan kesimpulan awal, apakah terjadi watermark pada crankshaft pada unit di PT. MIFA-Meulaboh-Aceh. Kesimpulan dari analisa awal akan ditindaklanjuti dengan melakukan analisa teknis (gambar fault tree analysis) terhadap penyebab utama atas dugaan terjadi kebocoran air yang mengakibatkan kerusakan pada crankshaft. 4. HASIL DAN PEMBAHASAN Dari hasil analisa yang dilakukan di PT MIFA, Meulaboh-Aceh, terhadap kerusakan crankshaft. Dari kronologis kejadian ini saat unit akan start up dan dilakukan pengecekan pada connecting rod yang terkontaminasi air (water). Gambar 1: Karat pada exhaust manifold (referensi : fakta dilapangan).
  11. 11. 12Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Pada gambar 1 tersebut berkarat karena adanya air yang mengalir dari flexsible mufler menuju ke exhaust manifold dan ke ruang bakar. Sehingga saat unit start akan menimbulkan hard crack, atau hidroulick lock, karena air yang berada di ruang bakar menghambat pergerakkan piston. Di bagian exhaust manifold yang menuju ruang bakar di beberapa cylinder berkarat. Diruang bakar maupun exhaust manifold tersebut tidak boleh ada air. Jika ada air diruang bakar akan mengakibatkan hidroulick lock atau jammed. Gambar 2: Water marks pada crankshaft. Watermarks pada crankshaft tersebut sebagai akibat, bukan penyebab. Jika air sudah mengenai permukaan crankshaft akan menimbulkan watermarks, karena crankshaft menggunakan material besi. Pada gambar 1 kebocoran air dari adapter (indikasi adapter berkarat)mengalirmelaluiexhaustmanifoldmenujukeruangbakar, selanjutnya air mengalir melalui celah di antara liner dan piston, sehingga tetesan air mengenai connecting rod dan crankshaft yang mengakibatkan watermarks pada crankshaft. Air yang berada di oil pan (penampungan oli) mengontaminasi minyak pelumas dan filter oli, maka minyak pelumas dan filter oli tidak bisa dipergunakan dan
  12. 12. 13Jurnal Ilmiah Teknosains Volume 1 Nomor 16 harus diganti. Adapun pada gambar 2 akibat air. Gambar 3: Karat pada adapter yang menuju ke exhaust manifold (referensi: Foto fakta dilapangan). Gambar 4: Kebocoran air di antara adapter dan bellow (referensi: Foto fakta di lapangan) Pada gambar 4 terdapat indikasi karat pada bellow, dimana air mengalir di antara adapter dengan bellow (flexsible muffler) kemudian air mengalir ke adapter dan selanjutnya menuju ruang bakarlaluturunkeoilpan,kerusakankomponenseperticrankshaft, liner diakibatkan oleh air. Sedangkan untuk point 3 kebocoran air melalui cylinder head dikarenakan cylinder head retak (crack). Pada saat unit beroperasi normal air terbuang melalui exhaust temperature dan pada saat
  13. 13. 14Jurnal Ilmiah Teknosains Volume 1 Nomor 16 unit stanby air mengalir ke ruang bakar. Overheating pada engine disebabkan oleh kekurangan level air, temperature air (high coolant temperature). Bahwa air disirkulasikan ke seluruh engine, dengan perpindahan panas tersebut air yang didinginkan melalui radiator dan kembali ke engine dengan kondisi temperatur yang dibutuhkan. Kenapa bisa temperature air meningkat? Hal ini karena proses pendinginan oleh radiator tidak maksimal yang disebabkan olehcoreradiator“ngeblok”ataufinradiatorterkontaminasi(debu, oli, dll.). Gambar 4: Liner mengalami (watermark)-(referensi: Foto fakta di lapangan). Keberadaan air di ruang bakar mengakibatkan kerusakan yang cukup besar pada komponen engine, maka biaya yang harus dikeluarkan untuk perbaikan (estimasi 200 - 800 juta), nilai yang cukup besar untuk diperhitungkan. Bukan hanya biaya perbaikan saja melainkan juga denda penalti kWH (kilo watt hour). 5. KESIMPULAN Penyimpanan, persiapan (preparation), pengiriman, dan pemasangan sangat penting dalam proses persiapan tes unit di lokasi pelanggan. Air (water) tidak boleh berada di ruang bakar, karena akan mempengaruhi performa unit. Air di dalam ruang bakar akan mengakibatkan hidrolik lock, sehingga biaya perbaikan cukup besar. Dan sebaliknya, pengiriman dari lokasi pelanggan ke
  14. 14. 15Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Depo penyimpanan, harus diperhatikan, juga mengenai penutupan adapter. Perawatan berkala pada radiator juga harus diperhatikan agar sirkulasi pendinginan menjadi lebih baik, demikian juga pengecekan level air radiator yang harus dilakukan setiap saat. Symptom (gejala): Air dalam ruang bakar. Faktor: • Penutup bellow tidak rapat • Baut pengikat bellow tidak kencang • Penggunaan penutup yang tidak sesuai dengan spek (terpal, plastic wrapping) Akibat: • Hidrolik lock (piston jammed) • Connecting rod patah • Water marks pada crankshaft • Liner water mark • Cyl block pecah • Piston rusak 6. SARAN Pada saat pengiriman unit agar dipastikan adapter tertutup dengan plate, tanpa menggunakan bellow. Pada saat unit stanby di depo agar dipastikan mengenai penutupan adapternya, supaya air tidak mengalir ke ruang bakar. Jikacrankshaft,liner,pistonterkontaminasiolehairagarsegera diberikan pelumas (oli atau solar) untuk meminimalisasi terjadinya karat. DAFTAR PUSTAKA Caterpillar, Media Number SENR2362-02 Colling system Operation FAR hidrolik lock unit 0YAS00446 Diesel Engine Handbooks (www.diesel engine handbooks) Corrosion Inhibitors Chapter 10 (www.corrosion Inhibitors).
  15. 15. 16Jurnal Ilmiah Teknosains Volume 1 Nomor 16 KEAHLIAN BIDANG MECHANICAL 3D CAD/CAE/ CAM SEBAGAI ALAT DAYA SAING MEMASUKI DUNIA ENJINERING DAN MANUFAKTURING Asep Dharmanto, S.T, MT (adharmanto@gmail.com) Dosen tetap STTM Cileungsi Wilarso, S.T (wilarso09@gmail.com) Dosen tidak tetap STTM Cileungsi ABSTRAK Perubahan suatu produk yang dinamis dan diinginkan oleh pasar sudah menjadi keharusan. Perusahaan yang tidak dapat mengimbangipasaruntukberimproviasipadahasilproduknyaakan ditinggalkan oleh konsumen. Karena itu, dalam dunia enjinering dan manufakturing keakurasian bentuk, kekuatan material, dan kecepatan produksi akan output produk desain adalah suatu hal yang tidak bisa ditawar lagi. Tools yang dibutuhkan tersebut adalah keberadaan sistem Computer Aided Design (CAD)/Computer Aided Engineering (CAE)/Computer Aided Manufacturing (CAM). Hal lain yang mengimbangi keberadaan sistem tersebut adalah kemampuan sumber daya manusia (SDM) yang handal, yaitu yang mempunyai keamampuan dasar perhitungan enjinering dan mampu mengoperasikan tools CAD/CAM/CAE. Kedua komponen tersebut, yakni SDM (engineer) yang berkualifikasi dan tools CAD/ CAM/CAE akan menciptakan output suatu produk enjinering dan manufakturing yang cepat dan tepat sesuai permintaan pasar. Kata kunci: improvisasi, keakurasian, SDM, CAD/CAM/CAE 1. LATAR BELAKANG Sekarang ini ada yang menarik tentang produk konsumer yang mengandalkan style yang selalu mengikuti tren, yaitu ‘perubahan bentuk’ atau ‘tampil beda’ dengan masa sebelumnya. Produk yang sekarang sedang menjadi tren, bisa jadi tahun depan sudah usang apabila muncul produk lain yang lebih baru, dimana hanya model luarnya saja yang diubah sedikit atau ditambahkan satu,
  16. 16. 17Jurnal Ilmiah Teknosains Volume 1 Nomor 16 dua fitur baru. Kita bisa melihat kasus ini pada siklus perubahan produk barang-barang konsumer seperti elektronik (gadget, home appliances), furniture, dan kendaraan bermotor. Salah satu contohnya adalah satu varian kendaraan roda empat yang terkenal di Indonesia (MPV), mobil MPV tersebut tetap eksis walaupun tipe dan variannya sendiri sudah berumur lebih dari 10 tahun. Tanpa mengabaikan purna-jual dan unsur safety, ada sesuatu yang menarik tentang kendaraan tersebut, karena setiap tahunnya ada perubahan sedikit atau ditambahkan aksesoris baru, misalnya pada bamper, model lampu, dashboard dan lain sebagainya. Dengan demikian, unsur psikologis bagi pemilik model baru dimana merasa unit mobilnya lebih baik dari unit mobil model sebelumnya tetap tertanam. Dan pada akhirnya penjualan tipe mobil MPV tersebut tetap tinggi. Bagi manufakturer lain yang lambat dalam hal improvisasi, perubahan bisa jadi akan ditinggalkan oleh konsumennya. Antisipasi perubahan tren suatu produk tentunya didukung oleh SDM yang berkualifikasi dan didukung pula oleh sistem perangkat lunak (softweare) dan perangkat keras (hardware) yang handal pada bagian riset, enjinering dan manufakturing. Di sinilah fungsi CAD/CAE/CAM sebagai alat pendukung bagi SDM untuk menciptakan dan menganalisa suatu produk baru lebih cepat, efisien dan handal. Dalam tulisan ini, penulis hanya menjelaskan sedikit dari fungsi utama dan saling keterkaitan antara CAD/CAE/CAM dalam dunia enjinering dan manufaktur. 2. MEKANIKAL CAD (MCAD) CAD/CAE/CAM menjadi lebih populer sebagai alat desain-analisis standar dalam dunia industri manufaktur terutama otomotif untuk model desain, analisis kegagalan dan produksi. Tools ini juga menjadi terkenal karena telah menjadi suatu persyaratan spesifikasi enjinering yang harus digunakan untuk setiap bagian perubahan desain baru berikut materialnya. Terutama, untuk industri otomotif, suatu komponen harus mempunyai ketahanan (durability) terhadap jarak tempuh yang dipersyaratkan.
  17. 17. 18Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Computer Aided Design, Engineering and Manufacturing adalah alat bantu enjiner untuk membuat, menguji, memodifikasi dan membuat ide desain. Di sisi lain, ada tuntutan untuk mengurangi biaya dan memperpendek proses desain, membuat prototipe dan siklus produksi. Tools ini nantinya juga dapat digabungkan dengan sistem Product Data Management (PDM) ataupun Product Lifecycle Management (PLM). PDM atau PLM adalah perangkat penghubung tentang informasi produk di internal perusahaan untuk sistem proses produksi yang kompleks. Gambar 1: Hubungan point antara CAD/CAE/CAM. [3]. 3. COMPUTER AIDED DESIGN (CAD) CAD sering diterjemahkan sebagai computer (alat) bantu desain. Terkadang huruf singkatan D juga bisa diartikan dengan drafting. Perbedaaan kata desain dan drafting dapat dilihat dari fungsi prosesnya, apakah perangkat lunak itu digunakan dengan modul tiga dimensi maka akan disebut desain dan kalau digunakan fungsi dua dimensi, detail dimensi disebut drafting. Kedua arti ini pada dasarnya sama dan mengacu pada gambar perancangan serta teknis berbagai proyek di komputer dibandingkan dengan meja gambar tradisional. Secara umum fungsi CAD yang mencakup arsitektural dan lanskap, mekanikal desain, perancangan listrik, dan desain yang lain. Tulisan ini akan memfokuskan di MCAD (mechanical computer aided design). Secara umum fungsi Computer Aided Design (CAD) memiliki tiga komponen yaitu desain, analisis, visualisasi.
  18. 18. 19Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Penjelasan singkat tentang komponen ini adalah desain mengacu pada pemodelan geometris, pemodelan 2D dan 3D kemudian pembuatan komponen, penyusunan komponen (asembli), pembuatan gambar dengan berbagai tampilan umum dan detail berikut dengan pendimensiannya. Dalam sistem MCAD yang terbaru, ada fungsi yang umum ditemui yaitu Parametrik dan Fitur. Parametrikadalahistilahyangdigunakanuntukmenggambarkan kemampuan dimensi untuk mengubah bentuk geometri model dengan cara memodifikasi nilai dimensinya. Fitur adalah istilah yang digunakan untuk menggambarkan urutan proses model komponen. Misalnya suatu bagian komponen bisa terdiri dari berbagai jenis fitur seperti lubang, alur, fillet, dan chamfers. Sedangkan Fitur adalah unit dasar dari model solid parametrik. Pemodelan parametrik menggunakan komputer untuk merancang objek atau sistem yang memodelkan komponen atribut dengan perilaku dunia nyata. Model parametrik menggunakan alat desain pemodelan berbasis fitur, solid, dan permukaan untuk memanipulasi atribut sistem. Salah satu fitur terpenting pemodelanparametrikadalahatributyangsalingterkaitmengubah fiturnya secara otomatis. Dengan kata lain, pemodelan parametrik memungkinkan perancang mendefinisikan keseluruhan model urutan bentuk. Sebelum munculnya parametrik, mengedit bentuk bukanlah tugas yang mudah bagi desainer. Misalnya, untuk memodifikasi padatan 3D, perancang harus mengubah panjang, lebar dan tinggi dengan cara memotong atau menambah. Namun, dengan pemodelan parametrik, perancang hanya perlu mengubah satu parameter, dan parameter lainnya menyesuaikan secara otomatis. Jadi, model parametrik fokus pada langkah-langkah dalam menciptakan bentuk dan parameterisasi model. Teknologi ini sangat besar manfaatnya bagi desainer perancangan teknik.
  19. 19. 20Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 2: Perubahan parametrik Gambar 3: Urutan fitur manajer. Ada dua model representasi parametrik yang dikenal: 1. Geometri Padat Konstruktif (Constructive Solid Geometry- CSG) CSG mendefinisikan sebuah model dalam hal menggabungkan bentuk dasar (primitif) dan yang dihasilkan (menggunakan operasi ekstrusi dan sweeping). Menggunakan operasi Boolean untuk membangun sebuah model. CSG adalah kombinasi dari primitif padat 3D (misalnya silinder, kerucut, prisma, persegi panjang atau bola) yang kemudian dimanipulasi dengan menggunakan operasi Boolean sederhana.
  20. 20. 21Jurnal Ilmiah Teknosains Volume 1 Nomor 16 2. Representasi Batas (Boundary Representation) Di BR, model padat dibentuk dengan menentukan permukaan yang membentuk batas spasialnya (titik, tepi, dll.), benda tersebut kemudian dibuat dengan menggabungkan titik spasial ini. Banyak metode Finite Element Method (FEM)/Metode Elemen Hingga menggunakan metode ini, karena memungkinkan interior meshing volume menjadi lebih mudah dikendalikan. Kelebihan pemodelan parametrik 3D atas 2D tradisional: • Kemampuan untuk menghasilkan desain yang fleksibel, cepat serta efisien • Model solid 3D memberikan berbagai macam cara untuk melihat modelnya • Visualisasi produk lebih baik, karena bisa dimulai dengan geometri sederhana hingga sampai yang detail • Integrasi yang lebih baik dengan aplikasi CAE/CAM dan pengurangan waktu siklus teknik • Data desain yang ada dapat digunakan kembali untuk membuat desain baru. Gambar 4: Gambar 3D asembli detail mobil. [5]
  21. 21. 22Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Dengan sistem CAD yang sebenarnya para perancang bisa membuat satu model digital dengan kemungkinan untuk merancang, memvisualisasikan, dan mensimulasikan produk mereka. Perangkat Lunak (Software) Ada banyak pilihan perangkat lunak yang tersedia di pasar saat ini untuk pemodelan parametrik. Pada tingkatan yang umum, perangkat lunak ini dapat dikategorikan sebagai: Low Range, Mid Range and High Range. Beberapa perangkat lunak industri terkemuka adalah: Tabel 1: Beberapa sistem CAD yang terkenal di Indonesia 4. COMPUTER AIDED ENGINEERING (CAE) Computer Aided Engineering (CAE) adalah perangkat lunak komputeruntukmensimulasikankinerjagunameningkatkandesain produk atau membantu penyelesaian masalah teknik di berbagai industri, termasuk simulasi, validasi, dan optimalisasi produk. Proses utama CAE terdiri dari proses preprocessing, solving, dan postprocessing. Pada tahap preprocessing, enginer memodelkan geometri (representasi sistem) dan sifat fisik rancangan, kemudian penentuan fiksasi model, dan terakhir pembeban atau kendala yang diterapkan pada model. Selanjutnya, model dipecahkan dengan menggunakan rumusan matematika yang sesuai dengan hukum fisika oleh sistem perangkat lunak CAE. Pada tahap pasca- pengolahan, hasilnya dapat dilihat oleh enginer untuk ditinjau apakah sesuai harapan atau tidak. Aplikasi CAE mendukung berbagai disiplin ilmu teknik atau
  22. 22. 23Jurnal Ilmiah Teknosains Volume 1 Nomor 16 fenomena termasuk: • Analisis tegangan statis dan dinamika komponen dan asembli • Analisis termal dan fluida menggunakan dinamika fluida komputasi (CFD) • Kinematikadananalisismekanismeyangdinamis(multibody dynamics) • Analisis akustik atau simulasi sistem mekatronika, untuk desain sistem mekatronika multi-domain • Simulasi acara mekanik (MES) • Analisis sistem kontrol simulasi proses pembuatan seperti casting, molding dan die press forming • Optimalisasi produk atau proses. FINITE ELEMENT ANALYSIS (FEA)/ANALISIS ELEMEN HINGGA Finite Element Analysis (FEA) adalah pemodelan produk dan sistem di lingkungan virtual untuk tujuan menemukan dan memecahkan masalahstrukturalataukinerjapotensial(atauyangsudahada).FEA adalah aplikasi praktis dari FEM, yang digunakan oleh para insinyur dan ilmuwan untuk model matematis dan numerik memecahkan masalah struktural, fluida, dan multiphika yang sangat kompleks. Perangkat lunak FEA dapat digunakan dalam berbagai industri, namun paling umum digunakan di industri otomotif, aeronautika dan biomekanik. Model Elemen Hingga (FE) terdiri dari sebuah sistem titik, yang disebut “node”, yang membentuk simpul jaring. Simpul-simpul tersebut saling terhubung yang merupakan unsur-unsur yang memiliki batasan sendiri yang membentuk mesh elemen hingga dan mengandung sifat material serta struktural model. Sehingga mesh tersebut menentukan bagaimana ia akan bereaksi terhadap kondisi tertentu. Kepadatan mesh elemen hingga dapat bervariasi di seluruh material, tergantung pada perubahan yang diantisipasi
  23. 23. 24Jurnal Ilmiah Teknosains Volume 1 Nomor 16 pada tingkat stres pada area tertentu. Kawasan yang mengalami perubahan tegangan tinggi biasanya membutuhkan kerapatan mesh yang lebih tinggi daripada yang mengalami variasi stres sedikit atau tidak sama sekali. Area tertentu mungkin termasuk titik-titik rekahan dari bahan yang patut diuji sebelumnya seperti fillet, sudut, detail kompleks, dan area dengan tekanan tinggi. UntukmensimulasikanefeklingkungankerjadunianyatadiFEA, berbagai jenis beban dapat diterapkan pada model FE, termasuk: • Nodal: kekuatan, momen, perpindahan, kecepatan, percepatan, suhu dan fluks panas • Elemental: pemuatan, tekanan, suhu dan fluks panas yang didistribusikan • Beban akselerasi tubuh (gravitasi) Jenis-jenis analisis meliputi: • Statistika linier: analisis linier dengan beban dan kendala terapan yang statis Statika dan dinamika nonlinier: efek karena kontak (dimana satu bagian dari model berhubungan dengan yang lain), definisi material nonlinier (plastisitas, elastisitas, dan lain-lain) dan perpindahan besar (strain yang melebihi teori perpindahan kecil yang membatasi pendekatan analisis linier) • Modus normal: frekuensi getaran alami • Respon dinamik: beban atau gerakan yang berbeda dengan waktu dan frekuensi • Buckling: beban kritis dimana struktur menjadi tidak stabil. • Perpindahan panas: konduksi, radiasi dan perubahan fasa.
  24. 24. 25Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 4: Analisis komponen pada aplikasi FEA. [4] Hasil tipikal yang dihitung oleh pemecah meliputi: • Perpindahan nodal, kecepatan dan akselerasi • Kekuatan unsur, strain dan tekanan Manfaat FEA FEA dapat digunakan dalam desain produk baru atau untuk memperbaiki produk yang ada, untuk memastikan bahwa desain tersebut dapat dilakukan sesuai spesifikasi sebelum manufaktur, dengan FEA Anda bisa: • Memprediksi dan meningkatkan kinerja dan keandalan produk • Kurangi prototip dan pengujian fisik • Evaluasi berbagai desain dan bahan • Optimalkan desain dan kurangi penggunaan material
  25. 25. 26Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 5: Visualisasi analisis komponen di asembli pada Aplikasi FEA. [1] 5. COMPUTER AIDED MANUFACTURING (CAM) Computer-aided manufacturing (CAM) adalah penggunaan aplikasi perangkat lunak komputer Kontrol Numerik (NC) untuk membuat petunjuk terperinci (G-code) yang menggerakkan alat mesin Computer Numerical Control (CNC) untuk bagian manufaktur. Pabrikan di berbagai industri bergantung pada kemampuan CAM untuk menghasilkan komponen berkualitas tinggi. Definisi CAM yang lebih luas dapat mencakup penggunaan aplikasi komputer untuk menentukan rencana manufaktur untuk merancang perkakas, persiapan detail model bantuan komputer (CAD-Draft), pemrograman NC, mengkoordinasikan pengujian mesin pengukur (Coordinate Measuring Machine-CMM), simulasi alat mesin, atau metode pasca-pengolahan. Output CAM kemudian dieksekusi di lingkungan produksi, seperti pengendalian numerik langsung (Distributed Numeric Control - DNC), manajemen alat, eksekusi CMM dan mesin CNC.
  26. 26. 27Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 6: Urutan pembuatan toolpath G-Code [4] Manfaat CAM dalam sistem produksi Sistem CAM dapat memaksimalkan pemanfaatan berbagai peralatan seperti mesin CNC, seperti High Speed Machining Center 3 axis atau 5 axis mesin dengan kecepatan tinggi, CNC Turning (CNC mesin bubut), CNC wire cut dan peralatan inspeksi CMM. Sistem CAM dapat membantu dalam menciptakan, memverifikasi,mensimulasi,danmengoptimalkanprogramNCuntuk produktivitas permesinan yang optimal serta mengotomatisasi pembuatan program. Proses Permesinan Tahapan umum proses pemotongan material dalam mesin CNC adalah sebagai berikut: • Roughing Proses ini dimulai dengan pemotongan blok material awal. Memotongnya secara kasar (dalam), beberapa proses mendekati offset terluar permukaan akhir. Tampilan proses pemotongan ini adalah memotong model secara horisontal. Strategi pemotongan roughing umum adalah pemotongan planar zig-zag, pemotongan offset contour. • Semi-f Dengan pisau potong yang lebih kecil dari proses roughing, proses ini memotong ke dalam jarak offset yang lebih kecil lagi dari model permukaan akhir. Akhir proses semi finishing harus meninggalkan sejumlah kecil material sehingga cutting tool finishing bisa
  27. 27. 28Jurnal Ilmiah Teknosains Volume 1 Nomor 16 memotong secara akurat saat finishing. Strategi proses cutting umum adalah raster passes, constant step over, melewati selangkah demi selangkah • Finishing Proses finishing biasanya lompat dengan step over yang kecil agar menghasilkan hasil yang halus jika telah selesai. Dalam finishing, langkah antara satu pass dengan pass yang lainnya (step over) dan seminimalmungkin.Kecepatanpotongyangrendahdankecepatan spindle dinaikkan untuk menghasilkan permukaan yang akurat. Untuk bagian sudut yang sulit bisa dikerjakan dengan proses pencil milling. • Kontur milling Dalam aplikasi milling 5 axis ada proses finish contouring yang dapat dilakukan. Benda kerja dapat berputar dan kepala spindle bisa menyudut, sehingga cutting tool permukaan benda kerja dapat bersinggungan pada bagian yang sulit. Sehinnga menghasilkan permukaan akhir yang sangat halus dengan akurasi dimensi tinggi. Gambar 7: Visualisasi Toolpath Machining [1] Roughing Offset b Countur Milling 5 Axis
  28. 28. 29Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Hardware untuk CAD/CAM/CAE Untuk bagian enjinering yang sudah memasuki tahap kompleksitas tinggi seperti LargeAssemblyDesign, Complexsurfacemodeling, dan dynamicanalysisdapatdiklasifikasikankerjakomputasiperformansi tingkat tinggi. Ini berarti komputer yang digunakan adalah tipe aplikasi teknologi komputer simulasi dengan persyaratan tertentu pada CPU, RAM, performa grafik, kecukupan power supply dan sistem pendinginannya. Rekomendasi tipe komputer adalah komputer kelas workstation dari fabrikan merek terkenal seperti HP, IBM atau Dell. Untuk spesikasi umum dari workstation tersebut diantaranya: • O/S sistem 64 bit • Sistem Multi processor • Fastest RAM 16-64 GB RAM, tergantung dari kompleksitas aplikasi • Untuk 3D model dan post processing menggunakan 100% OpenGL compatible graphic card. Poin-poin spesifikasi di atas harus dikonfirmasi dengan perangkat lunak CAD/CAE/CAM si penjualnya. Biasanya, dari pihak penjual ada rekomendasi detail hardware sesuai modul perangkat lunaknya. CAD/CAM/CAE Terintegrasi dengan PDM Ouput CAD/CAE/CAM bila terhubung antar departemen, selain enjinering bisa diefisienkan dengan suatu sistem yang disebut Produk Data Manajemen (PDM). PDM adalah suatu software atau tool untuk mengontrol data tentang suatu produk. Penulusuran data adalah perolehan informasi tentang spesifikasi, development, proses, bill of material yang dibutuhkan untuk menghasilkan suatu produk. Fungsi PDM yang lain adalah penelusuran cost setiap produk atau asembli suatu produk setiap tahapan dan untuk cost total seluruh tahapan. PDM menjadi tempat informasi tentang proses dan sejarah setiap produk. Perubahan data akan terekam berikut dengan user (pemakai)-nya setiap project mulai dari
  29. 29. 30Jurnal Ilmiah Teknosains Volume 1 Nomor 16 manajer, enjiner, sales, logistik sampai quality. DalamPDMjugadidapatitentanginformasipembuatan,perubahan dan arsip seluruh informasi setiap produk. Informasi yang disimpan adalah data CAD/CAM/CAE, drawing, dan dokumen yang terkait. Pusat penyimpanannya adalah server sebagai pusat database, sedangkan informasi terkait suatu produk berbentuk metadata. Perubahan file suatu produk harus dilakukan dengan suatu sistem Check Out untuk editing, dan Chek In untuk menyimpan. Produk suatu data harus lakukan dengan siklus WorkFlow, dimana dengan siklus ini approval suatu produk dapat dilakukan secara online atau paperless. Dan informasi perubahan dapat dilakukan lewat sistem Engineering Change Note (ECN). Tipikal informasi yang ditangani oleh PDM adalah: • Part Number • Part Description • Vendor part number-descrition • Units and Quantity • Cost/price • Cad Drawing • Material Data Sheet or BOM • Automatic Report Gambar 8: Ilustrasi PDM dan kustomisasi informasi data. Untuk data management yang lebih kompleks karena kompleksnya dan besarnya produk yang dihasilkan, misal membutuhkan suatu sistem yang lebih terintegrasi ke finance dan supplier maka harus meningkat ke sistem Product Life cycle
  30. 30. 31Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Management (PLM). 6. KESIMPULAN Keberadaan sistem CAD/CAE/CAM di dunia industri khususnya bidang enjinering dan manufaktur adalah bagian terintegrasi tak terpisahkanuntukmenghasilkanoutputprodukberkualitasdengan tingkat efisiensi yang tinggi. Terkadang bagi suatu perusahaan yang berkerja sama dengan perusahaan yang lebih besar dan mapan keberadaan CAD/CAM menjadi prasyarat untuk kerja sama dan bisnis. Karena dengan perangkat lunak yang sama maka impor data adalah 100% data aktual sama tidak ada deviasi. Bagi para mahasiswa lulusan perguruan tinggi yang ingin berkarya di bidang enjinering dan manufaktur, maka pengetahuan dasar dengan skil yang kuat tentang CAD/CAE/CAM adalah suatu keharusan. Dengan keterampilan tersebut maka para lulusan akan dengan mudah untuk beradaptasi dengan lingkungan enjinering dan manufaktur. DAFTAR PUSTAKA NX Siemens https://www.plm.automation.siemens.com) Assault Systemes (https://www.3ds.com) American Engineering Group (AEG) (http://engineering-group. com) [3] DesignTech (https://www.designtechsys.com) [4] DR Nicos Bilalis, Computer Aided Design CAD, Report produced for the EC funded project, January 2000 [5] Stefano Tornincasa, The Future And The Evolution OF Cad, TMT 2010
  31. 31. 32Jurnal Ilmiah Teknosains Volume 1 Nomor 16 [6] Asep Dharmanto, “Construction of Power Transformer Tank Against High Seismic Required Response Spectrum”, Bangkok CEPSI 2016.
  32. 32. 33Jurnal Ilmiah Teknosains Volume 1 Nomor 16 PERANCANGAN PRESSURE VESSEL AIR RECEIVER TANK 25M³ VERTICAL Ucok Mulyo Sugeng, Tahi Manurung, Muhamad Ridwan Teknik Mesin, Sekolah Tinggi Teknologi Muhammadiyah Cileungsi Email : ucok_ms2009@yahoo.com Pressure Vessel adalah sebuah bejana tekan atau wadah yang dirancang untuk dapat menampung udara bertekanan. Perbedaan tekananpadaPressureVesselakanmengakibatkankecelakaanfatal. Sebuah industri yang menggunakan tenaga pneumatic biasanya memerlukan sebuah Pressure Vessel yang dapat memenuhi kapasitas produksi. Maka dari itu, kapasitas pada volume bejana tekan harus lebih besar untuk dapat memenuhi tenaga pneumatic yang dibutuhkan pada proses produksi di sebuah industri, mengacu pada kebutuhan di atas maka akan dirancang bejana tekan dengan kapasitas volume yang besar dengan kapasitas kurang lebih 25M³ dan dapat dipakai pada bermacam-macam aplikasi di berbagai sektor industri seperti industri kimia (petrochemical plant), energi (power plant),  minyak dan gas (oil & gas). Perancangan Presure vessel ini bertujuan untuk dapat memenuhi kebutuhan udara tekan dengan kapasitas 25M³. Kata kunci: pressure vessel, udara tekan 1. PENDAHULUAN Seiringperkembanganzamandalambidangindustridanbanyaknya permintaan untuk dapat menghasilkan produk-produk unggulan yang mampu mengefisiensi waktu maka teknologi penumatic sangat diperlukan, dalam hal ini adanya peralatan teknologi yang mendukung teknologi penumatic semakin maju dengan pesat, terutamanya dalam hal peralatan automatic mesin yang menggunakan sistem pneumatic. Dalam peralatan mesin pneumatic dibutuhkan tempat penyimpanan udara yang dinamakan bejana tekan atau pressure
  33. 33. 34Jurnal Ilmiah Teknosains Volume 1 Nomor 16 vessel. Sebuah industri yang menggunakan tenaga pneumatic begitu menguntungkan dengan perawatan yang begitu mudah dan harga efisien.Mesinpadaindutripunbegitubanyakyangmenggunakannya pada sektor industri seperti industri kimia (petrochemical plant), energi (power plant), minyak dan gas (oil & gas). Karena dibutuhkannya tempat penyimpanan udara atau bejana tekan dengan volume yang lebih besar kurang lebih 25M³ dan digunakan pada sektor industri dengan memenuhi kapasitas produksi, maka dari itu kami mengambil judul dalam tugas akhir Perancangan Pressure Vessel Air Receiver Tank 25M³ Vertical. 2. LANDASAN TEORI 2.1. Air Receiver Tank Air Receiver Tank adalah suatu alat bejana tekan atau pressure vessel yang berfungsi untuk menampung udara bertekanan. Pada umumnya alat ini digunakan oleh banyak industri, khususnya yang menggunakan pneumatik dan dapat dipakai pada bermacam- macam aplikasi di berbagai sektor industri, seperti industri kimia (petrochemical plant), energi (power plant), minyak dan gas (oil & gas). 2.1.1. Tipe-tipe Air Receiver Tank Berikut tipe-tipe umum Air receiver tank : • Tipe Vertical • Tipe Horizontal 2.2. Komponen Utama Air Receiver Tank 1. Shell 2. Head 3. Nozzle
  34. 34. 35Jurnal Ilmiah Teknosains Volume 1 Nomor 16 4. Support Shell dan heads bersama-sama membentuk wadah untuk menampung udara bertekanan. Nozzle berfungsi sebagai saluran masuk dan keluar fluida bertekanan, sedangkan support sebagai penumpu bejana tekan. Pada suatu air receiver tank, tegangan maksimum yang terjadi biasanya disebabkan oleh adanya konsentrasi tegangan. Konsentrasi tegangan ini dapat terjadi pada bagian nozzle (saluran keluar-masuk udara) dan pada bagian head (penutup tangki). 2.3. Tipe – tipe Head Air Receiver Tank Berikut tipe-tipe Head Air Receiver tank yang sering di gunakan di Industri: 1. Sphere or Hemisperical head
  35. 35. 36Jurnal Ilmiah Teknosains Volume 1 Nomor 16 2. Ellipsoidal head 3. Torisperical Head 4. Cone and Conical Section
  36. 36. 37Jurnal Ilmiah Teknosains Volume 1 Nomor 16 3. METODELOGI PERANCANGAN 3.1. Metode perancangan VDI 2221 Perancanganpressurevesselairreceivertank25M³inimenggunakan metode perancangan VDI 2221 (Verein Deutscher Ingenieure atau Persatuan Insinyur Jerman). Adapun 4 tahapan pada VDI 2221 yaitu: a. Tahap I  : Penjabaran Tugas (Clarification of the Task) b. Tahap II  : Perancangan Konsep (Conceptual Design) c. Tahap III : Perancangan Wujud (Embodiment Design) d. Tahap IV : Perancangan Terinci (Detail Design) 3.1.1. Penjabaran Tugas
  37. 37. 38Jurnal Ilmiah Teknosains Volume 1 Nomor 16 3.1.2. Perancangan  Konsep
  38. 38. 39Jurnal Ilmiah Teknosains Volume 1 Nomor 16 3.1.3. Perancangan Wujud 3.1.4. Perancangan Terinci Perancangan terinci ini merupakan perancangan pressure vessel air receiver tank 25M³ dalam bentuk gambar yang akan diproduksi, serta komponan dan toleransi terdapat dalam gambar tersebut. Untuk menyempurnakan perencanaan (desain) maka dibuat suatu dokumen hasil rancangan sehingga dapat diproduksi secara terus menerus dan pengembangannya yang lebih baik dari produk berdasarkan dokumen tersebut. 3.2. Fungsi Utama
  39. 39. 40Jurnal Ilmiah Teknosains Volume 1 Nomor 16 3.3. Sub Fungsi 3.4. Matrik solusi
  40. 40. 41Jurnal Ilmiah Teknosains Volume 1 Nomor 16 3.5. Diagram Kombinasi Prinsip Solusi 3.6. Pilihan Kombinasi yang Cocok dari Kombinasi-kombinasi Prinsip Solusi
  41. 41. 42Jurnal Ilmiah Teknosains Volume 1 Nomor 16 3.7. Konsep Bentuk Variasi 4 yang Terpilih 3.7.1 Konsep Bentuk 3 Dimensi 3.7.1 Konsep Bentuk 3 Dimensi
  42. 42. 43Jurnal Ilmiah Teknosains Volume 1 Nomor 16 4. PERHITUNGAN DAN ANALISA 4.1. Cylindrical Shell (Long seam) t ......................................................................……(1) 4.2 Sphere and Hemispherical Head t ........................................................................... (2) 4.3. Ellipsoidal Head t ........................................................................... (3)
  43. 43. 44Jurnal Ilmiah Teknosains Volume 1 Nomor 16 4.4. Cone and Conical Section t ................................................................ (4) 4.5. Asme Flanged and Dished head (toripherical head) When = t ............................................................................ (5) When t .......................................................................... (6) 4.6 Leg Support Untuk mengetahui bahwa leg support itu aman digunakan karena desain pressure vessel tersebut menggunakan PIPA, maka
  44. 44. 45Jurnal Ilmiah Teknosains Volume 1 Nomor 16 untuk analisanya menggunakan rumus sebagai berikut: a. Nu (Load ) Nu = hasil berat keseluruhan/total leg support.................(7) b. d (Inside diameter pipe) d = D – ( t act x 2 ) ..............................................................(8) c. I (Momen inertia ) I = 0.049 x ( D ⁴ - d ⁴ )..........................................................(9) d. A ( Cross-section Area ) A = 0.784 x ( D ² - d ² )........................................................(10) e. r ( Radius of gyration) r = ................................................................................(11) f. Lk ( Length Buckle ) Lk = L x k............................................................................(12) g. λ ( slenderness of beam ) λ = ..................................................................................(13) h. λc (review strangth of beam) λc = x ......................................................................(14) i. P max ( Max Load ) i.1. Buckling Koefisien of beam i.1.1. Opsi 1
  45. 45. 46Jurnal Ilmiah Teknosains Volume 1 Nomor 16 if λc < 0,25 then ω = 1..........................................(15) i.1.3. Opsi 2 if λc > 1,2 then ω = 1,25*(λc^2).........................(16) i.1,2. Opsi 3 2 if 0,25 < λc < 1,2 then ω = 1,43/(1,6-0,67*λc)...(17) j. Nn (compressive strength of the material ) Pmax = Nn = A x Fy / ω................................................ .....(18) k. t min ( Check the Thickness of pipe ) t min = D x ( )......................................................(19) l. λr = (Check the cross-section slenderness of pipe) λr = D / t < 22,000 / fy........................... ............................(20) m. Sf = Safety Factor Note : Control Stength should not be more than one Sf = ( Nu / Φ x Nn ) < 1........................................................(21) 4.7 Lifting Lug t = ...................................................................(22)
  46. 46. 47Jurnal Ilmiah Teknosains Volume 1 Nomor 16 4.8. Rancangan Anggaran Dana Pressure Vessel Air Receiver Tank 25m³ Dalam perancangan pressure vessel air receiver tank 25m³ membutuhkan rancangan anggaran dana untuk mengestimasi kebutuhan yang akan diproduksi pada air receiver tank 25m³.
  47. 47. 48Jurnal Ilmiah Teknosains Volume 1 Nomor 16 4.9. Waktu Produksi Description Mulai Total hari Selesai Marking & Cutting 1- Juli -17 4 4- Juli -17 Bodem dan Roll 5- Juli -17 2 7- Juli -17 Assembly 8- Juli -17 3 11- Juli -17 Welding 12-Juli-17 4 16- Juli -17 Finishing 17- Juli-17 1 18- Juli -17 5. KESIMPULAN Dari hasil perancangan yang telah dilakukan maka dapat ditarik beberapa kesimpulan antara lain: Berdasarkan Metodologi perancangan dengan menggunakan metode VDII (Verein Deutscher Ingenieure atau persatuan Insinyur Jerman) mendapatkan konsep-bentuk variasi 4. Dengan metode ini kita dapat menentukan desain apa yang akan kita buat dan cocok untuk diproduksi; Dengan menggunakan perhitungan pada shell, head dan leg kita dapat menemukan ketebalan plat yang dapat digunakan untuk pressure vessel yang akan kita produksi; Dengan adanya rancangan anggaran biaya kita dapat menentukan biaya untuk pembelian material sehingga biaya menjadi efisien; Pada proses produksi untuk estimasi waktu disesuaikan pada waktu produksi yang biasanya dilakukan beberapa lama pada proses produksi tersebut; Pemilihan bahan disesuaikan oleh spesifikasi yang akan diproduksi.
  48. 48. 49Jurnal Ilmiah Teknosains Volume 1 Nomor 16 DAFTAR PUSTAKA Paul Buthod, Pressure Vessel Hand Book 10`th Eddition, Pressure Vessel Publishing.INC, Oklahoma, 1997 ASME section VIII div.1 Rules For Contruction Of Presure Vessels edition 2010 ASME Section IX Welding and Brazing Qualification wdition 2010 Sri widharto, inspeksi teknik Buku 1 ,PT.Penebar Swadaya, Jakarta 2004 Agus Setiawan, Perancangan Struktur baja dengan metode LRFD, erlangga, Jakarta,2008 Ir. Ucok Mulyo Sugeng. MT, Modul perancangan produk, Sekolah tinggi teknologi muhammadiyah Cileungsi, Bogor,2013 http://victorcruzworld.blogspot.co.id/2011/10/prinsip-kerja-dasar- penumatik.html?m=1 http://andarkusuma.wordpress.com/2013/01/13/tahapan- perencanaan-berdasarkan-vdi-2221/ http://id.m.wikipedia.org/wiki/tekanan
  49. 49. 50Jurnal Ilmiah Teknosains Volume 1 Nomor 16 PENDEKATAN METODE RWL (RECOMMENDED WEIGHT LIMIT) UNTUK MENGUKUR BEBAN KERJA PENGANGKATAN/HANDLING MANUAL DI MESIN STAMPING Suwaryo Nugroho Program Studi Teknik Industri, STT Muhammadiyah Cileungsi Email: suwaryonugroho@yahoo.com ABSTRAKSI Metode RWL adalah salah satu metode untuk mengukur dan menganalisabebankerjaoperatorpadaproseskerjapengangkatan secara manual. Pengukuran tersebut bertujuan untuk mengetahui apakah beban kerja yang dilakukan oleh operator cukup aman dilakukan sepanjang jam kerja atau tidak, dan sesuaikah dengan ketentuan dari kesehatan dan keselamatan pekerja yang direkomendasikan oleh pemerintah maupun oleh peraturan internasional. Penelitian dilakukan di salah satu perusahaan Stamping, dimana dalam salah satu aktivitas produksinya masih menggunakan sistem handling secara manual dan dilakukan sepanjangshiftkerja.PerhitunganRWLdanIndeksLiftingdilakukan dengan menggunakan jarak perpindahan material yang berbeda- beda sesuai dengan penempatan wip pada material tempat yang berbeda. Dari perhitungan tersebut didapat bahwa nilai Indeks Lifting untuk masing-masing jarak perpindahan menghasilkan nilai yang berbeda-beda walaupun nilai perbedaannya tidak signifikan, dengan nilai load indeks-nya antara 3,335-3.670, nilai tersebut melebihi dari nilai Indeks Load yang disarankan yaitu maksimum sebesar 1, sehingga dapat disimpulkan bahwa pekerjaaan tersebut tidak aman dan nyaman bagi pekerja. Kata Kunci: RWL, Indeks Lifting
  50. 50. 51Jurnal Ilmiah Teknosains Volume 1 Nomor 16 ABSTRACT RWL is one kind of methods to measure and analyze work of load of operators in manual material handling. Purpose of this measure weather the work of load operator are enough secure to subject or not, which that kind job did for one shift, and to make sure are this job suitable form healthy and safety regulation regionally or internationally. This research are held in one of metal stamping company which supply motor cycle component to its customer, and in stamping production still use manual handling of work in process resulted from stamping machine. Calculation of RWL are using different distance of movement work pieces from the original distance, and result of RWL calculation has different value from different distance although there are slight different value between them. The value of lifting index lies between 3.335-3.670. This value greater from standard lifting index as internationally are 1. So, we can conclusion that the job is not comfort and safe for operator. Key Word: RWL, Lifting Index 1. PENDAHULUAN 1.1. Latar Belakang Pemindahanbebankerjasecaramanualmasihseringdilakukanoleh hampir semua bidang pekerjaan, terutama pekerja yang posisinya sebagai operator produksi dan bagian gudang. Pemindahan barang tersebut membutuhkan tenaga yang dikeluarkan oleh pekerja, baik bebanringanataupunberat.Besarkecilnyabebanmasihmerupakan keputusan subjektif oleh pihak manajemen terhadap para pekerja, sehingga tidak heran ketidak-objektifan tersebut membawa dampak yang sangat serius terhadap pekerja manakala beban kerja yang harus dipindahkan tidak sesuai dengan kemampuan dan batasan kerja operator berupa sering sakitnya operator, turn over operator yang tinggi, tingkat produktivitas yang rendah, dan pada giliranya dapat mengganggu pencapaian produktivitas secara keseluruhan. Nurmianto (2008) menyatakan bahwa kecelakaan pada saat melakukan pemindahan secara manual 93% diantaranya diakibatkan oleh strain (rasa nyeri yang berlebihan) sedangkan 5% lainnya pada hernia. Dari data, 61% pada strain di antaranya pada
  51. 51. 52Jurnal Ilmiah Teknosains Volume 1 Nomor 16 bagian punggung. Salah satu perusahaan yang bergerak di bidang industri otomotif, PT XYZ di Cikarang mengirimkan WIP (Work In Process) ke perusahaan perakitan unit sepeda motor. WIP yang dikirimkan ke customer masih dalam bentuk blanking (lembaran) yang kemudian di-roll dan dijadikan komponen muffler. WIP dihasilkan melalui proses blanking pada mesin stamping yang prosesnya dilakukan secara kontinu menggunakan sistem coiler dan uncoiler, akan tetapi untuk pemindahan hasil produksi (wip) masih dipindahkan secara manual dari mesin stamping ke palet-palet yang sudah disiapkan sebelumnya. Proses pemindahan secara manual ini dapat berakibat pada keluhan yang disampaikan oleh operator, yang merasa sakit dan ngilu pada bagian punggung dan lengan disebabkan oleh pengangkatan material blanking sebanyak 12 kg secara terus- menerus dan hanya diselingi waktu istirahat normal dan istirahat tersembunyi selama 8 jam kerja. Siska dan Teza (2012) dalam melakukanpenelitianpadahandlingdipabrikbatubatamenemukan indek LI = 1,56, sementara Elfetuori dan Taboun (2002) dalam risetnya menghasilkan lifting yang jauh dari kenormalan yaitu: 2,56- 5,33 LI dengan sudut perpindahan yang berbeda-beda. Muslimah et. al. (2006) dalam peneleitian pengkatan manual di pergudangan Bulog menghasilkan indeks LI sebesar 8,87 – 10,7. Dan Setiadi et. al. (2013) pada pengangkatan batako diketemukan nilai LI berkisar 2,94-3,25. Berdasarkan latar belakang di atas maka tujuan penelitian ini adalah sebagai berikut: Menghitung nilai RWL dan indeks LI (Lifting Index) pada proses pengangkatan secara manual di proses blanking pada ketinggian palet yang berbeda Merokemendasikan usulan perbaikan agar nilai indeks (LI) berada dalam batas aman. 2. TINJAUAN PUSTAKA
  52. 52. 53Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Menurut Nurmianto (2008) pemindahan bahan secara manual apabila tidak dilakukan secara ergonomis akan menimbulkan kecelakaan dalam industri. Kecelakaan industri (industrial accident) yang disebut sebagai “over-exerting – lifting and carrying” yaitu kerusakan jaringan tubuh yang diakibatkan oleh beban angkat yang berlebih. Data mengenai insiden tersebut telah mencapai angka rata-rata 18% dari seluruh kecelakaan selama tahun 1982- 1985 menurut data statistik tentang kompensasi pekerja di negara bagian New South Wales, Australia. Dari data kecelakaan ini, 93% di antaranya diakibatkan oleh strain (rasa nyeri yang berlebihan) sedangkan 5% lainnya pada hernia. Dari data strain, 61% di antaranya berada pada bagian punggung. Sastrowinoto (1985) menyatakan bahwa kerja berdiri harus menyediakan ruang bagi peralatan, perkakas dan lain-lain hingga gerakan-gerakan tidak terhalang. Jika kerja berdiri memerlukan tenaga otot pada bagian atas (menyangkut komponen berat), menekan keras ke bawah selama merakit dan sebagainya maka ketinggian bangku harus lebih rendah. Pernyataan tersebut sangat cocok pada pekerjaan pengangkatan material blanking yang cukup berat dilakukan oleh operator produksi. Sehingga perlu desain bangku kerja yang lebih baik untuk menurunkan tingkat kelelahan pekerja. BatasanbebanyangbolehdiangkatmenurutNurmianto(2008) sebagai berikut: a. Batasan Legal (legal limitations) b. Batasan Biomekanika (biomechanical limitations) c. Batasan Fisiologi (physiological limitations) d. Batasan Psiko-fisik (psyco – physical limitations) a. Batasan Angkat secara Legal Dalamrangkauntukmenciptakansuasankerjayangamandansehat maka perlu adanya suatu batasan angkat bagi operator. Batasan angkat ini ini dipakai sebagai batasan angkat secara internasional. Adapun variabelnya sebagai berikut:
  53. 53. 54Jurnal Ilmiah Teknosains Volume 1 Nomor 16 1. Pria dibawah usia 16 tahun, maksimum angkat adalah 14 Kg 2. Pria usia antara 16 dan 18 tahun, maksimum angkat 18 Kg 3. Pria usia lebih dari 18 tahun, tidak ada batasan angkat 4. Wanita usia antara 16 tahun dan 18 tahun, maksimum angkat 11 Kg 5. Wanita usia lebih dari 18 tahun, maksimum angkat 16 Kg Batasan-batasanangkatinidapatmembantuuntukmengurangi rasa nyeri, ngilu pada tulang belakang bagi wanita. Batasan angkat ini akan mengurangi ketidakyamanan kerja pada tulang belakang, terutama bagi operator pekerja berat. Tabel 1. Tindakan yang harus dilakukan berdasarkan batasan angkatnya b. Batasan angkat dengan menggunakan Biomekanika Nilai dari analisa biomekanika adalah rentang postur atau posisi aktivitas kerja, ukuran beban dan ukuran manusia yang dievaluasi. Sedangkan kriteria keselamatan adalah berdasar pada beban tekan (compression load) pada intervertebral disk antara lumbar nomor lima dan sacrum nomor satu (L5/S1).
  54. 54. 55Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 1 menunjukan cara pemberian nomor pada vertebal disk. Analisa dari berbagai macam pekerjaan yang menunjukan rasa nyeri (ngilu) berhubungan erat dengan kompresi (tekan) yang terjadi pada L5/S1, demikian kata Chaffin dan Park (1973). Telah ditemukan pula bahwa 85-95% dari penyakit hernia pada disk terjadi dengan relative frekuensi L4/L5 dan L5/S1. L4/L5 adalah intervetebral disk yang berada di lumbar ke-4 dan ke-5, sedangkan L5/S1 adalah intervetebral disk yang berada di antara lumbar Ke-5 dan sacrum. Kebanyakan penyakit-penyakit tulang belakang adalah merupkan hernia pada intervetebral disk yaitu keluarnya inti intervetebral (pulpy nucleus) yang disebabkan oleh rusaknya lapisan pembungkus intervetebral disk bagian belakang seperti digambarkan pada gambar adalah menekan pada dan mengiritasi akar syaraf dan menyebabkan rasa sakit yang kronis. Rasa sakit tersebut disebabkan oleh “slipped disc”. Gambar 1. Klasifikasi dan kodifikasi pada vertebrae c. Batasan Angkat secara Fisiologis Metode pendekatan ini dengan mempertimbangkan rata-rata beban metabolisme dari aktivitas angkat yang berulang–ulang (repetitive lifting), sebagaimana dapat juga ditentukan dari jumlah konsumsioksigen.Haliniharusbenar–benardiperhatikanterutama dalam rangka untuk menentukan batasan angkat. Kelelahan kerja akibat aktivitas yang berulang-ulang (repetitive lifting) akan meningkatkan resiko rasa nyeri pada tulang belakang (back injuries). Repetitive lifting dapat menyebakan Cumulative Trauma Injuries atau Repetitive Strain Injuries.
  55. 55. 56Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Ada beberapa bukti bahwa semakin banyak jumlah material yang diangkat (dan dipindahkan) dalam sehari oleh seseorang, maka akan lebih cepat mengurangi ketebalan dari intervetebral disk atau elemen yang berada di antara segmen tulang belakang. Fenomena ini menggambarkan bahwa pengukuran yang akurat terhadap tinggi tenaga kerja dapat digunakan sebagai alat untuk mengevaluasi beban kerja. Metode lain secara fisiologis adalah dengan cara pengukuran langsung terhadap tekanan yang ada di dalam perut atau IAP ( Intra Abdominal Pressure) selama aktivitas angkat. d. Batasan Angkat secara Psiko-fisik Metode ini berdasarkan pada sejumlah eksperimen yang berupaya untuk mendapatkan berat pada berbagai keadaan dan ketinggian badan yang berebeda–beda. Metode ini dirangkumkan oleh Snook (1978) dalam Nurmianto (2008) dikatakan bahwa: “Para pekerja memonitor perasaanya masing-masing dan mengatur berat beban sampai menunjukan kemampuan angkat maksimum.” Kemudian aktivitas angkat yang riil diterapkan dengan melibatkan para pekerja industri pada eksperimen tersebut. Ada tiga macam kategori posisi angkat yang didapatkan yaitu: 1. Dari permukaan lantai ke ketinggian genggaman tangan (knuckle height) 2. Dari ketinggian genggaman tangan ( knuckle height) ke ketinggian bahu (shoulder height) 3. dari ketinggian bahu (shouder height) ke maksimum jangkauan tangan vertikal (vertical arm reach) SebuahtabelyangditemukanolehSnokdaneksperimenyatelah mendapatkan rekomendasi dari NH dan MRC (the National Health and Medical Research Council). Batasan-batasan ini mempunyai kelebihan dalam kondisi yang nyata pada populasi tenaga kerja tertentu.
  56. 56. 57Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Tabel 2. Batasan Angkat secara psiko-fisik Tabel 3. Berat beban yang ditolerir untuk aktivitas angkat yang sering
  57. 57. 58Jurnal Ilmiah Teknosains Volume 1 Nomor 16 2.1. Recommended Weight Limit (RWL) Dan LI Recommended Weight Limit (RWL) adalah nilai beban angkat teoritis yang disarankan untuk pekerjaan mengangkat beban secara manual. Rumus perhitungan dari RWL adalah sebagai berikut : RWL = LC x HM x VM x DM x AM x FM x CM di mana: LC = Konstanta Beban (Lifting Constanta) = 23 Kg HM = Faktor Pengali Horizontal (Horizontal Multiplier) = 25/H H = Jarak Horizontal antara mata kaki dan material yang akan diangkat (cm) VM = 1 - 0.003 [ V- 69 ] = Faktor Pengali Vertikal (Vertical Multiplier) V = Jarak Vertikal antara Posisi awal beban dengan posisi beban pada saat diangkat (cm) DM = 0,82 + ( 4,5/D ) = Faktor Pengali Jarak (Distance Multiplier) D = Jarak ditempuh seseorang saat melakukan aktivitas memindahkan material (cm) AM = 1 - { 0,0032 A } = Faktor Pengali Asimetri (Assimetry Multiplier)
  58. 58. 59Jurnal Ilmiah Teknosains Volume 1 Nomor 16 A = Sudut Puntir FM = Faktor Pengali Frekuensi CM = Faktor Pengali Kopling (Coupling qppooplier) Gambar 2. Representasi Pengangkatan Vertikal
  59. 59. 60Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Tabel 4. Faktor pengali kopling Tabel 5. Faktor pengali frekwensi
  60. 60. 61Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Untuk pekerja Indonesia, terdapat perbedaan dalam menentukan VM dan AM. Untuk VM VM = 1 – 0.0132 (V-69) untuk pengangkatan dengan ketinggian awal di atas 69 cm VM = 1 – 0.0145 (69-V) untuk pengangkatan dengan ketinggian awal di bawah 69 cm Untuk AM AM = 1 – (0.005 A) untuk 0o ≤ A ≤ 30o AM = 1 – (0.0031 A) untuk 30o < A ≤ 60o AM = 1 – (0.0025 A) untuk A > 60o A merupakan sudut asimetrik yang merupakan sudut yang dibentuk antara garis asimetrik dan pertengahan garis sagital. Garis Asimetrik adalah garis horizontal yang menghubungkan titik tengah garis yang menghubungkan kedua mata kaki bagian dalam dan proyeksi titik tengah beban pada lantai. Garis Sagital adalah garis yang melalui titik tengah kedua mata kaki bagian dalam dan berada pada bidang sagital. Bidang sagital adalah bidang yang membagi tubuh menjadi dua bagian, kanan dan kiri, saat posisi tubuh netral (tangan berada di depan tubuh dan tidak ada perputaran pada bahu dan kaki). Perancanganworkspaceharusmemperhatikanbatasan-batasanini, karena faktor jarak perpindahan dan tinggi benda kerja merupakan salah satu faktor yang berpengaruh terhadap RWL.
  61. 61. 62Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 2. Representasi dari sudut asimetrik 3. METODOLOGI PENELITIAN Mempelajari kondisi pekerjaan dan proses stamping yang ada di perusahaan tersebut, melihat kondisi awal operator dalam melakukan pekerjaannya, sistem yang digunakan dalam hal ini handling material atau wip, dan bagaimana cara penempatannya, kemudian melakukan pengambilan variabel-variabel yang mempengaruhi nilai Lifting Index (LI), dan dilakukan perhitungan variabel tersebut dengan menggunakan metode RWL, sehingga menghasilkan nilai beban dari pekerjaan yang dianalisa.
  62. 62. 63Jurnal Ilmiah Teknosains Volume 1 Nomor 16 4. HASIL DAN PEMBAHASAN 4.1. Pengumpulan Data Pengumpulan data dilakukan pada saat operator melakukan proses kerja blanking, pada proses ini dilakukan secara kontinu, operator pertama sebagai kontrol terhadap parameter mesin dengan selalu memantau monitor/kontrol panel untuk mengetaui parameter proses. Sementara, operator kedua sebagai helper yang berfungsi memindahkanmaterialhasilprosesblankkedalampalet-paletyang sudah disiapkan sebelumnya. Pemindahan wip tersebut dilakukan
  63. 63. 64Jurnal Ilmiah Teknosains Volume 1 Nomor 16 sepanjang waktu kerja dengan data sebagai berikut: 1. Berat benda kerja 1 lembar/sheet = 1.2 kg 2. 1 kali angkat 10 sheet atau setara dengan 1.2 x 10 = 12 kg per sekali angkat 3. Sudut perputaran operator 90 derajat 4. Jarak perpindahan dari titik awal ke tempat tujuan adalah ( 110 – 30 cm ) = 80 cm 5. Material dipindahkan ke dalam palet dan ditumpuk dalam satu palet dengan jumlah per palet sebanyak 250 sheet atau material, dan operator forklift akan memindahkan palet yang sudah terisi material/wip sebanyak 3 palet ke tempat penyimpanan sementara sebelum dikirim ke customer untuk dilakukan proses selanjutnya. Dan siklus ini dilakukan terus sepanjang waktu kerja selama 8 jam kerja 6. Perbedaanjarakperpindahanantarapaletke-1sampaipallet ke-3 membuat perhitungan RWL antara tempat material tersebut akan berbeda, sehingga perhitungan RWL akan mengambil semua jarak perpindahan vertikal semua palet 7. Frekuensi angkat: banyaknya jumlah pengangkatan dalam per menitnya dapat dilakukan perhitungan sebagai berikut: a. Banyaknya hasil produksi dalam 1 jam adalah 1000 pcs. b. 1 kali angkat sebanyak 10 pcs. c. Frekuensi angkat dalam 1 jam = 1000/10 = 100 kali per jam d. Frekuensi angkat dalam 1 menit = 100/60 = 1.67 atau 2 kali angkat dalam 1 menit. 4.2. Perhitugan RWL A. Perhitungan RWL untuk jarak palet (110 – 15 cm) = 95 cm
  64. 64. 65Jurnal Ilmiah Teknosains Volume 1 Nomor 16 RWL = LC x HM x VM x DM x AM x FM x CM Di mana: LC = 23 Kg HM = 25/H = 25 / 30 = 0.8333 H = 30 cm VM = 1 - 0.0132 [ V- 69 ] = 1 – 0.0132 [ 110- 69 ] = 1 – 0.0132[ 41 ] = 0.459 DM = 0,82 + ( 4,5/D ) = 0.82 + (4.5/95) = 0.820 AM = 1 - { 0,0025 A } = 1 - { 0,0025 * 90} = 0.775 FM = 0.65 CM = 0.90 RWL = LC x HM x VM x DM x AM x FM x CM = 23 x 0.8333 x 0.459 x 0.820 x 0.775 x 0.65 x 0.90 = 3,270 Lifting Index = L / RWL
  65. 65. 66Jurnal Ilmiah Teknosains Volume 1 Nomor 16 = 12 / 3,270 = 3,670 B. Perhitungan RWL untuk jarak palet ( 110 – 35 cm ) = 75 cm RWL = LC x HM x VM x DM x AM x FM x CM Di mana : LC = 23 Kg HM = 25/H = 25 / 30 = 0.8333 H = 30 cm VM = 1 - 0.0132 [ V- 69 ] = 1 – 0.0132 [ 110- 69 ] = 1 – 0.0132[ 41 ] = 0.459 DM = 0.82 + ( 4,5/D ) = 0.82 + (4.5/75) = 0.880 AM = 1 - { 0,0025 A } = 1 - { 0,0025 * 90} = 0.775 FM = 0.65 CM = 0.90
  66. 66. 67Jurnal Ilmiah Teknosains Volume 1 Nomor 16 RWL = LC x HM x VM x DM x AM x FM x CM = 23 x 0.8333 x 0.459 x 0.880 x 0.775 x 0.65 x 0.90 = 3,510 Lifting Index = L / RWL = 12 / 3,510 = 3,419 C. Perhitungan RWL untuk jarak palet ( 110 – 55 cm ) = 55 cm RWL = LC x HM x VM x DM x AM x FM x CM Di mana: LC = 23 Kg HM = 25/H = 25 / 30 = 0.8333 H = 30 cm VM = 1 - 0.0132 [ V- 69 ] = 1 – 0.0132 [ 110- 69 ] = 1 – 0.0132 [ 41 ] = 0.459 DM = 0.82 + ( 4,5/D ) = 0.82 + (4.5/55) = 0.902
  67. 67. 68Jurnal Ilmiah Teknosains Volume 1 Nomor 16 AM = 1 - { 0,0025 A } = 1 - { 0,0025 * 90} = 0.775 FM = 0.65 CM = 0.90 RWL = LC x HM x VM x DM x AM x FM x CM = 23 x 0.8333 x 0.459 x 0.902 x 0.775 x 0.65 x 0.90 = 3,598 Lifting Index = L / RWL = 12 / 3,598 = 3,335 5. ANALISA DAN KESIMPULAN Pehitungan RWL dilakukan dengan menggunakan jarak perpindahan material yang berbeda-beda, hal ini sesuai dengan proses kerja yang dilakukan oleh operator yang menempatkan material blanking pada palet yang berbeda yang terdiri dari tiga palet dengan ketinggian palet masing-masing sebesar 15, 25, dan 35, dari pengukuran tersebut didapat nilai Lifting Index untuk perbedaan jarak perpindahan sebagai berikut: 1. Untuk jarak perpindahan 95 cm menghasilkan nilai Load Index = 3,670 2. Untuk jarak perpindahan 75 cm menghasilkan nilai Load Index = 3,419 3. Untuk jarak perpindahan 55 cm menghasilkan nilai Load Index = 3,335
  68. 68. 69Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Dapat dilihat ada perbedaan nilai indeks lifting (LI) atas penempatan material blanking pada ketinggian palet yang berbeda walaupun perberdaanya tidak signifikan. Akan tetapi dapat disimpulkan bahwa pekerjaan tersebut sangat tidak aman dan nyaman dilakukan oleh operator, apalagi dilakukan selama rentang waktu yang sangat panjang. Kondisi seperti tersebut di atas dapat menyebabkan kondisi yang tidak sehat bagi pekerja yang berakibat pada kesehatan yang menurun, ada beberapa hal yang harus dilakukan oleh perusahaan untuk melakukan perbaikan sistem dan kondisi kerja sehingga nilai indeks lifting-nya masuk ke dalam batas normal atau dibawah nilai 1, dengan melakukan reduksi terhadap beban berat yang harus diangkat oleh operator dan membuat alat/tool yang dapat meringankan pekerjaan handling tersebut, akan tetapi dalam penelitian ini tidak melakukan perhitungan ulang terhadap nilai LI setelah dilakukan reduksi, baik berat material maupun jarak perpindahan material. DAFTAR PUSTAKA Budiman, Eka, Setyaningrum, Ratih. Perbandingan Metode- Metode Biomekanika untuk menganalisa Postur pada aktivitas Manual Material Handling Mas’idah, Eliah., Fatmawati, Wiwiek., Ajibta, Lajib. Analisa Manual Material Handling (MMH) dengan menggunakan metode Biomekanika untuk mengidentifikasi resiko cidera tulang belakang (Musculoskelestal Disorder) Sultan Agung, Vol XLV No. 119 September-November 2009 Nurmianto, Eko (2008). Ergonomi, Konsep Dasar dan Aplikasinya. Penerbit Guna Widya. Sanjaya, AA. Aplikasi Recomended Weigth Limit (RWL) dalam perbaikan cara pengangkatan. Unitas, Vol.2, No.10, Maret 2002
  69. 69. 70Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Sastrowinoto, Suyatno (1985). Meningkatkan Produktivitas dengan Ergonomi, Penerbit Pustaka Binaman Pressindo Setiadi, MY., Poerwanto, Anizar. Usulan Alat Bantu Pemindahan Batako untuk mengurangi resiko Muskuloskeletal Disorder di PT. XYZ. E-journal Teknik Industri FT USU Vol 1, No.3, pp.33-37, April 2013 Siska, Mery dan Teza, Multy. Analisa Posisi Kerja Pada proses Pencetakan Batu Bata mengggunakan Metode NIOSH. Jurnal Teknik Industri, Vol. 1, No.1, Juni 2012
  70. 70. 71Jurnal Ilmiah Teknosains Volume 1 Nomor 16 REKAYASA MENINGKATKAN EFEKTIFITAS MESIN DIE CASTING DENGAN MENGGUNAKAN PERHITUNGAN OEE (OVERALL EQUIPMENT EFFECTIVENESS) DI PT ABCD Susiyanti Nurjanah, Miftahul Imtihan, Suwaryo Nugroho Jurusan Teknik Industri Sekolah Tinggi Teknologi Muhammadiyah Cileungsi ABSTRAK Dalam membuat produk yang baik dan ketepatan waktu dalam menyelesaikan produksi, dibutuhkan performance mesin maupun peralatan yang baik untuk menunjang kelancaran proses produksi, dan suatu perusahaan memerlukan manajemen perawatan dalam mengukur efektifitas mesin tersebut. Overall Equipment Effectiveness(OEE) merupakan suatu metode yang digunakan untuk mengukur efektifitas suatu mesin atau peralatan untuk mendapatkan nilai OEE maka diperlukan 3 (tiga) nilai yaitu Availbility, Performance Efficiency dan Rate of Quality. Kendala yang kerap terjadi pada mesin di PT. ABCD ini adalah sering terjadi kerusakan mesin yang secara tiba-tiba dan hasil perhitungan OEE bulan Juli 2015 s.d Desember 2015 dengan rata- rata nilai 72%. Dan nilai tersebut masih dibawah dengan standar yang ditetapkan oleh JIMP (Japan Institute of Plant Maintenance)& Wolrd Class yaitu 85%, hasil dari analisa six big losses yang mempengaruhi Performance Efficiency adalah Reduced Speed Losess (Penurunan waktu Produksi). Kata kunci : OEE, TPM, Efektifitas Mesin
  71. 71. 72Jurnal Ilmiah Teknosains Volume 1 Nomor 16 1. LATAR BELAKANG Dalam mengevaluasi dan mengukur sejauh mana keberhasilan penerapanTPM(TotalProductiveMaintenace),alatpengukurutama yang digunakan adalah OEE (Overall Equipment Effectiveness). OEE adalah suatu cara untuk mengukur kinerja mesin produksi dalam penerapan program TPM (Total Productive Maintenance). Pengukuran kinerja dengan OEE (Overall Equipment Effectiveness) terdiri dari 3 (tiga) komponen utama pada mesin produksi yaitu Availability (Waktu Kesediaan Mesin). Performance (Jumlah Unit yang diproduksi) dan Quality (Mutu yang dihasilkan). PT. ABCD merupakan salah satu perusahaan manufacturing yangbergerakdalambidangDieCastingAlumunium&Zinc,istilahdie casting dalam industri dapat diartikan sebagai proses pengecoran metal dan non metal. Pada PT. ABCD sering ditemukan beberapa masalah seperti tingkat kerusakan mesin yang cukup tinggi (Breakdown). Sudah saatnya PT. ABCD menata ulang konsep dan sistem maintenance, dimana konsep dan sistem yang baru tersebut tidak hanya mampu memastikan bahwa Equipment yang dimiliki dapat menghasilkan kualitas yang baik tetapi juga dapat mengukur efisiensi secara menyeluruh dari Equipment maupun fasilitas yang dimiliki serta dapat mengidentifikasi masalah serta memberikan ide perbaikan yang dapat dilakukan. 2. Pengertian Total Productive Maintenance Metode pemeliharaan ini merupakan pengembangan dari metode Productive Maintenance metode yang diterapkan di Amerika, yang telah dimodifikasi sesuai kebudayaan Jepang. Karena TPM merupakan pengembangan dari PM, maka TPM dapat diartikan sebagaiProductiveMaintenanceyangmelibatkanpartisipasiseluruh bagian TPMadalahsuatumetodeyangbertujuanuntukmemaksimalkan efisiensi penggunaan peralatan, dan memantapkan sistem perawatan preventif yang dirancang untuk keseluruhan peralatan dengan mengimplementasikan suatu aturan dan memberikan
  72. 72. 73Jurnal Ilmiah Teknosains Volume 1 Nomor 16 motivasi kepada seluruh bagian yang berada dalam suatu perusahaan tersebut, melalui peningkatan komponensipasi dari seluruh anggota terlibat mulai dari manajemen puncak sampai kepada level terendah TPM adalah operator produksi dilibatkan dalam kegiatan memelihara mesin dalam batas-batas tertentu tanpa menganggu kerja utamanya sebagai operator mesin. Pada awalnya apa yang dikerjakan oleh operator dalam kegiatan Total Productive Maintenance mendapat bimbingan dan dididik oleh pihak departemen pemeliharaan. Kata “total” sendiri dalam TPM memiliki tiga pengertian yang digambarkan pada lima elemen TPM yang telah disebutkan sebelumnya, yaitu (Seiichi, 1988:11) : 1. Efektivitas total (Total Effectiveness) mengacu pada poin 1 menunjukkan effisiensi ekonomis atau profitabilitas. 2. Sistem pemeliharaan (Total Maintenance System) point 2 meliputi Maintenance Prevention (MP) dan Maintainability Improvement (MI) demikian juga Preventive Maintenance (PM). 3. Partisipasi total dari seluruh karyawan (Poin 3,4, dan 5) meliputi pemeliharaan mandiri oleh operator melalui kelompok kerja. 2.1. Pengertian Overall Equipment Effectiveness (OEE) Overall Equiptment Effectiveness (OEE) adalah metode pengukuran efektivitas penggunaan suatu peralatan. OEE dikenal sebagai salah satu aplikasi program Total Productive Maintenance (TPM). Overall Equiptment Effectiveness (OEE) juga merupakan produk dari six big losess mesin dan peralatan. Keenam faktor dalam six big losess dapat dikelompokkan menjadi 3 (tiga) dalam OEE untuk dapat digunakan dalam mengukur kinerja mesin/peralatan yakni, downtime losess, speed losess dan defect losess seperti dapat dilihat pada gambar dibawah ini:
  73. 73. 74Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 2.1. Overall Equipment Effectiveness and Goals Gambar diatas adalah menunjukan rumus bagaimana cara penghitungan OEE, Dan untuk standar benchmark world class yang dianjurkan JIPM, yaitu OEE = 85%, Tabel 2.1 menunjukkan skor yang perlu dicapai untuk masing-masing faktor OEE. OEE Factor World Class Availability 90.0% Performance 95.0% Quality 99.9% OEE 85.0% Tabel 2.1 World Class OEE Sumber: www.oee.com/world-class-oee.html Tabel diatas menunjukan nilai OEE nilai standar benchmark
  74. 74. 75Jurnal Ilmiah Teknosains Volume 1 Nomor 16 world class yang dianjurkan JIPM, Overall Equipment Effectiveness (OEE) adalah “praktek terbaik” matriks yang mengidentifikasi presentase (%) waktu produksi yang direncanakan yang benar- benar produktif. Secara garis besar OEE sebagai patokan yang dapat digunakan untuk membandingkan kinerja mesin produksi yang diberikan kepada standar industri. OEE juga merupakan alat ukur untuk mengevaluasi dan memperbaiki cara yang tepat untuk menjamin peningkatan produktivitas penggunaan mesin/peralatan. Formula matematis dari OEE (Overall Equipment Effectiveness) di rumuskan sebagai berikut: OEE = Availability x Performance efficiency x Rate of quality product x 100% 1. Mengukur Availability 2. Mengukur Performance Efficiency Net operation rate merupakan perbandingan antara jumlah produk yang diproses (processed amount) dikali actual cycle time dengan operation time. Net operation time berguna untuk menghitung rugi-rugi yang diakibatkan oleh minor stoppages dan menurunnya kecepatan produksi (reduced speed) Tiga faktor penting yang dibutuhkan untuk menghitung performance efficiency : a. Ideal cycle (waktu siklus ideal/waktu standar)
  75. 75. 76Jurnal Ilmiah Teknosains Volume 1 Nomor 16 b. Processes amount (jumlah produk yang diproses) c. Operation time (waktu operasi mesin) Performance efficiency dapat dihitung sebagai berikut: 3. Mengukur Rate of Quality Product 2.2. Six Big Losess Kegiatan dan tindakan-tindakan yang dilakukan dalam TPM tidak hanya berfokus pada pencegahan terjadi kerusakan pada mesin/ peralatan dan meminimalkan downtime mesin/peralatan. Akan tetapi banyak faktor yang dapat menyebabkan kerugian akibat rendahnya efisiensi mesin/peralatan saja. Rendahnya produktivitas mesin/peralatan yang menimbulkan kerugian bagi perusahaan sering diakibatkan oleh penggunaan mesin/peralatan yang tidak efektif dan efisiensi terhadap enam faktor yang disebut enam kerugian besar (six big losses). Adapun enam kerugian besar (six big losess) tersebut adalah sebagai berikut: a. Downtime (penurunan waktu) 1. Equipment failure/breakdown (Kerugian karena kerusakan) 2. Set-up and adjusment (Kerugian karena pemasangan dan penyetelan) b. Speed losess (penurunan kecepatan) 1. Idling and minor stoppages (kerugian karena beroperasi tanpa beban maupun berhenti sesaat)
  76. 76. 77Jurnal Ilmiah Teknosains Volume 1 Nomor 16 2. Reduced speed (kerugian karena penurunan kecepatan produksi) c. Defect (cacat) 1. Process defect (kerugian karena produk cacat maupun karena kerja produk diproses ulang). 2. Reduced yieled losess (kerugian pada awal waktu produksi hingga mencapai waktu produksi yang stabil). 3. METODOLOGI PENELITIAN Penelitian ini dilakukan dengan pengamatan langsung untuk mengetahui kondisi pengoperasian mesin Die Casting dan mengetahui hal-hal yang terkait perhitungan OEE. 3.1. Pengumpulan data Kegiatan yang dilakukan dalam pengumpulan data, melakukan pengamatan langsung kebagian produksi casting melihat cara proses kerja mesin die casting 04, mengambil nilai cycle time pada proses produksi, breakdown mesin, set-up mesin, total output produk dan melihat waktu operasi mesin secara langsung. 4. LAPORAN HASIL Di bawah ini adalah data bulanan mesin die casting selama 6 bulan Tabel 4.1 Tabel Jam kerja Mesin Die Casting 1 Juli 20910 19610 0 390 0,38 1327 2 Agustus 30750 30750 840 360 0,75 674 3 September 30750 16710 0 510 0,57 1370 4 Oktober 30750 16710 0 415 0,43 893 5 November 30750 10410 0 420 0,43 859 6 Desember 30750 26610 0 350 0,53 2400 No Bulan Planning Jam Kerja Mesin (Menit) Actual Jam Kerja Mesin (Menit) Overtime (Menit) Waktu Set-up Mesin (Menit) Cycle Time (Menit) Breakdown Mesin (Menit)
  77. 77. 78Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Tabel 4.2 Tabel data produksi dan NG produksi 4.1. HASIL PEMBAHASAN a. Pengukuran Nilai Availability Availability yaitu menunjukan penggunaan waktu yang tersedia untuk kegiatan operasi mesin atau peralatan. Adapun data-data yang digunakan dalam pengukuran Avaibility ini adalah Jam actual kerjamesin,Downtime(FailureandrepairdanSetupAndAdjusment). Dan rumus yang digunakan untuk mencari Availability adalah: Tabel 4.3 Tabel Nilai Availability 2015 JULI 91% AGUSTUS 97% SEPTEMBER 90% OKTOBER 92% NOVEMBER 88% DESEMBER 90% BULAN AVAILABILITY 1 Juli 36458 1227 2 Agustus 32148 1226 3 September 32148 1358 4 Oktober 29902 1355 5 November 14420 850 6 Desember 42070 2568 Total Produksi (pcs) Total Produksi NG (pcs) No Bulan
  78. 78. 79Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Tabel diatas menerangkan Nilai Avaibility yang telah dihitung berdasarkan dari data produksi pada bulan Juli sampai Desember 2015 Gambar 4.1 Grafik Data Availability b. Pengukuran Nilai Performance Performance adalah nilai yang menunjukan keampuan peralatan dalam menghasilkan barang. Adapun data-data yang digunakan dalam pengukuran nilai performance ini adalah Output, Cycle Time, Operating Time (Loading Time, Failure and Set up Adjusment), dan rumus yang digunakan untuk mencari nilai performance sebagai berikut: Tabel 4.4 Tabel Nilai Peformance Bulan Peformance Juli 78% Agustus 79% September 97% Oktober 83% November 68% Desember 93%
  79. 79. 80Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Tabel diatas menerangkan Nilai Peformance yang telah dihitung berdasarkan dari data produksi pada bulan Juli sampai Desember 2015. Gambar 4.2 Grafik Data Performance c. Pengukuran Nilai Quality Rate Quality rate adalah nilai yang menunjukkan kemampuan peralatan dalam menghasilkan produk yang sesuai dengan standar. Adapun data-data yang digunakan dalam pengukuran quality rate adalah output, dan reject, dan rumus yang digunakan untuk mencari quality rate sebagai berikut :
  80. 80. 81Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Bulan Quality Rate Juli 97% Agustus 96% September 96% Oktober 95% November 94% Desember 94% Tabel 4.5 Tabel data Quality Rate Tabel diatas menerangkan Nilai Quality Rate yang telah dihitung berdasarkan dari data produksi pada bulan Juli sampai Desember 2015 Gambar 4.3 Grafik Data nilai Quality Rate d. Pengukuran Nilai OEE Setelah mendapatkan nilai availability, performance, dan quality diperoleh, maka selanjutnya adalah menghitung nilai OEE. OEE = Avaibility x Performance x Quality
  81. 81. 82Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Tabel 4.6 Tabel Data OEE Tabel diatas menerangkan Nilai OEE yang telah dihitung berdasarkan dari availbility, performance, quality rate pada bulan Juli sampai Desember 2015. Gambar 4.4 Grafik Data Nilai OEE Bulan Juli-Desember 2015 Bulan OEE Juli 69% Agustus 73% September 84% Oktober 73% November 56% Desember 79%
  82. 82. 83Jurnal Ilmiah Teknosains Volume 1 Nomor 16 5. KESIMPULAN Dalam usaha peningkatan produktivitas dan efisiensi pada mesin Die casting diperusahaan adalah dengan melakukan perhitungan OEE untuk mengetahui faktor-faktor dalam six big losses yang menjadi prioritas utama untuk dilakukan perbaikan pada mesin. Dari hasil analisa diagram sebab akibat yang dilakukan dapat dilihat pada faktor reduced speed losses merupakan faktor yang mempengaruhi rendahnya efektifitas mesin yang digunakan sehingga merupakan prioritas perusahaan untuk dilakukan perbaikan sebagai langkah awal dalam usaha peningkatan produktivitas dan efisiensi mesin Die casting, adapun penyelesaian masalah dapat dilakukan rekayasa sebagai berikut: 1. Sebaiknya perusahaan mebuat prosedur perawatan mesin berupa inspeksi dan pembersihan serta melakukan perawatan secara berkala, seperti: a. Melakukan pemeriksaan Plunger secara berkala, contoh 2 minggu sekali b. MelakukanpemeriksaanHousingsecaraberkala,contoh 1 minggu sekali c. Melakukan pengecekan pada tools yang ada pada dies secara berkala, contoh 2 minggu sekali d. Melakukan pembersihan mesin pada akhir proses agar sisa gram atau abu material tidak menempel pada bagian dies maupun mesin. Sedangkan untuk meningkatkan efektifitas mesin Die casting, penulis membuat form checklist untuk kegiatan maintenance yang dapat dilakukan bagian maintenance itu sendiri. Form checklist ini berfungsi sebagai pengingat untuk jangka waktu perawatan secara berkala dengan rekayasa sebagai berikut:
  83. 83. 84Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Gambar 5.1 Form Pemeriksaan Berkala Gambar diatas adalah rekayasa form pemeriksaan berkala dalam meningkatkan efektifitas mesin khususnya pada mesin Die casting. DAFTAR PUSTAKA Denso. (2006). Introduction to total productive maintenance. Study guide. Denso. Ginting Sherly Meylinda. 2007. “Usulan Perbaikan Terhadap Manajemen Perawatan Dengan Menggunakan Metode Total Productive Maintenance (TPM)” www.gunadara.ac.id/library/ articles/graduate/industrial.../artikel_31402176.pdf Kho Dickson. 2015. “ Manajemen Kualitas” www. ilmumanajemenindustri.com
  84. 84. 85Jurnal Ilmiah Teknosains Volume 1 Nomor 16 Kurniawan Fajar. 2013. “Manajemen Perawatan Industri”. Yogyakarta Graha Ilmu Leanindonesia.com. (2010, November 15). “OEE overall equipment effectiveness” [Web log post] Retrieved from http://www. leanindonesia.com/2010/11/oee-overall-equipment. Nakajima seiichi. 1988. “Introduction to Total Productive Maintenance (TPM)”, Cambrige Productivity Press Inc.
  85. 85. 86Jurnal Ilmiah Teknosains Volume 1 Nomor 16 1. Naskah diketik dengan 1 spasi pada kertas ukuran kuarto [8x11 inch] dan marjin kiri-kanan 3 cm dan atas bawah 3 cm. 2. Naskah dapat ditulis menggunakan bahasa Indonesia atau bahasa Inggris. 3. Panjang artikel ilmiah tidak lebih dari 7.500 kata atau 10-20 halaman kuarto. 4. Naskah yang terlalu panjang akan dikembalikan untuk dipersingkat. 5. Naskah dapat dikirim ke alamat redaksi melalui pos atau E-mail. Pengiriman mela- lui Pos harus menyertakan cetakan naskah sebanyak 2 eksemplar dan naskah dalam bentuk CD-R/CD-RW dalam format Microsoft Word. 6. Biodata dan alamat penulis perlu disertakan dalam lembar terpisah 7. Naskah yang dimuat diberikan cetak lepas sebanyak 10 eksemplar. 8. Naskah belum pemah dipublikasikan. Naskah berapa artikel konseptual memuat komponen: judul, nama penulis, abstrak dan kata-kata kunci, bagian pendahuluan, bagian inti, penutup/rangkuman/simpulan, daftar pustaka, dan tabel. 9. Naskah dapat berapa artikel hasil penelitian memuat komponen: judul, nama penu- lis, abstrak dan kata-kata kunci, bagian pendahuluan, metode penelitian/analisis, hasil pembahasan, simpulan dan saran, daftar pustaka, dan tabel. 10. Abstrak disusun kurang lebih 100 kata dalam bahasa Indonesia/Inggris. Daftar kata kunci (5 kata dan setiap kata tidak lebih dari 20 karakter) menunjukkan isi artikel. 11. Halaman depan naskah harus memuat identitas penulis secara jelas. 12. Catatan tambahan derivasi matematika/statistika untuk justifikasi semua karakter matematika/statistika yang dipakai di dalam artikel harus dikirim bersama artikel agar membantu penyunting ahli (catatan tambahan tidak dipublikasikan) 13. Diagram harus jelas digambar dengan label sumbu-sumbu dan skala sumbu yang disebut secara jelas. 14. Judul tabel harus jelas di dalam unit pengukuran, area geograpi tahun dasar untuk angka indeks, dan sumber daftar pustaka. 15. Rujukan dalam teks naskah dan daftar pustaka harus secara hati-hati dicermati dan lengkap dalam hal tahun dan tempat publikasi, gunakan konvensi teknik ilmiah (Sistem Nama dan Tahun). 16. Daftar Pustaka untuk Buku disusun dengan urutan: nama pengarang (nama paling belakang berada di depan dan diikuti oleh nama terdepan dst.), tahun penerbitan, judul lengkap, nama publikasi/penerbitan, kota. 17. Daftar Pustaka untuk Jurnal disusun menurut abjad nama pengarang dan urutan: nama pengarang, tahun penerbitan, judul lengkap, nama jurnal, volume, halaman, publikasi/penerbitan, kota. 18 Daftar Pustaka untuk skripsi/tesis/desertasi disusun dengan urutan: nama penga- rang, tahun lulus, judul skripsi/tesis/desertasi, publikasi/penerbitan, kota. CATATAN UNTUK KONTRIBUTOR

×