buletin pss

1,412 views

Published on

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
1,412
On SlideShare
0
From Embeds
0
Number of Embeds
3
Actions
Shares
0
Downloads
38
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

buletin pss

  1. 1. EDISI APRIL<br />2011<br />SIMPLE SCIENCE<br />INQUIRY MIND<br />ONE STEP FORWARD<br />ICE BREAKING<br />EPILOG<br />'TINTA'<br />BULETIN PSS<br />SMK LUNAS<br />SEGALA KARYA DAN HASIL IDEA ADALAH TERKANDUNG DALAM HAK CIPTA TERPELIHARA PUSTAKA AL-RAZI. ALL COPY RIGHT SERVED.<br />
  2. 2. ISI KANDUNGAN<br />
  3. 3. Daripada Abu Said Al-Khudrir.a. berkata : Rasulullah S.A.W. bersabda, “Orang yang berilmuitutidakakanpuasdarimencariilmu yang didengarinyasehinggaadalahkesudahannyaitudidalamsyurga.”<br />Daripada Abu Hurairahr.a. berkata : Rasulullah S.A.W. bersabda, “Tuntutlahilmudenganbersungguh-sungguh, dantentutelahbersamailmuituakanketenteramandankewibawaandanhendaklahkamubersifattawadhukbagi guru yang kamubelajarkepadanya.”<br />
  4. 4. AHLI JAWATANKUASA <br />PENGAWAS PUSAT SUMBER<br />SMK LUNAS SESI 2011<br />PENAUNG : EN. ABDUL RAZAK BIN MAT NOH<br />GURU PENASIHAT : PN. BARIZAH BT BAHAROM<br />PENGERUSI : NURAINI BT ABD RAHMAN<br />NAIB PENGERUSI : MUHAMAD KHAIRUL NA’IM BIN ABU HASAN<br />SETIAUSAHA : NUR SHAHIDATUL AKMAL BT MUSTAFA<br />PEN. SETIAUSAHA : NOR SALEHA BT IDRIS<br />BENDAHARI : LIM CAI ZHEN<br />SIDANG REDAKSI<br />KETUA PENGARANG: NUR AFIFAH BT HARON<br />FOTOGRAFI DAN SIBER: SITI NOR HAWA BT ABLAH <br />PRODUKSI & REKAAN: NADZIRAH BT AIHSAN<br /> WARTAWAN :AIMI FATIN BALQIS BT ABU BAKAR<br /> :NUR FATIN SAHIRA BT MOHD FAIDZAL<br />
  5. 5. SEKAPUR SIRIH<br />Salam ukhwah dan salam satu Malaysia diucapkan kepada semua pengguna Pusat Sumber Sekolah Menengah Kebangsaan Lunas. Terlebih dahulu saya mewakili semua ahli bidang redaksi yang terlibat dalam pengeluran buletin PSS edisi bulan Januari hingga Mac ini ingin merakamkan ucapan terima kasih di atas kepercayaan yang diberikan oleh Guru Pusat Sumber, Pn. Bariza Baharom. Beliau telah banyak membantu sepanjang pendokumentasian buletin ini. Semangat yang beliau tunjukan perlu dicontohi dalam dalam memberi nasihat dan pandangan bernas semasa kami mengumpul bahan dan artikal yang berkaitan. Selain itu, ucapan terima kasih juga ditujukan kepada semua ahli sidang redaksi yang telah bertungkus-lumus menjayakan pendokumentasian ini. Dalam keluaran sulung bagi tahun 2011 ini, buletin PSS memaparkan secara ringkas perihal kepelbagaian maklumat yang boleh didapati oleh pelajar mahupun guru sekolah ini. Keluaran kali ini meliputi skop pendidikan yang lebih luas sebagai usaha menarik minat warga SMK Lunas untuk pergi ke pusat sumber. Adalah diharapkan supaya pembaca dapat memanfaatkan buletin PSS ini dan menyedari bahawa pusat sumber merupakan gedung ilmu pengetahuan yang meliputi pelbagai aspek pendidikan. <br />“SELAMAT MEMBACA!”<br /> <br />NUR AFIFAH BT HARON<br />Ketua Pengarang,<br />TINTA, Buletin PSS<br />
  6. 6. NAMA: NURAINI ABD RAHMAN<br />TINGKATAN: 5 SC 1<br />TARIKH LAHIR: 17 JULAI 1994<br />JAWATAN: PENGERUSI <br />KOMEN: BERUSAHA MENCAPAI SESUATU YANG DIIMPIKAN. SEMOGA SEMUA PENGAWAS PERPUSTAKAAN DAPAT BEKERJASAMA DENGAN BAIK DAN APA YANG DIRANCANG BERJALAN DENGAN LANCAR. SAYA BERHARAP PENGAWAS PERPUSTAKAAN DAPAT MENJALANKAN AMANAH YANG DIBERIKAN DENGAN BAIK DAN PENUH DEDIKASI.<br />ICE BREAKING........!!!!<br />
  7. 7. NAMA: MUHAMAD KHAIRUL NA’IM B ABU HASAN<br />TINGKATAN: 5 SC 2<br />TARIKH LAHIR: 5 MEI 1994<br />JAWATAN: NAIB PENGERUSI<br />KOMEN: <br />SAYA BERHARAP PERPUSTAKAAN SEKOLAH SAYA AKAN LEBIH KONDUSIF DAN PROAKTIF. SAYA JUGA BERHARAP SEMUA AHLI PUSAT SUMBER AKAN MEMJALANKAN TUGAS DENGAN SEMPURNA. SELAIN ITU, SAYA BERHARAP SUASANA PERPUSTAKAAN AKAN LEBIH CERIA DAN MENARIK. <br />
  8. 8. NAMA: NUR SHAHIDATUL AKMAL BT MUSTAFA<br />TINGKATAN: 5 PA 1<br />TARIKH LAHIR: 15 JULAI 1994<br />JAWATAN: SETIAUSAHA<br />KOMEN: SAYA BERHARAP PARA PELAJAR YANG MENGGUNAKAN PUSAT SUMBER AKAN AKUR PADA PERATURAN YANG TELAH DITETAPKAN. SAYA HARAP PARA PELAJAR DAPAT MENDISIPLINKAN DIRI AGAR TIDAK MEWUJUDKAN KEKECOHAN DI DALAM PUSAT SUMBER. SELAIN ITU, SIFAT HORMAT-MENGHORMATI PELU DITANAM DALAM DIRI PELAJAR.<br />
  9. 9. NAMA: NOR SALEHA BT IDRIS<br />TINGKATAN: 5 SC 1<br />TARIKH LAHIR: 20 MAC 1994<br />JAWATAN: PENOLONG SETIAUSAHA<br />KOMEN: SAYA BERHARAP PERPUSTAKAAN INI AKAN DI TAMBAH BAIKKAN. MENBAHAGIKAN TEMPAT-TEMPAT DENGAN LEBIH PRATIKAL AGAR TEMPET-TEMPAT DIDALAM PERPUSTAKAAN AKAL LEBIH TERSUSUN.<br />
  10. 10. NAMA: LIM CAI ZHEN<br />TINGKATAN: 5 SC 1<br />TARIKH LAHIR: 18 JANUARI 1994<br />JAWATAN: BENDAHARI<br />KOMEN: SAYA MENDAPATI BAHAWA PERPUSTAKAAN KITA KEKURANGAN BILANGAN BUKU RUJUKAN PMR DAN SPM. NAMUN, PIHAK PENTADBIRAN TELAH MENGATASI MASALH TERSEBUT. DI SAMPING ITU, KOMPUTER YANG TIDAK BERFUNGSI TELAH DI HANTAR UNTUK DIBAIKI. PELBAGAI USAHA TELAH DILAKUKAN BAGI MENAMBAH BAIK MUTU PERKHIDMATAN PSS KITA.<br />EVERYONE THINK OF CHANGING THE WORLD, BUT NO ONE THINK OF CHANGING HIMSELF<br />
  11. 11. INQUIRY MIND......!!!<br />WHAT IS THE WORLD’S LARGEST FISH???? THE SMALLEST????<br />The largest is the whale shark, which grows to move than 50 feet in length and may weigh several tons. The second largest is the basking shark, which may measure 35 to 40 feet long. <br />The smallest fish is the tiny goby, an inhabitant of fresh-to-brackish-water lakes in Luzon, Philippines. It seldom is longer than a half inch at adulthood, yet is so abundant it supports a fishery.<br />CAN A MAN HAVE A BABY????<br />OPPSS, a man can’t give birth to baby. In reproduction, males and females both contribute genetic material to a baby, but only the woman has the right body part for a baby to grow and be born. The process starts when a man’s sperm fertilizes a woman’s egg, which is in the lower part of her abdomen. Over nine months, the egg grows into a whole baby – that’s why a pregnant woman has big bellies. Then the baby is pushed out of the mother through the birth canal. Men just don’t have the right equipment to do this stuff. Can you just imagine that how man could possibly deliver the baby.<br />A man should possibly think like a true man but he should act like a woman in order to achieve success.<br />
  12. 12. ONE STEP FORWARD....!!!!<br />SIAPAKAH YANG MENCIPTA TANDAS????<br />Bilikmanditelah lama ditemuisejakzamanFiraunlagitetapihanyapadatahun 1819, seorangrakyat British, ALBERT GUBLIN telahmencipta system tandasmoden yang dikenalisebagai “SILENT VALVELESS WATER WASTE PREVENTER”. Dalamzamanpertengahan, buangantandasdialirkankedalamparitdisekelilingistana. Tetapipada 1859, Parlimen British telahmenutupsementaratandasberkenaankeranamenyebabkanbau yang kurangmenyenangkankepada Sungai Thames.<br />APAKAH PERBEZAAN JERUNG DENGAN IKAN-IKAN LAIN????<br />Kebanyakanikanmempunyairangka yang dibuatdaripadatulangtetapirangkajerungterdiridaripadarawansejenistisu yang kuatdanfleksibel. Hampirsemuajenisikandiselaputidengansisik yang licindannipismanakalajerungdiselaputidengansisik yang tajamsepertigigidinamakan DENTIKAL. Kebanyakanikanhanyamempunyaisatubelahandiinsang-organ untukbernafaspadakiridankananbadantetapijerungmempunyai lima, enamatautujuhbelahan. <br />80% kejayaandalambekerjabergantungkepadakecerdasanemosidanhanya 20% bergantungkepadakecerdasanintelek.<br />
  13. 13. Are all rivers the same?<br />No. Some rivers are deep. Some are shallow. Rivers can be muddy or crystal clear.<br />Do shell<br /> Shell is very slowly .But they only grow while they are home to the animal they contain. Once the animal leaves, the shell stops growing.<br />SIMPLE SCIENCE<br />Do any animals beside seals swim in the polar waters?<br />Polar bears, walruses, and whales all swim in the smallest ocean on earth. It is called the Arctic Ocean, and it is at the North Pole <br />What is ice?<br />Ice is water that is very, very cold. It has gotten so cold, that it has frozen. If you make ice warm again, it will turn back into water.<br />
  14. 14. AKTIVITI-AKTIVITI SEPANJANG BULAN JANUARI DAN FEBRUARI<br />Aktivitimingguan unit kokurikulumdandilakukanpadasetiaphariSelasa.<br />Perasmian Tabung Kebajikan yang bertujuan membantu pelajar yang bermasalah.<br />
  15. 15. PerasmianTabungKebajikan yang bertujuanmembantupelajar yang bermasalah.<br />Penghargaan kepada atlet yang telah mengharumkan nama sekolah<br />
  16. 16. Sambutanmaulidurrasulperingkatsekolah. Sambutaninitelahdiadakanselepaspembelajaransesipagi. Dihadiriolehsemuapelajarsesipetangdanstafsekolah.<br />
  17. 17. Mesyuarat PIBG telahdiadakanpada 6 Mac 2011. MesyuaratinitelahdijalankanduaharisebelumUjianPertama. Pelbagaiaktivititelahdimuatkansepanjangmesyuaratberlangsung.<br />
  18. 18. English Enrichment ProgrammetelahdilancarkanbagimeningkatkanmutubahasaInggerisdalamkalanganpelajar. Pelbagai program telahdilancarkan<br />
  19. 19. KARYA PELAJAR<br />TULISAN LANGIT<br />NadzirahbintiAihsan<br />SofeaSyahirahduduktermenungdibangkukayukediamanDato’ Murad yang tersergammewahitu. “Apa yang harusakulakukan? Patutkeakuberitahukepada mama dengan papa?” monolognyasendirian. Awanmendungdilangitseolah-olahmenambahkankerunsingandijiwa. KedengaransuaraDatin Melissa memanggilanaktunggalnyauntukmasukkedalamrumah, kerananampaknyalangithitamitumenunjukkanbahawahariakanhujan. “Fea, marimasuksayang.” “Baik ma,” balasSofealemah. Dipandangwajahibunya, mulutnyainginberkata-katatetapiterkunci. Diasegerakebilik, tidaksanggupmemandangwajahibunya. Sofeateringatkanperistiwa yang berlakudisekolahpagitadi. Diaditangkapoleh guru disiplinkeranaberdua-duaandibelakangmakmalsainsdengankekasihnya, Muqri. Inibukanlah kali pertamaSofeadipanggilkebilikkaunselingsekolah. Tempatituumpamapersinggahankeduanyadisekolahselepaskelas. Olehkeranainginmenjaganamabaikkeduaorangtuanya yang berpengaruhitu, perkara yang dilakukanolehSofeaditutupolehpihaksekolah.<br />Cikgu Hassan sudahhilangsabardenganperbuatanSofea. Kali inidiatekad, tekaduntukmemanggilkedua-duaibubapaSofeakesekolah. PANG! Sofeaterperosokketepi sofa setelahditamparolehDato’ Murad. Terlihatjelaspadapipinya<br />
  20. 20. yang gebuitumerahakibattamparanayahnya. “Abang! Kenapabuatanakkitamacamni? Fea, cakapdekat mama. Featakbuatkansemuani? Takkan, sayang?” Datin Melissa teresak-esak. Sofeadiamseribubahasa, hendakdiiyakan, diatidakmampuapatahlagibersuaradidalamsaat-saatbegitu. “Akuhantarkaukesekolahuntukbelajar! Bukanbersosial! Kaudahmemalukanaku! Kaucakap, dekatmanaakunakletakmukaakunanti?!” bentakDato’ Murad. Ternyatadiakesaldengansikapanaktunggalnyaitu. Sofeahanyamampumenangis. KedukaanbertambahapabilaDato’ Muradmengambilkeputusanuntukmenghantarnyakepusatpemulihanakhlak, WadiSafra’. Datin Melissa terpaksaakurdengankeputusansuaminyawalaupundalamhatikecilnya, diasedikitmemberontak. Sofeatersepitdiantaraduapilihan. Diatidakmahumeninggalkankehidupannyadikota metropolitan itu, namuntidakjugasanggupmenahancacianorangolehkeranaaibnyasendiri.<br />SepanjangperjalananmerekakeWadiSafra’, air mataSofealajumengalir. PerjalananmerekaitutidakdisertaiDato’ Murad. DiasudahtidakmahumengakuSofeasebagaianaknya. Maruahnyalebihpentingdaridarahdagingnyasendiri. Datin Melissa memegangerattanganSofea, tidaksesaat pun diasanggupmelepaskantanganputerinyaitu. “Fea, mama tahuinisukarbuatmutetapi mama dan papa rasa inilahkeputusan yang terbaikbuatmu. JanganlahFearisau, mama akanselaludatangmenjengukFeadisana. Ibujanjisayang.” UcapnyasambilmengucupdahiSofea. Kata-kataibunyalansungtidakdapatmenenangkanhatiSofea. Setelah 2 jam perjalanan, merekatibakedestinasimereka.<br />
  21. 21. TeratakWadiSaframenyejukkansetiapmata yang memandangnya. Kedatanganmerekadisambutmesraolehseorang guru, yang lebihselesadikenalisebagaiUmmiAisyah. SofeaSyahirahdipelukeratolehnya, pelukantersebutsepertitandabahawaSofeaakanselamatdibawahjagaannya. Kedatangannyajugadisambutmesraolehbeberapaorangpelajar lain. Sofeamerasakandirinyabegituasingditempatitu. Diabermaindenganperasaannyasendiri. Ah, apaharuskutinggalditempatbegini?<br />Sebulantelahberlalu, Sofeadapatmenyesuaikandiriditeratakitu. Walaupunterpaksabersusahpayahuntukmandidiwaktupagi, elektrik yang kadangkalanyaada, kadangkalanyatiada, namunhatinyatenang. Bebasdarihiruk-pikukbandaraya Kuala Lumpur. UmmiAisyahsemakinsayangterhadapanakdidiknyaitu. EntahkenapaUmmiAisyahmerasakanSofea lain daripelajarnya yang lain. Apa yang istimewanyagadisitu? Disangkanyapanashinggakepetang, rupa-rupanyahukanditengahhari. KemunculanMuqri, kekasih lama Sofeamenimbulkankembaliperistiwahitam yang menghantuidirinya. SofeaseringdigangguolehMuqri. SegalabentukancamandiberikankepadaSofea. PeristiwaitusedikitmenggangguSofea, diajugatidakdapatmenumpukanperhatiandidalamkelas, malahlebihcenderungmenyendiri. UmmiAisyahmenyedariperubahananakdidiknyaitu. Ketikaditanyapadamulanya, SofeaengganmenceritakanmasalahnyatetapisetelahdidesakolehUmmiAisyah, diamengalah. UmmiAisyahsetiamendengarsegalaaduangadisbelasantahunitu. “Sofea, Sofeatakperlurisauya, nak. UmmidansemuawargaWadiSafra’ akanmenjagaSofea. KamitakkanbiarkanMuqrimengganguSofea.” UjarUmmi. Sofeasedikitlega.<br />KelegaanituhanyasementaraapabilaMuqrisemakinbertindakagresif. DiaberanimengambiltindakandrastikdenganmemecahmasukketeratakWadiSafra. Diamenjeritsepertiorangkurangsiuman. “KeluarkauSofea! Keluar!” Sofeatersentakapabilaterdengarsuaraitu. Inginsahajadialarimenyembunyikandiritetapisampaibila<br />
  22. 22. harusdiaberbuatdemikian? Sofeamengambilkeputusanuntukberhadapandenganbekaskekasihnya. Diajugaingintahuapa motif Muqriberbuatdemikian. ApabilaMuqrinampaksahajaSofeaberadadihadapannya, terusdiamelututdihadapanSofea. “Fea, abangsayangkanFea. Kita pulangya? AbangdatangninakambilSofeapulangdenganabang. Abangjanjikitaakanhidup…” percakapannyadipotongolehSofea. “JangangangguSofealagi. Akutakperlulelakidayussepertikau!” tegasSofea. “Takgunakau! Bukanitujawapan yang akumahu!” bentakMuqrilaluterusmencapaipisaulipat yang disisipkanditepipoketnyalalumenerpalajukearahSofea. UmmiAisyahtidakberlengahlalumenolakSofeaketepi. “Ummi!!!” jeritSofea. TikamanuntuktepatkeperutUmmi, darahmemancutkeluar. Muqripanik, diatidakmenyangkaakankejadianini. DiacubameloloskandiritetapiberjayaditangkapolehbeberapawargaWadiSafra’ yang lain. “Hubungiambulans! Cepat!!” Sofeasepertitidakdapatmenerimakenyataan, dipegangeratUmmi yang berlumurandarah. Orangramaiberkejarandalamkekalutanitu. Ummidikejarkanke hospital.<br /> “Ummi, masihingatkahummikepadasaya? Insankerdil yang hinaini. Ummi, sayatidakmampumembalasjasaummidenganbarang-barangmewah, apatahlagiwang ringgit. Jadi, sayahadiahkansebuahsajak yang sayaciptauntukummisendiri. Iniialah kali pertamasayamenciptasajak. Mungkintidakseindahtulisanlangit, tetapisayaharapUmmisudimembacanya.<br />
  23. 23. “Harisemalam, hariinidanharimendatang,<br />Bisikanmumasihmenjadikeramat,<br />Aturlangkahmukemasmenentuhaluan,<br />Kasihsayangmumemancartakmintadibalas,<br />Bagaikanbutiranpasir, pengorbananmusukardihitung,<br />Akankukenangjasamu, akankujadikanpedomanhidup.<br />Terimakasih.<br />Anakdidikmu,<br />SofeaSyahirah”<br /> Air mataUmmimengalirlaju. Sofea, anakdidiknya yang memberiseribukenangandalamdirinya. MelaluikisahhidupSofealah, UmmimenjadikannyasebagaikekuatanuntukterusmengajardiWadiSafra. Empattahunberlalubegitupantas, UmmimasihsetiamencurahkantenagabaktinyaditeratakWadiSafrasementaraSofeasudahberjayabergelarusahawanmuda yang berjaya.<br />PERHATIAN!!!<br />ANDA BOLEH MENGHANTAR KARYA ANDA KE PUSTKA AL-RAZI, SEK. MEN. KEB. LUNAS.<br />KARYA YANG TERPILIH AKAN DITERBITKAN DALAM RUANGAN KARYA PELAJAR UNTUK KELUARAN BULETIN PSS ‘TINTA’ SETERUSNYA...<br />KARYA ANDA MESTILAH ASLI, KREATIF DAN TIDAK MENYENTUH SENSITIVITI PERKAUMAN.<br />SELAMAT BERKARYA!!!!!!<br />
  24. 24.
  25. 25.
  26. 26. 'TINTA'<br />BULETIN PSS<br />SMK LUNAS<br />PERHATIAN!!! HADIAH MENARIK MENANTI ANDA SILA HANTAR JAWAPAN ANDA KE ALAMAT SEPERTI TERTERA DI BAWAH:<br />NUR AFIFAH BT HARON,<br />PUSTAKA AL-RAZI SMK LUNAS,<br />

×