SlideShare a Scribd company logo
G r a p h i c S t a n d a r d M a n u a l
dinar kebayaspesialis kebaya & make up
G r a p h i c S t a n d a r d M a n u a l
DAFTAR ISI
Daftar Isi
Kata Pengantar
Identitas
Logo
Elemen Pembentuk Logo
Logo Primer & Sekunder
Konsep Logo & Teks Lampiran (tagline)
Konsep Warna
Background
Ilustrasi
Ukuran Standar
Skala Minimal
Konfigurasi
Clearspace
Gridlines
Typeface
Co Branded Logos
Target Penempatan Logo
Logo 3d
1
2
5
6
10
15
16
17
19
21
23
25
31
33
37
DAFTAR ISI
Media Aplikasi Logo
Stationery and administrative
Web sites
PR / IR Communications
Letterheads
Envelope
Name Card
Fax Cover Sheet
Notepad
Bill / Nota
Mailing label
Presentation Slide
Map
Brosur
Sertifikat
CD Case
Leaflet
38
40
41
43
44
45
46
47
48
49
51
52
53
55
DAFTAR ISI
Penutup
Marketing / Sales
Identity Introduction
Pricelist
Poster
Banner
X Banner
Seragam
Gift/ Merchandise
HR Communications
Facilities Signs
Vehicles
Recruitment Ad Form
Neon Box
Alternatif Grafis
Channel Letter
Umbul-umbul
65
67
70
72
73
76
63
56
57
60
61
62
SalamSejahtera,
Pertama, saya sangat bersyukur kepadaT uhanYME karena buku panduan ini telah selesai
denganlancar.Dengan rasabanggadanbahagiasayamempersembahkan pedomanaplikasilogo
atau Graphic Standart Manual Dinar Kebaya. Dalam revisi logo yang baru ini saya berharap
peningkatan citra positif yang muncul secara internal dan eksternal. Selain itu, buku ini juga
diharapkandapatmelindungipenggunaan logosecarabaikdantepatdemitercapainyaVisidanMisi
perusahaan. Pedoman aplikasi logo ini berisi tentang penjelasan dan panduan dalam aplikasi logo
secaratepatdan benar. Hal ini ber tujuan menjaga estetika dan fungsional logo sebagai simbol yang
mewakili perusahaan. Selain juga agar tidak terjadi kesalahpenggunaan diluar dari peraturan-
peraturanperusahaan.
Semoga buku ini dapat bermanfaat bagi pihak yang bersangkutan terutama perusahaan
Dinar Kebaya. Hal-hal yang mungkin perlu revisi di dalam buku ini, penyusun menerima kritik dan
saran. Pada akhirnya buku ini bertujuan untuk membantu mewujudkan Visi dan Misi Perusahaan
Dinar Kebaya. Demikian dari saya. T erima kasih atas dukungan dari semua pihak yang terkait.
Semogabermanfaat.
PROFIL PERUSAHAAN
Dinar Kebaya merupakan sebuah perusahaan yang berdiri pada tahun 2007. Perusahaan
inibergerakdibidangjasadanproduksikebaya.Jasayangditawarkanberpupa makeupdantatarias
pengantin. Sedangkan untuk produksi kebaya, sebagian besar adalah modifikasi kebaya modern.
Pada awalnya, usaha ini bertempat di rumah owner yaitu Dinar Rahadian. Kemudian pada tahun
2010 pindah ke ruko kalpataru dan kemudian berpindah lagi di ruko grahm utero soekarno hatta
sampai saat ini. Pada perkembangannya, Dinar Kebaya mulai menambah jasa yang ditawarkan yaitu
dengan menambahkan jasa wedding organizer.Tidak hanya make up dan rias pengantin saja, tetapi
jugaadaperawatanprawedding,fotowedding,paketwisuda,dsb.
Untuk produksi kebaya sendiri masih terus dikembangkan dengan inovasi yang tiada
henti. Karena sebagian besar konsumen Dinar Kebaya adalah anak muda, maka modifikasi kebaya
yang dilakukan adalah dengan gaya modern dan gaya baju anak muda yang ter update. Namun
terdapat benang merah sendiri dari modifikasi kebaya ini, yaitu dengan tidak meninggalkan
identitas tradisional kebaya itu sendiri. Dinar Kebaya memiliki visi untuk mengembangkan bisnis
usahanyadanmengenalkankebayasampaikeranahinternasonal.
GRAPHIC STANDART MANUAL
Produk Dinar Kebaya berupa modifikasi kebaya modern dan tradisional. Sebagian besar adalah
produk kebaya modern. Yang dimaksud dengan modifikasi kebaya modern ini adalah kebaya yang
fashionable, perpaduan unsur etnik dan modern, dan juga permainan detail dari struktur kebaya itu
sendiri(bisadaridetailborder,renda,payet,dsb).
PRODUK PERUSAHAAN
GRAPHIC STANDART MANUAL
LOGO
dinar kebayaspesialis kebaya & make up
ELEMEN PEMBENTUK LOGO
Cyan, Magenta, Yellow, Black (CMYK) Sistem warna yang lazim digunakan dalam proses cetak.
Typeface (Font) : Nama jenis huruf yang digunakan didalam logo ini,
antara lain Barkentina 1 dan Myriad Pro
Picture Mark
Text Mark
Tagline
Logo
Pesan berupa teks yang diposisikan di bawah identitas logo
Area sekitar logo yang sengaja dikosongkan dengan skala yang telah ditentukan untuk
menghindari tabrakan dengan elemen desain lain, termasuk teks dan foto.
Warna
Teks (Type)
Tagline
Area Kosong (Clearspace)
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
1
VERSI LOGO PRIMER & SEKUNDER
Identitas logo Dinar Kebaya mempunyai dua komponen dasar, yaitu logogram (picture mark)
dengan bentuk bulat dan logotype (text mark) dengan teks dinar kebaya . kedua elemen
tersebutdiletakkandalamposisiratatengah.
sebagai aturan pokok perusahaan, identitas ini wajib
dipergunakan sebagai penanda perusahaan dalam
produkdanatributperusahaan.
Versi Primer / utama
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
2
VERSI LOGO PRIMER & SEKUNDER
Logo sekunder ini sebagai alternatif penempatan posisi logo selain dalam posisi rata tengah.
posisi logo pada logo sekunder ini yaitu dengan arah horizontal. Dimana logogram diletakkan
disebelahkiridanlogotypedisebelahkanannya.
Dalam penerapannya, logo dalam versi primer lebih
diutamakan. penempatan logo primer harus
dimaksimalkan dan jika memang kurang sesuai dengan
bidang yang dikomposisikan barulah diperbolehkan
memakailogosekunder.
Versi Sekunder
Alternatif posisi
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
3
Logo Sekunder Picturemark
Pada perkembangannya, diharapkan pemakaian logo bisa sampai pada aplikasi logo
picturemark saja. Yaitu berupa bentuk bulat. Sedangkan pada textmark tidak perlu
dipakai. Setelah brand bisa kuat, teringa di pikiran target audiens, barulah logo
picturemark ini bisa dipakai. Dengan pemakaian ini diharapkan brand dapat lebih
diingatdandapatmenjagaefektivitaslogopadapeng-aplikasiannya.
Perlu dilakukan penelitian lanjut mengenai ke-efektivitas logo picturemark ini. Diperlukan
juga survei mengenai kekuatan logo dinar kebaya pada perkembangannya. Oleh karena
itu, pemakaian logo picturemark ini harus setelah ada keputusan dari perusahaan
mengenaikapanbisadipakai.!
atau
GRAPHIC STANDART MANUAL 4
VERSI LOGO PRIMER & SEKUNDER
KONSEP LOGO DAN TEKS LAMPIRAN (TAGLINE)
Berupa bentuk dasar bulat yang didalamnya
terdapat bentuk salah satu sayap kupu-kupu.
Sayap tersebut membentuk huruf D . Ide untuk
mengambil bentuk sayap kupu-kupu dikarenakan
Dinar Kebaya ingin ber kembang dan
bermetamorfosa dari perusahaan yang kecil
menjadi perusahaan yang besar. bentuk bulat
sebagai dasarnya yaitu karena Dinar Kebaya
memiliki visi untuk memperkenalkan produknya
sampai ke ranah International. dari visi tersebut
terpikirkanbentukbumi,sebagaitandaglobal.
Logogram
Logotype Dinar Kebaya berupa text Dinar Kebaya dengan menggunakan jenis huruf barkentina. jenis huruf ini berkesan
etnik sehingga cocok dengan karakter Dinar Kebaya. spesialis kebaya & make up adalah taglin euntuk memperjelas
identitasperusahaan.
Logotype
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
5
KONSEP WARNA
Warna logo Dinar Kebaya adalah gradasi dari merah jambu menuju ungu, kemudian ada merah muda
pastel disalah satu bagiannya. Merah jambu melambangkan feminim, kewanitaan kemudian ungu
mewahsedangkanmerahmudapastelmelambangkananakmuda.secara keseluruhan,warnayangada
pada logo ini adalah melambangkan tentang feminim, kewanitaan, anggun, mewah dengan spirit anak
muda.
warna sekunder untuk logo dinar kebaya yaitu putih, hitam dan silver. Warna ini digunakan untuk
kebutuhantertentu(dibahasdibagianberikutnya).
Konsep Warna
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
6
C : 38 M : 99
Y : 2 K : 0
R : 169 G : 56 B : 144
C : 9 M : 87
Y : 27 K : 0
R : 221 G : 82 B : 128
WARNA KORPORAT
GRAPHIC STANDART MANUAL
r kebaya
C : 2 M : 26
Y : 0 K : 0
R : 243 G : 200 B : 222
C : 0 M : 0
Y : 0 K : 100
R : 55 G : 52 B : 53
Untuk kebutuhan media cetak dan
digital, desain logo dinar kebaya
telah dipatenkan agar menjaga
konsistensibranddinarkebaya.
Warna primer dipakai dalam semua
aplikasi media dan atribut
perusahaan. kecuali untuk kondisi
tertentu logo dinar kebaya
diperbolehkan memakai warna
sekunder. (dijelaskan di bab warna
sekunder)
Warna
Warna Primer
7
WARNA KORPORAT
Warna sekunder dipakai sebagai alternatif dalam kebutuhan desain agar lebih bervariasi dan sesuai
dengan estetika dan fungsionalnya.
Warna Sekunder
Warna Putih Warna putih digunakan pada desain grafis dengan variasi warna warna muda dan pastel. warna logo putih ini
ditujukan untuk mendukung kesan muda, bersih dan cerah. penggunaan logo putih dengan background cerah
pada prosentasi terntentu agar logo tetap bisa terlihat. warna logo putih ini bisa digunakan seagai alternatif
terakhirjikasemuawarnakurangcocokuntukdikomposisikandenganwarnaprimerlogodinarkebaya.
Warna Silver Warna silver digunakan pada desain grafis dengan variasi warna yang didominasi putih atau hitam. hal ini
bertujuanuntukmemberikesaneleganpadatampilangrafisyangbuat.
Warna Hitam Warna hitam bisa difungsionalkan seperti warna putih yang netral yaitu jika warna primer sudah tidak cocok
dipakaiuntukkebutuhankomposisiwarnapadatampilangrafis.
C : O M : 0 Y : 0 K : 0
R : 255 G : 255 B : 255
C : O M : 0 Y : 0 K : 60
R : 132 G : 134 B : 136
C : O M : 0 Y : 0 K : 100
R : 55 G : 52 B : 53
GRAPHIC STANDART MANUAL 8
MODE SINGLE COLOR
WARNA KORPORAT
MODE PRIMER MODE GRAYSCALE
MODE SINGLE COLOR
penambahan line untuk single color logo
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
MODE BLACK & WHITE
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
MODE DOUBLE COLOR
dinar kebayaspesialis kebaya & make up
MODE DOUBLE COLOR
dinar kebayaspesialis kebaya & make up
GRAY SINGLE COLOR
dinar kebayaspesialis kebaya & make up
warna gray single color mulai
black 60 sampai 30.
9
BACKGROUND
Background dapat menjadi penentuan dalam pemakaian logo. Apakah memakai logo primer atau sekunder.
ataukah memakai warna primer atau sekunder. Background yang bervariasi tentunya memiliki pertimbangan-
pertimbangansendiridalamaplikasilogo.
Positive Reserved Reserved
B / W Background foto Background foto
Backround logo primer harus
warna putih atau abu-abu 10 %.
logo black dengan background
putih, begitu juga sebaliknya.
Background
Background sebaiknya menggunakan warna
warna yang ada dalam logo primer
warna background foto yang cenderung gelap menggunakan
logo single color putih, sedangkan warna background yang
cenderung cerah menggunakan logo single color hitam.
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
10
BACKGROUND
Ornamen khusus ini berupa visualisasi gambar bunga yang sering digunakan untuk bordir dan payet kebaya.
Dibuatuntukmemenuhikebutuhangrafistampilanbranddinarkebaya.backgroundinitidakharusselaludipakai,
bisa disesuaikan dengan fungsionalnya. namun untuk menjaga konsistensi brand dinar kebaya, sebaiknya setiap
mediayangakandipakai,jikamemungkinkanornameninibisadipakaimeskipunhanyasebagaiaksen.
Ornamen Khusus!
warna ornamen tidak boleh menonjol dari logo atau objek yang
ada di atasnya. kecuali ornamen ini ditujukan sebagai wallpaper .!
GRAPHIC STANDART MANUAL 11
BACKGROUND
Ornamen Khusus!
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
12
BACKGROUND
Alternatif Perpaduan Warna
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
Warnabackgroundyangdipakaiharussenadasekitarwarnamerahmuda,ungu,danmerahmudapastel.selainitu
jika tidak ada pilihan dapat menggunakan warna background putih, abu-abu muda (k:10), hitam, atau foto. foto
punharusdenganprosentasegelapterangyangdapatmemudahkanlogotetapterbaca.
13
BACKGROUND
Perpaduan Warna yang Salah
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
14
ILUSTRASI
Untuk memaksimalkan karakter perusahaan,
maka tema ilustrasi dari semua grafis identitas harus seragam
Ilustrasi berupa foto dan ornamen korporat
ilustrasi dalam bentuk lain kurang diperkenankan diaplikasikan
Tema yang Seragam
Muda
Modern
Profesional
Feminim
15
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
Ukuran logo pada setiap aplikasinya tidak boleh lebih kecil dari ukuran yang telah
ditetapkan. Hal ini berguna agar logo tetap dalam proporsi yang baik dan tetap
mudahdikenalidanataudibaca.
dinar kebayaspesialis kebaya & make up
30 mm
7 mm
22 mm
6.7
mm
4
mm
7 mm
30 mm
16 mm
9 mm
5.5 mm
9.4 mm
Untuk ukuran terkecil ini boleh tidak menggunakan tagline. karena kemungkinan
akansulituntukdibaca.
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
16
Ukuran standar
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
SKALA MINIMAL LOGO
100 %
75 %
60 x 31 mm
45 x 23 mm
dinar kebaya
50 %
30 x 16 mm
ukuran terkecil maksimal
GRAPHIC STANDART MANUAL 17
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
SKALA MINIMAL LOGO
picturemark
10 x 10 mm
ukuran terkecil hanya dapat dipakai
untuk picturemark saja
diharapkan ukuran ini digunakan dengan baik karena mempengaruhi redibility
dari textmark. untuk picturemark masih bisa terlihat walau dalam ukuran terkecil
sekalipun.
pada penggunaannya kalau bisa tidak sering memakai ukuran terkecil ini.
untuk skala maksimal tidak dibatasi sampai ukuran berapapun yang
terpenting adalah ukuran dengan skala yang proporsional.
GRAPHIC STANDART MANUAL 18
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
KONFIGURASI LOGO
GRAPHIC STANDART MANUAL 19
x
0.5x
0.5x
4x
2.4x1.7x
12.5x
4x
Konfigurasi berfungsi sebagai anatomi logo. Ketetapan konfigurasi simbol dan tulisan identitas
menggunakan acuan skala karakter huruf. Satuan karakter yang dipakai dalam skala ini diambil
dari komponen huruf 'X
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
KONFIGURASI LOGO
Konfigurasi berfungsi sebagai anatomi logo. Ketetapan konfigurasi simbol dan tulisan identitas
menggunakan acuan skala karakter huruf. Satuan karakter yang dipakai dalam skala ini diambil
dari komponen huruf 'X
dinar kebayaspesialis kebaya & make up
1.8x
1.9x
1x
1.2x1.2x
8.5 x0.3 x
0.15x
0.18x
GRAPHIC STANDART MANUAL 20
x
Zona yang bersih atau kosong diciptakan untuk memastikan logo masih menonjol dan tampak jelas.
Ruangan yang kosong diukur dengan X. Ruangan kosong di sekitar logo berguna untuk menonjolkan
penampilan logo Dinar Kebaya dibandingkan elemen gambar atau lainnya.
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
CLEARSPACE / AREA KOSONG
GRAPHIC STANDART MANUAL 21
Area kosong diberikan disekitar logo dengan skala yang telah ditentukan. Elemen visual
lain tidak diperkenankan masuk dalam area ini. Hal ini bertujuan agar tidak mengganggu
readibilitas dan estetika logo.
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
CLEARSPACE / AREA KOSONG
GRAPHIC STANDART MANUAL 22
xdinar kebayaspesialis kebaya & make up
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
GRIDLINES / GARIS BANTU
Gridlines adalah sekumpulan garis bantu yang berfungsi menjaga konsistensi visual
logo sehingga pada penerapannya tidak terjadi kesalahan pada proporsi bentuk logo.
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
23
UKURAN MINIMAL, CLEARSPACE & GUIDELINES
UKURAN POSISI YANG SALAH
GRAPHIC STANDART MANUAL
dinar kebaya
spesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar
kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
24
TYPEFACE
Myriad Pro
BARKENTINA
The quick brown fox jumps over the lazy dog. 1234567890
The quick brown fox jumps over the lazy dog. 1234567890
The quick brown fox jumps over the lazy dog. 1234567890
The quick brown fox jumps over the lazy dog. 1234567890
The quick brown fox jumps over the lazy dog. 1234567890
The quick brown fox jumps over the lazy dog. 1234567890
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
25
TYPEFACE
BARKENTINA
Myriad Pro
Jenis font ini dipilih karena berkesan etnik dan elegan. Sebagai jenis huruf serif,
Barkentina meiliki bentuk yang luwes dan dinamis. Setiap ujung kaitnya juga
seperti bentuk sulur yang luwes, sangat cocok dengan karakter perusahaan
DinarKebayayangluwesdanterkesanfeminim.
Jenis font ini dipilih untuk diaplikasikan pada tagline Dinar Kebaya. bentuk
huruf ini tegas dan jelas dibaca, mengimbangi font logo yang terkesan luwes.
meskipun jenis huruf ini terkesan tegas namun ukurannya diperkecil untuk
menghindarikesan kaku.
Penggunaan jenis huruf ini adalah paten / wajib. text mark utama adalah
memakaijenishurufini.tidakdiperbolehkanmemakaijenishurufapapun.
Penggunaan jenis huruf ini adalah paten / wajib karena sudah disesuaikan
dengantextmarkutama.
PointdariTextMarkiniadalahReadibilitydansesuaidengankarakterperusahaan
yang luwes,elegan,danetnik.Aplikasitextmarkinisesuaidenganperaturanyang
sudahdibuat(skala,jarakminimaltepi,dll).
!
GRAPHIC STANDART MANUAL 26
Untuk font primer. dianjurkan untuk menggunakan jenis huruf yang berkait (serif).
haliniditujukankarenahurufdengankaitakanterlihatluwes.
FontPrimeryangdigunakanmisalnya:
FONT PRIMER
Selainfontuntuklogo.Terdapatjugapanduanuntukfont yangdiaplikasikandalamsemuamediaDinarKebaya
yangmenggunakanhuruf.
Untuk font sekunder bisa menggunakan jenis huruf tanpa kait (san serif).
pemakaian font sekunder ini dipakai ketika font primer dirasa kurang cocok dengan
halyangakandiaplikasikan.Namunpenggunaanfont primertetapdiutamakan.
FontSekunderyangdigunakanmisalnya:
FONT SEKUNDER
Times New Roman
Californan FB
Adobe Hebrew
dll.
meskipun terdapat banyak pilihan, namun
sebagai panduan, huruf serif yang digunakan
harusreadibility.
TYPEFACE
Franklin Gothic
Kozuka Gothic Pr6N M
Browallia New
dll.
Selain jenis huruf yang dicontohkan, dianjurkan
tidak terlalu jauh beda dengan jenis huruf yang
dicontohkan.
GRAPHIC STANDART MANUAL 27
spectacular event @ MOG 22 -24 Juni 2013
rias pengantin
paket wisuda
spesialis kebaya
prawedding
FONT PRIMER
Paket
Wisuda
+ Foto
Wisuda
dinar kebayaspesialis kebaya & make up
FONT SEKUNDER
contoh penggunaan jenis huruf serif
sehingga lebih berkesan luwes dan
mendukungnuansaklasik.
contoh penggunaan jenis huruf san
serif membuat kesan yang tegas dan
moderen. Dinar Kebaya tidak harus
berkesan klasik dan etnik, bisa juga
berkesan moderen tetapi tetap harus
dicantumkanlogo.
Dalam setiap media yang digunakan Dinar Kebaya, tidak harus selalu berkesan etnik dan
klasik karena Dinar Kebaya sendiri juga memiliki karakter moderen dan dinamis. Atau
perpaduan dari keduanya karena Dinar Kebaya adalah industri kreatif yang bergerak
dibidangmodifikasiKebayamoderen.
TYPEFACE
!
GRAPHIC STANDART MANUAL 28
TYPEFACE.
PENERAPAN FONT YANG SALAH
dinar kebaya
s p e s i a l i s k e b a y a & m a k e u p
dinar kebayaspesialis kebaya & make up
DINAR KEBAYAspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
GRAPHIC STANDART MANUAL 29
PENERAPAN FONT YANG SALAH
K e b a y a a d a l a h b l u s
tradisional yang dikenakan
oleh wanita Indonesia yang
terbuat dari bahan tipis
yang dikenakan dengan
sarung, batik, atau pakaian
rajutan tradisional lainnya
seperti songket dengan
motifwarna-warni.
Mengenai
Dinar Kebaya
Kebaya adalah blus
t r a d i s i o n a l y a n g
dikenakan oleh wanita
Indonesia yang terbuat
dari bahan tipis yang
d i k e n a k a n d e n g a n
sarung, batik, atau
p a k a i a n r a j u t a n
tradisional lainnya
seperti songket dengan
motif warna-warni.
Mengenai
Dinar Kebaya
Kebaya adalah blus
t r a d i s i o n a l y a n g
dikenakan oleh wanita
Indonesia yang terbuat
dari bahan tipis yang
d i k e n a k a n d e n g a n
sarung, batik, atau
p a k a i a n r a j u t a n
tradisional lainnya
seperti songket dengan
motif warna-warni.
Mengenai
Dinar Kebaya
bentuk font terlalu kaku
font ini memberi kesan
anak-anak. tidak sesuai
dengan karakter perusahaan
kerterbacaan kurang!
!
!
TYPEFACE
GRAPHIC STANDART MANUAL 30
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
CO BRANDED LOGOS
CO BRANDED LOGOS. Logo dengan text mark
Posisi co-brandedlogodisertai textmarkdantagline.
Spasi minimum (jarak terdekat) antar logo mengacu pada 1/4
rataratapanjang logo. Hal ini juga diterapkan jika co-branded
logodisusunsecaravertikal.
ASDFGQWERTY
z
ASDFGQWERTY
z
Spasi Minimum
A B
A
B
1/4 [(A=B):2]
GRAPHIC STANDART MANUAL 31
Z
CO BRANDED LOGOS. Logo dengan text mark
CO BRANDED LOGOS
Z
Posisico-brandedlogotanpatextmarkdantagline.
logoDinarKebayadanLogolainmemilikiukuranyangsama.
Sedangkan spasi antar logo mengacu pada panjang dan lebar
masing-masinglogo.
GRAPHIC STANDART MANUAL 32
TARGET PENEMPATAN LOGO
Jika logo disertai tagline dan text mark, maka ukuran logo serta batas dengan ukuran area yang telah
ditentukan mengacu pada Clean area logo. mengenai skala ukuran logo sudah dijelaskan di penjelasan skala
minimal,dll.haliniberlakuuntuksemuaukuranApaper.
area margin
clear space
ukuran A Paper
Target Penempatan Logo
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
33
TARGET PENEMPATAN LOGO
AreaselainA Paper,tetapmenggunakanacuanskalalogodanclearspacearea.
tidak dianjurkan memakai area
bidang non geometris / tidak
beraturan!
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
34
TARGET PENEMPATAN LOGO
Penempatan Logo yang tidak sesuai
clear space keluar area
clear space masuk
ke dalam area margin
tidak menghiraukan clear space
dan area margin
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
35
Penempatan Logo yang tidak sesuai
TARGET PENEMPATAN LOGO
GRAPHIC STANDART MANUAL
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
36
LOGO 3D
Logo dalam bentuk tiga dimensi
GRAPHIC STANDART MANUAL 37
Media & Aplikasi
STATIONERY AND ADMINISTRATIVE
Letterheads
kop surat untuk Dinar Kebaya dibagi
menjadi dua pilihan. yaitu untuk
kertas berukuran A4 dan ukuran F4.
untuk ukuran A4 alamat di letakkan
diatas kop surat. sedangkan untuk
ukuran F4 diletakkan diibawah. Untuk
pemakaian disesuaikan dengan
kebutuhan. jika membutuhkan space
yang banyak dapat menggunakan
ukuran F4.
GRAPHIC STANDART MANUAL 38
STATIONERY AND ADMINISTRATIVE
Letterheads
GRAPHIC STANDART MANUAL 39
STATIONERY AND ADMINISTRATIVE
Envelopes
ukuran 23 x 11.5 cm
alamat selalu dibelakang
amplop dengan font
lucida bright
label ditempelkan disini
alamat & kontak
d : 2.5 cm 1.2 cm1.2 cm
2.6 cm
0.6 cm
10 cm
2.5 cm
1.5 cm
3.5 cm
1 cm
3 cm
2.5 cm
dinar kebayaspesialis kebaya & make up
7 cm
5.5 cm2 cm
GRAPHIC STANDART MANUAL 40
STATIONERY AND ADMINISTRATIVE
Business Card
centre
GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang Jawa Timur
Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154
email : dinarkebaya26@yahoo.com
f : facebook.com/dinar.rahadian.7
Name
Position
Contact Person
1.6 cm
3 cm
1 cm
1.5 cm
dinar kebayaspesialis kebaya & make up
4 cm
2 cm
promotion
3 cm
3.5 cm
3.5 cm
3.5 cm
2 cm
1 cm1 cm
ukuran 9 x 5.5 cm
BELAKANGDEPAN
Kartu nama 2 sisi (eksklusif)
sisi belakang dapat
digunakan untuk promo.
untuk kartunama eksklusif
harus memakai laminasi dof
GRAPHIC STANDART MANUAL 41
dinar kebayaspesialis kebaya & make up
GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang Jawa Timur
Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154
email : dinarkebaya26@yahoo.com
f : facebook.com/dinar.rahadian.7
0.5 cm
1.3 cm
1.5 cm
0.5 cm
Nama
Jabatan
Contact Person
1 cm
0.7 cm
1.5 cm 1.5 cm
1.5 cm 5 cm
2.5 cm 2.5 cm1 cm
Kartu nama 1 sisi
ukuran 9 x 5.5 cm
STATIONERY AND ADMINISTRATIVE
Business Card
GRAPHIC STANDART MANUAL 42
STATIONERY AND ADMINISTRATIVE
ukuran 21 x 29.7 cm
Fax Cover Sheet
dinar kebayaspesialis kebaya & make up
1.5 cm
1.5 cm
2.6 cm
5 cm 2.5 cm2.5 cm
FAXCOVER SHEET
To :
Company :
Fax :
Phone :
Pages :
From :
Fax :
Phone :
NOTES:
3 cm
GRAPHIC STANDART MANUAL 43
STATIONERY AND ADMINISTRATIVE
Note pads
ukuran A5
dinar kebayaspesialis kebaya & make up
1.8 cm
2 cm
1.5 cm 3.5 cm
uk. 10.5 x 14.8 cm
notes ...... , ..........................
Jl. Soekarno Hatta 2B - Malang 65141 Telp. 0341 - 5446071 / 081803813154
space untuk lem
0.7 cm
0.8 cm
1.3 cm
0.8 cm
0.7 cmSampul Isi
GRAPHIC STANDART MANUAL 44
STATIONERY AND ADMINISTRATIVE
Bills
isi depan
GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang Jawa Timur
Telp. 0341 - 5446071 / 081803813154
email : dinarkebaya26@yahoo.com
dinar kebayaspesialis kebaya & make up
Nota pembayaran
0.6 cm
0.8 cm
2.1 cm
1.4 cm
8.3 cm
3.1 cm
1.1 cm 4 cm 0.9 cm 3.9 cm 0.4 cm
1 cm
5.5 cm
Nota/ bill uk. 10.5 x 16.4 cm
GRAPHIC STANDART MANUAL 45
STATIONERY AND ADMINISTRATIVE
Mailing Label
Kepada :
text
0.8 cm
Ny. Mutiara Larasati
Jl. Wijayakusuma, Tegal mindi, Sinduadi,
Sleman, Yogyakarta 54451
Kepada :
centre text
Mailing label uk. 6.7 x 3.2 cm
GRAPHIC STANDART MANUAL 46
STATIONERY AND ADMINISTRATIVE
Presentation Slide
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
Produk Kami
ukuran disesuaikan dengan kebutuhan
secara garis besar ada tiga macam style
yang dapat digunakan.
background putih background full
warna korporat, dan background
ornament.
dianjurkan untuk memakai ornament
dan abstrak bentuk logo untuk
memperkuat identitas perusahaan.
contoh aplikasi dengan konten
GRAPHIC STANDART MANUAL 47
WEB SITES
Web Sites
www.dinarkebaya.com
tampilan interface yang simple. mengutamakan foto.
dinar kebayaspesialis kebaya & make up
artikel spoiler
dinar kebayaspesialis kebaya & make up
Make Up
Home Profile Gallery Contact
dinar kebayaspesialis kebaya & make up
Home Profile Gallery Contact
dinar kebayaspesialis kebaya & make up
photo
menu menu menu menu
Dinar Kebaya adress
menu menu menu menu
Dinar Kebaya adress
text
Template desain website
Contoh aplikasi desain website
GRAPHIC STANDART MANUAL 48
PR / IR COMMUNICATIONS
Press Kit Folder
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
Galeri Pusat di GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang, JawaTimur - Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com
www.dinarkebaya.com
49 CM
22 CM
5 CM
34 CM
map tampak luar
dilipat kedalam
GRAPHIC STANDART MANUAL 49
PR / IR COMMUNICATIONS
Press Kit Folder
dinar kebayaspesialis kebaya & make up
9 CM
map tampak dalam
rongga untuk menyelipkan
kartunama
GRAPHIC STANDART MANUAL 50
PR / IR COMMUNICATIONS
Press Kit Folder
dinar kebayaspesialis kebaya & make up
center
11 cm
21 cm
3.2 cm
2.3 cm
center
ilustrasi
text
text
text
brosur 2 sisi
GRAPHIC STANDART MANUAL 51
PR / IR COMMUNICATIONS
Certificate
dinar kebayaspesialis kebaya & make up
Certificateof ........................
This is to certify that
name
position
..............,
area
alamat dan kontak
Dinar Kebaya
ukuran 29.7 x 21 cm
10 x 4 cm
GRAPHIC STANDART MANUAL 52
PR / IR COMMUNICATIONS
Press Kit Folder
CD case
dinar kebayaspesialis kebaya & make up
area
alamat dan kontak
Dinar Kebaya
GRAPHIC STANDART MANUAL 53
PR / IR COMMUNICATIONS
Press Kit Folder
13 cm
13 cm
6,5 cm
1,5 cm
13 cm
dinar kebayaspesialis kebaya & make up
CD case & label
GRAPHIC STANDART MANUAL 54
PR / IR COMMUNICATIONS
Press Kit Folder
leaflet uk. A6 1 sisi (10.5 x 14.8 cm)
ilustration text
text
text
ilustration
GRAPHIC STANDART MANUAL 55
HR Communications
Recruitmen Ad Format
Open
Recruitmen
sebagai karyawati di Dinar Kebaya
dengan syarat :
wanita 18- 30 tahun
berpenampilan menarik
keterampilan tata rias & busana diutamakan
Galeri Pusat di GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com
www.dinarkebaya.com
dinar kebayaspesialis kebaya & make up
Kirim lamaran ke :
dinar kebayaspesialis kebaya & make up
21 cm
23 cm
2.5 cm
3.2 cm
2.3 cm
text
contoh aplikasi template
GRAPHIC STANDART MANUAL 56
FACILITIES SIGNS
Building Signage
dinar kebayaspesialis kebaya & make up
Building Signage dibagi menjadi dua macam, yaitu neon box dan channel letter.
ukuran menyesuaikan bangunan dengan skala yang proporsional dengan logo.
building signage sangat penting untuk menandai bahwa bangunan atau
tempat tertentu adalah galery atau butik dinar kebaya.
ukuran menyesuaikan
dengan skala
proporsional
GRAPHIC STANDART MANUAL 57
FACILITIES SIGNS
Building Signage
dinar kebaya
spesialis kebaya & make up
NEON BOX
Berupa print backlight dengan lampu dari dalam. jika memakai bahan stiker maka bahan
background dari neon box dengan logo memakai warna blok (bukan gradasi).
namn lebih diutamakan jika menggunakan logo gradasi.
GRAPHIC STANDART MANUAL 58
FACILITIES SIGNS
Building Signage
dinar kebayaspesialis kebaya & make up
VARIASI GRAFIS NEON BOX
Neon Box bisa ditambahkan dengan background ornament namun tidak bertumpuk dengan
logo. logo harus selalu dengan background putih untuk building signage.
tidak diperkenankan menambah apapun pada background kecuali ornament yang telah di
contohkan diatas. bila ada promo atau unsur image lain dapat menggunakan media yang
terpisah dari building signage ini. hal ini bertujuan untuk menjaga tanda identitas gallery
atau butik dinar kebaya
Penggunaaan channel letter hany pada logo, sedangkan background tetap dengan print
backlight.
GRAPHIC STANDART MANUAL 59
FACILITIES SIGNS
Building Signage
ALTERNATIF SIGNAGE
Bentuk signage seperti disamping dapat diaplikasikan
bila signage building yang dijelaskan sebelumnya
menempati posisi yang kurang bisa dilihat oleh publik.
misalkan antara butik dengan jalan raya terlalu jauh.
hal-hal lain dapat menjadi pertimbangan untuk
dapat menggunakan alternatif signage ini.
logo tetap harus dengan background putih
neon box
tembok
dinar kebayaspesialis kebaya & make up
alamat website
ilustrasi
95 cm
112 cm
51 cm
40 cm
240 cm
130 cm
GRAPHIC STANDART MANUAL 60
FACILITIES SIGNS
Building Signage
CHANNEL LETTER
Ketebalan huruf menyesuaikan dengan huruf. warna yang ada disamping harus sama
dengan warna yang didepannya. lampu bisa dtempatkan di didalam huruf.
dinar kebaya
spesialis kebaya & make up
dinar kebaya
spesialis kebaya & make up
dd
GRAPHIC STANDART MANUAL 61
FACILITIES SIGNS
Umbul-umbul
dinar kebayaspesialis kebaya & make up
Spesialis
Make Up
dan
Kebaya
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
Bentuk yang diperbolehkan
panjang : 3.5 m
lebar : menyesuaikan
GRAPHIC STANDART MANUAL 62
VEHICLE
Car Branding
Daihatsu Gran Max
panjang = 4,045 mm, tinggi = 1,900 (with tires) mm
WiFi
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
Lampu Lampu
N 1111
ilustrasi
logo
text promo
GRAPHIC STANDART MANUAL 63
N 1111
Lampu Lampu
dinar kebayaspesialis kebaya & make up
Lampu Lampu
N 1111
kebaya selalu membuat
Anda Cantik!
jika Anda tahu bagaimana menemukannya
KONSULTASIKAN DESAIN BA JU KEBAYA ANDA TERLEBIH DAHULU,
KAMI AKAN MEMBERIK AN YANG TERBAIK
dinar kebayaspesialis kebaya & make up
contoh aplikasi untuk konten
VEHICLE
Car Branding
Daihatsu Gran Max
panjang = 4,045 mm, tinggi = 1,900 (with tires) mm
GRAPHIC STANDART MANUAL 64
MARKETING SALES
Brochures (Pricelist)
text
ilustrasi
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
text text text
ukuran 21 x 33 cm
GRAPHIC STANDART MANUAL 65
MARKETING SALES
Brochures (Pricelist)
GAYATRIpackage
Gayatri I 7 Juta
Gayatri II 10 Juta
Make Up Pengantin
Hijab / Hairdo Akad Resepsi
2 Sepasang Kebaya
Ibu Dan Besan
Make Up + Sanggul / Hijab (akad)
Make Up + Sanggul / Hijab (resepsi)
Bapak Dan Besan
Basofi / Beskap (resepsi)
Kembar Mayang
2 Make Up + Sanggul / Hijab + Kebaya
2 Basofi / Beskap Remaja Putra
Mc Akad Resepsi
Dekor Akad Nikah
BONUS PERAWATAN PREWEDDING
Make Up Pengantin
Hijab / Hairdo Akad Resepsi
2 Sepasang Kebaya
Ibu Dan Besan
Make Up + Sanggul / Hijab (akad)
Make Up + Sanggul / Hijab (resepsi)
Bapak Dan Besan
Basofi / Beskap (resepsi)
Kembar Mayang
2 Make Up + Sanggul / Hijab + Kebaya
2 Basofi / Beskap Remaja Putra
pricelist/peritem
MAHISApackage
TRIBUANApackage
GAYATRIipackage
dinar kebayaspesialis kebaya & make up
Price List
Packages
Wedding
&
PACKAGE
PACKAGE
PACKAGE
PACKAGE
dinar kebayaspesialis kebaya & make up
TEXT
ILUSTRASI
UK. 15 X 19 cm
contoh dengan konten
GRAPHIC STANDART MANUAL 66
MARKETING SALES
Poster/ Print Ad
ilustrasi
foto
head text
&
keterangan
alamat
&
kontak
logo
komposisi
GRAPHIC STANDART MANUAL 67
MARKETING SALES
Poster/ Print Ad
GRAPHIC STANDART MANUAL 68
ukuran A3. konten poster hanya sebagai contoh
Paket
Wisuda
gratis
foto wisuda
Desain dan Jahit Kebaya,
Traditional & Modern Make up,
Tata Rias Pengantin, Prewedding, Wisuda,
Sewa Baju Pengantin,
Foto & Shooting, Dekorasi Dll
GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang
Jawa Timur - Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154
email : dinarkebaya26@yahoo.com
dinar kebaya
@dinarkebaya
www.dinarkebaya.com
dinar kebayaspesialis kebaya & make up
ilustrasi foto
model kebaya
dengan background putih
atau abu-abu
ilustrasi foto
model kebaya
dengan background putih
atau abu-abu
alamat Dinar Kebaya
dan kontak
logo diatas
MARKETING SALES
Poster/ Print Ad
GRAPHIC STANDART MANUAL 69
ukuran A3. alternatif layout. konten poster hanya sebagai contoh
Wedding
Exhibition
dinar kebaya
gracia wedding organizer
p r e s e n t
tata rias dan busana pengantin, bridal,
wedding documentation, decoration,
wedding organizer, dll
(all about wedding)
5-7 September,
Grand Hall MATOS
DAPATKAN UNDIAN
SEPASANG CINCIN BERLIAN
DAN TIKET HONEYMOON
KE BALI
CONTACT :
Gracia WO
081803888222
Dinar Kebaya
0341 5446071
www.graciawo.com
www.dinarkebaya.com
dinar kebaya Gracia
ilustrasi foto
model kebaya
dengan background putih
atau abu-abu
29.7 cm
11 cm
3.5 cm
10.5 cm
42cm
head text
memakai jenis huruf
yang berbeda dengan
keterangan
keterangan
alamat Dinar Kebaya
dan kontak
MARKETING SALES
Banner / Spanduk
Head
Text
dinar kebayaspesialis kebaya & make up
sub keterangan
alamat dan kontak Dinar Kebaya
keterangan
Paket
Wisuda
Gratis Foto Wisuda!
dinar kebayaspesialis kebaya & make up
Desain dan Jahit Kebaya, Traditional & Modern Make up,
Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin,
Foto & Shooting, Dekorasi Dll
GRAHA UTERO SOEKARNO HATTA 2B - Malang 0341 - 5446071 / 081803813154
www.dinarkebaya.com
contoh aplikasi template dan komposisi banner uk. 2 x 1 m
(ukuran dapat diubah namun tetap proporsi)
template banner
ilustrasi
GRAPHIC STANDART MANUAL 70
dinar kebayaspesialis kebaya & make up
Wedding
Package
(Mahisa,Tribuana,Gayatri)
Desain dan Jahit Kebaya, Traditional & Modern Make up,
Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin,
Foto & Shooting, Dekorasi Dll
GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang
Telp. 0341 - 5446071 / 081803813154
www.dinarkebaya.com
dinar kebayaspesialis kebaya & make up
Head
Text
keterangan
sub keterangan
ilustrasiilustrasi
alamat dan kontak Dinar Kebaya
template banner/ spanduk
contoh aplikasi template dan komposisi banner uk. 4 x 1 m
(ukuran dapat diubah namun tetap proporsi)
MARKETING SALES
Banner / Spanduk
GRAPHIC STANDART MANUAL 71
MARKETING SALES
X banner
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
Text
Text
ilustration
Text
Text
center
ilustration
Text
uk. 60 x 160 cm
GRAPHIC STANDART MANUAL 72
IDENTITY INTRODUCTION
Seragam Karyawan
Seragam Formal.
seragm ini dipakai untuk acara formal.
bawahan berupa rok batik.
Bordir
penambahan
bros
GRAPHIC STANDART MANUAL 73
IDENTITY INTRODUCTION
Seragam Karyawan
Seragam Semi formal
berupa blazer yang bisa
dipadupadankan dengan
baju lain. dapat memakai
bawahan rok ataupun celana.
warna bawahan yang digunakan meliputi warna yang senada dengan blazer, hitam, atau bisa juga
dengan memakai jeans. Memakai warna lain tidak diperbolehkan karena dapat
mengganggu kejelasan identitas Dinar Kebaya.
Bordir
Bros
GRAPHIC STANDART MANUAL 74
IDENTITY INTRODUCTION
dinar kebayaspesialis kebaya & make up
dapat dipakai oleh karyawan ketika dalam suasana santai dan bekerja sehari hari.
Seragam Karyawan
GRAPHIC STANDART MANUAL 75
IDENTITY INTRODUCTION
Merchandise / Gifts
BROS
d: 2 cm
d: 2 cm
khusus bros boleh
memakai warna emas/ warna dari bahan
www.dinarkebaya.com
d: 3 cm
bahan akrilik bening
dinar kebayaspesialis kebaya & make up
uk: 5 x 1.5 cm
GANTUNGAN KUNCI
GRAPHIC STANDART MANUAL 76
IDENTITY INTRODUCTION
Merchandise / Gifts
dinar kebayaspesialis kebaya & make up
Galeri Pusat di GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com
www.dinarkebaya.com
Galeri Pusat di GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com
www.dinarkebaya.com
dinar kebayaspesialis kebaya & make up
Paper Bag
GRAPHIC STANDART MANUAL 77
IDENTITY INTRODUCTION
Merchandise / Gifts
dinar kebayaspesialis kebaya & make up
MUG / Gelas
Bolpoin
diameter logo: 8 cm
uk : 4 x 0.9 cm
uk : 4 x 0.9 cm
GRAPHIC STANDART MANUAL 78
IDENTITY INTRODUCTION
Kaos
dinar kebayaspesialis kebaya & make up
dinar kebayaspesialis kebaya & make up
depan belakang
GRAPHIC STANDART MANUAL 79
IDENTITY INTRODUCTION
Hanger Baju
dinar kebaya
dinar kebayaspesialis kebaya & make up
dinar kebaya
80 cm
16 cm
30 cm
GRAPHIC STANDART MANUAL 80
1.5 x 1.5 cm
dinar kebaya
3 x 1 cm
dinar kebaya
3 x 1.5 cm
baju
kebaya
baju
kebaya
IDENTITY INTRODUCTION
Label baju
GRAPHIC STANDART MANUAL 81
Demikianpenjelasan GraphicStandardManualDinarKebaya.
Hal ini tidak akan dapat banyak manfaat kecuali dengan penerapan yang baik dan sesuai.
Semoga dengan adanya logo baru Dinar Kebaya ini dapat memberikan semangat kerja bagi
karyawansecarapersonal,sertapihak-pihakyangmendukungperusahaanDinarKebaya.
Visi perusahaan untuk bertandang di kancah global tidaklah tidak mungkin karena dengan tekad
yang kuat dan terus berproses berkembang maju, Dinar Kebaya dapat sukses menggapai visi
perusahaan.
Pada penerapan media, masih banyak media yang belum dicantumkan pada GSM ini
karena media terus berkembang. Namun, benang merah dari acuan media aplikasi corporate
identity Dinar Kebaya adalah muda, modern, feminim. Aspek-aspek dari penataan yang baik sesuai
denganmediajugaperludiperhatikan.
Sukses untuk Dinar Kebaya!
PENUTUP
Alamat :
GRAHA UTERO SOEKARNO HATTA
Jl. Soekarno Hatta 2B - Malang
Jawa Timur - Indonesia - 65141
Telp. 0341 - 5446071 / 081803813154
branch office :
Jl. Aris Munandar no. 105 Malang
Telp - 0341 - 7588833
appoinment at 08133309191
www.dinarkebaya.com
email : dinarkebaya26@yahoo.com
f : facebook.com/dinar.rahadian.7
dinar kebayaspesialis kebaya & make up
Corporate Identity Design by:
Naila Conita
email: nailaconita@gmail.com
@2014
woman
own
”
”
dinar kebayaspesialis kebaya & make up

More Related Content

What's hot

GSM WISMARI (GRAFIS STANDAR MANUAL)
GSM WISMARI (GRAFIS STANDAR MANUAL)GSM WISMARI (GRAFIS STANDAR MANUAL)
GSM WISMARI (GRAFIS STANDAR MANUAL)
UTERO INDONESIA (utero.id)
 
Logo presentation- SW bakery and coffee
Logo presentation- SW bakery and coffeeLogo presentation- SW bakery and coffee
Logo presentation- SW bakery and coffee
UTERO INDONESIA (utero.id)
 
GSM Kampung Keramat
GSM Kampung KeramatGSM Kampung Keramat
GSM Kampung Keramat
UTERO INDONESIA (utero.id)
 
GSM BPR Artha Kanjuruhan 2020
GSM BPR Artha Kanjuruhan 2020GSM BPR Artha Kanjuruhan 2020
GSM BPR Artha Kanjuruhan 2020
UTERO INDONESIA (utero.id)
 
PT. Gatra Mapan
PT. Gatra MapanPT. Gatra Mapan
Graphics Standard Manual - Lak Lik
Graphics Standard Manual - Lak LikGraphics Standard Manual - Lak Lik
Graphics Standard Manual - Lak Lik
Yanuar Rahman
 
Graphic Standar Manual Stamford FC Indonesia
Graphic Standar Manual Stamford FC IndonesiaGraphic Standar Manual Stamford FC Indonesia
Graphic Standar Manual Stamford FC Indonesia
UTERO INDONESIA (utero.id)
 
fixkglogo.pdf
fixkglogo.pdffixkglogo.pdf
fixkglogo.pdf
dandihermawan5
 
LOGO ALTERNATIF INDONESIA 73
LOGO ALTERNATIF INDONESIA 73 LOGO ALTERNATIF INDONESIA 73
LOGO ALTERNATIF INDONESIA 73
UTERO INDONESIA (utero.id)
 
Event Guideline Pekan Kabi Nasional 2020
Event Guideline Pekan Kabi Nasional 2020Event Guideline Pekan Kabi Nasional 2020
Event Guideline Pekan Kabi Nasional 2020
UTERO INDONESIA (utero.id)
 
Graphics Standard Manual - Catfish
Graphics Standard Manual - CatfishGraphics Standard Manual - Catfish
Graphics Standard Manual - Catfish
Yanuar Rahman
 
Google Wayfinding Proposal
Google Wayfinding ProposalGoogle Wayfinding Proposal
Google Wayfinding Proposal
UTERO INDONESIA (utero.id)
 
How to make Brand Guideline
How to make Brand GuidelineHow to make Brand Guideline
How to make Brand Guideline
Bella Dwi Jayanti
 
PT. Sang Hyang Seri (PERSERO)
PT. Sang Hyang Seri (PERSERO)PT. Sang Hyang Seri (PERSERO)
PT. Sang Hyang Seri (PERSERO)
UTERO INDONESIA (utero.id)
 
GSM OSIJI MASKOT
GSM OSIJI MASKOTGSM OSIJI MASKOT
GSM OSIJI MASKOT
UTERO INDONESIA (utero.id)
 
Utero Indonesia
Utero IndonesiaUtero Indonesia
Ngedesain logo : Belajar Sketsa dan Konsep
Ngedesain logo : Belajar Sketsa dan Konsep Ngedesain logo : Belajar Sketsa dan Konsep
Ngedesain logo : Belajar Sketsa dan Konsep
Rio Purba
 
pdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdf
pdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdfpdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdf
pdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdf
AryDwiyanto1
 
Materi Logo.pptx
Materi Logo.pptxMateri Logo.pptx
Materi Logo.pptx
hadypsaputro2
 

What's hot (20)

GSM WISMARI (GRAFIS STANDAR MANUAL)
GSM WISMARI (GRAFIS STANDAR MANUAL)GSM WISMARI (GRAFIS STANDAR MANUAL)
GSM WISMARI (GRAFIS STANDAR MANUAL)
 
Logo presentation- SW bakery and coffee
Logo presentation- SW bakery and coffeeLogo presentation- SW bakery and coffee
Logo presentation- SW bakery and coffee
 
GSM Kampung Keramat
GSM Kampung KeramatGSM Kampung Keramat
GSM Kampung Keramat
 
GSM BPR Artha Kanjuruhan 2020
GSM BPR Artha Kanjuruhan 2020GSM BPR Artha Kanjuruhan 2020
GSM BPR Artha Kanjuruhan 2020
 
PT. Gatra Mapan
PT. Gatra MapanPT. Gatra Mapan
PT. Gatra Mapan
 
Graphics Standard Manual - Lak Lik
Graphics Standard Manual - Lak LikGraphics Standard Manual - Lak Lik
Graphics Standard Manual - Lak Lik
 
Graphic Standar Manual Stamford FC Indonesia
Graphic Standar Manual Stamford FC IndonesiaGraphic Standar Manual Stamford FC Indonesia
Graphic Standar Manual Stamford FC Indonesia
 
fixkglogo.pdf
fixkglogo.pdffixkglogo.pdf
fixkglogo.pdf
 
LOGO ALTERNATIF INDONESIA 73
LOGO ALTERNATIF INDONESIA 73 LOGO ALTERNATIF INDONESIA 73
LOGO ALTERNATIF INDONESIA 73
 
Event Guideline Pekan Kabi Nasional 2020
Event Guideline Pekan Kabi Nasional 2020Event Guideline Pekan Kabi Nasional 2020
Event Guideline Pekan Kabi Nasional 2020
 
Graphics Standard Manual - Catfish
Graphics Standard Manual - CatfishGraphics Standard Manual - Catfish
Graphics Standard Manual - Catfish
 
Google Wayfinding Proposal
Google Wayfinding ProposalGoogle Wayfinding Proposal
Google Wayfinding Proposal
 
How to make Brand Guideline
How to make Brand GuidelineHow to make Brand Guideline
How to make Brand Guideline
 
PT. Sang Hyang Seri (PERSERO)
PT. Sang Hyang Seri (PERSERO)PT. Sang Hyang Seri (PERSERO)
PT. Sang Hyang Seri (PERSERO)
 
GSM OSIJI MASKOT
GSM OSIJI MASKOTGSM OSIJI MASKOT
GSM OSIJI MASKOT
 
Presentasi yamaha
Presentasi yamahaPresentasi yamaha
Presentasi yamaha
 
Utero Indonesia
Utero IndonesiaUtero Indonesia
Utero Indonesia
 
Ngedesain logo : Belajar Sketsa dan Konsep
Ngedesain logo : Belajar Sketsa dan Konsep Ngedesain logo : Belajar Sketsa dan Konsep
Ngedesain logo : Belajar Sketsa dan Konsep
 
pdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdf
pdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdfpdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdf
pdfcoffee.com_panduan-dan-aplikasi-identitas-perusahaan-plnpdf-pdf-free.pdf
 
Materi Logo.pptx
Materi Logo.pptxMateri Logo.pptx
Materi Logo.pptx
 

Similar to Dinar Kebaya

Legent tren 08.222.8888.349 legend tren dan legend millenial
Legent tren 08.222.8888.349 legend tren dan legend millenialLegent tren 08.222.8888.349 legend tren dan legend millenial
Legent tren 08.222.8888.349 legend tren dan legend millenial
legendmillenial
 
COMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdf
COMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdfCOMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdf
COMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdf
chakraworksid
 
meteri KT untuk kampar kiri.pptx
meteri KT untuk kampar kiri.pptxmeteri KT untuk kampar kiri.pptx
meteri KT untuk kampar kiri.pptx
MasriKumar
 
Graphics Standard Manual - Catfish
Graphics Standard Manual - CatfishGraphics Standard Manual - Catfish
Graphics Standard Manual - Catfish
riyanberlian.com
 
How Grab Make a Brand?
How Grab Make a Brand?How Grab Make a Brand?
How Grab Make a Brand?
HIA Class.
 
Company profli upgrade litle
Company profli upgrade litleCompany profli upgrade litle
Company profli upgrade litle
upgrade graphic design
 
Legend Millenial By Legend Tren
Legend Millenial By Legend TrenLegend Millenial By Legend Tren
Legend Millenial By Legend Tren
legendtrenofficial
 
Presentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdf
Presentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdfPresentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdf
Presentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdf
rioantonio2006
 
Graphic Design Bab 1-1.pptx
Graphic Design Bab 1-1.pptxGraphic Design Bab 1-1.pptx
Graphic Design Bab 1-1.pptx
RestuAicomXVRezthu
 
Logo guide rumah halal
Logo guide rumah halalLogo guide rumah halal
Logo guide rumah halal
UswanNurIman
 
Thursina_Brand_Guideline_1.0.pdf
Thursina_Brand_Guideline_1.0.pdfThursina_Brand_Guideline_1.0.pdf
Thursina_Brand_Guideline_1.0.pdf
ssuser72db00
 
Brand identity guidelines
Brand identity guidelinesBrand identity guidelines
Brand identity guidelines
Arumdari Nurgianti
 

Similar to Dinar Kebaya (12)

Legent tren 08.222.8888.349 legend tren dan legend millenial
Legent tren 08.222.8888.349 legend tren dan legend millenialLegent tren 08.222.8888.349 legend tren dan legend millenial
Legent tren 08.222.8888.349 legend tren dan legend millenial
 
COMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdf
COMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdfCOMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdf
COMPANY PROFILE CHAKRAWORKS - INTEGRATED BRANDING SOLUTION.pdf
 
meteri KT untuk kampar kiri.pptx
meteri KT untuk kampar kiri.pptxmeteri KT untuk kampar kiri.pptx
meteri KT untuk kampar kiri.pptx
 
Graphics Standard Manual - Catfish
Graphics Standard Manual - CatfishGraphics Standard Manual - Catfish
Graphics Standard Manual - Catfish
 
How Grab Make a Brand?
How Grab Make a Brand?How Grab Make a Brand?
How Grab Make a Brand?
 
Company profli upgrade litle
Company profli upgrade litleCompany profli upgrade litle
Company profli upgrade litle
 
Legend Millenial By Legend Tren
Legend Millenial By Legend TrenLegend Millenial By Legend Tren
Legend Millenial By Legend Tren
 
Presentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdf
Presentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdfPresentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdf
Presentasi Hitam Hijau Neon Merah Muda Neon Trendi Ilustratif Kreatif.pdf
 
Graphic Design Bab 1-1.pptx
Graphic Design Bab 1-1.pptxGraphic Design Bab 1-1.pptx
Graphic Design Bab 1-1.pptx
 
Logo guide rumah halal
Logo guide rumah halalLogo guide rumah halal
Logo guide rumah halal
 
Thursina_Brand_Guideline_1.0.pdf
Thursina_Brand_Guideline_1.0.pdfThursina_Brand_Guideline_1.0.pdf
Thursina_Brand_Guideline_1.0.pdf
 
Brand identity guidelines
Brand identity guidelinesBrand identity guidelines
Brand identity guidelines
 

More from UTERO INDONESIA (utero.id)

Presentasi pilihan karir di era sekarang
Presentasi pilihan karir di era sekarangPresentasi pilihan karir di era sekarang
Presentasi pilihan karir di era sekarang
UTERO INDONESIA (utero.id)
 
Presentasi video marketing
Presentasi video marketingPresentasi video marketing
Presentasi video marketing
UTERO INDONESIA (utero.id)
 
Presentasi digital branding
Presentasi digital brandingPresentasi digital branding
Presentasi digital branding
UTERO INDONESIA (utero.id)
 
Graphic Standar Manual Universitas Widyagama Malang
Graphic Standar Manual Universitas Widyagama MalangGraphic Standar Manual Universitas Widyagama Malang
Graphic Standar Manual Universitas Widyagama Malang
UTERO INDONESIA (utero.id)
 
PROPOSAL CEBRO AGENCY DRIVE THRU
PROPOSAL CEBRO AGENCY DRIVE THRUPROPOSAL CEBRO AGENCY DRIVE THRU
PROPOSAL CEBRO AGENCY DRIVE THRU
UTERO INDONESIA (utero.id)
 
PROPOSAL CEBRO AGENCY SMK ISLAM 1 BATU
PROPOSAL CEBRO AGENCY SMK ISLAM 1 BATUPROPOSAL CEBRO AGENCY SMK ISLAM 1 BATU
PROPOSAL CEBRO AGENCY SMK ISLAM 1 BATU
UTERO INDONESIA (utero.id)
 
DESIGN BOOTH CEBRO AGENCY
DESIGN BOOTH CEBRO AGENCY DESIGN BOOTH CEBRO AGENCY
DESIGN BOOTH CEBRO AGENCY
UTERO INDONESIA (utero.id)
 
2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang
2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang
2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang
UTERO INDONESIA (utero.id)
 
2017 BUKU EKRAF sub sektor film, video, animasi kota malang
2017 BUKU EKRAF sub sektor film, video, animasi kota malang2017 BUKU EKRAF sub sektor film, video, animasi kota malang
2017 BUKU EKRAF sub sektor film, video, animasi kota malang
UTERO INDONESIA (utero.id)
 
VISUAL GUIDELINE Pencitraan Malang Kota Kreatif
VISUAL GUIDELINE Pencitraan Malang Kota Kreatif VISUAL GUIDELINE Pencitraan Malang Kota Kreatif
VISUAL GUIDELINE Pencitraan Malang Kota Kreatif
UTERO INDONESIA (utero.id)
 
Roadmap pencitraan diskopindag min
Roadmap pencitraan diskopindag  minRoadmap pencitraan diskopindag  min
Roadmap pencitraan diskopindag min
UTERO INDONESIA (utero.id)
 
BUKU EKRAF sub sektor Film, Video, Animasi Kota Malang
BUKU EKRAF sub sektor Film, Video, Animasi Kota MalangBUKU EKRAF sub sektor Film, Video, Animasi Kota Malang
BUKU EKRAF sub sektor Film, Video, Animasi Kota Malang
UTERO INDONESIA (utero.id)
 
BUKU EKRAF sub sektor Kuliner Kota Malang
BUKU EKRAF sub sektor Kuliner Kota MalangBUKU EKRAF sub sektor Kuliner Kota Malang
BUKU EKRAF sub sektor Kuliner Kota Malang
UTERO INDONESIA (utero.id)
 
MALANG CREATIVE CENTER
MALANG CREATIVE CENTERMALANG CREATIVE CENTER
MALANG CREATIVE CENTER
UTERO INDONESIA (utero.id)
 
CALENDAR UWG 2021
CALENDAR UWG 2021CALENDAR UWG 2021
CALENDAR UWG 2021
UTERO INDONESIA (utero.id)
 
BUKU KOLABORASI RAYA DI BUMI AREMA
BUKU KOLABORASI RAYA DI BUMI AREMABUKU KOLABORASI RAYA DI BUMI AREMA
BUKU KOLABORASI RAYA DI BUMI AREMA
UTERO INDONESIA (utero.id)
 
BUKU PUTIH KOTA KREATIF
BUKU PUTIH KOTA KREATIFBUKU PUTIH KOTA KREATIF
BUKU PUTIH KOTA KREATIF
UTERO INDONESIA (utero.id)
 
BUKU KATA KREATIF
BUKU KATA KREATIFBUKU KATA KREATIF
BUKU KATA KREATIF
UTERO INDONESIA (utero.id)
 
YOUTUBE PACKAGE - SI GEMBEL
YOUTUBE PACKAGE - SI GEMBELYOUTUBE PACKAGE - SI GEMBEL
YOUTUBE PACKAGE - SI GEMBEL
UTERO INDONESIA (utero.id)
 
YOUTUBE PACKAGE - JAGOAN BETON
YOUTUBE PACKAGE - JAGOAN BETONYOUTUBE PACKAGE - JAGOAN BETON
YOUTUBE PACKAGE - JAGOAN BETON
UTERO INDONESIA (utero.id)
 

More from UTERO INDONESIA (utero.id) (20)

Presentasi pilihan karir di era sekarang
Presentasi pilihan karir di era sekarangPresentasi pilihan karir di era sekarang
Presentasi pilihan karir di era sekarang
 
Presentasi video marketing
Presentasi video marketingPresentasi video marketing
Presentasi video marketing
 
Presentasi digital branding
Presentasi digital brandingPresentasi digital branding
Presentasi digital branding
 
Graphic Standar Manual Universitas Widyagama Malang
Graphic Standar Manual Universitas Widyagama MalangGraphic Standar Manual Universitas Widyagama Malang
Graphic Standar Manual Universitas Widyagama Malang
 
PROPOSAL CEBRO AGENCY DRIVE THRU
PROPOSAL CEBRO AGENCY DRIVE THRUPROPOSAL CEBRO AGENCY DRIVE THRU
PROPOSAL CEBRO AGENCY DRIVE THRU
 
PROPOSAL CEBRO AGENCY SMK ISLAM 1 BATU
PROPOSAL CEBRO AGENCY SMK ISLAM 1 BATUPROPOSAL CEBRO AGENCY SMK ISLAM 1 BATU
PROPOSAL CEBRO AGENCY SMK ISLAM 1 BATU
 
DESIGN BOOTH CEBRO AGENCY
DESIGN BOOTH CEBRO AGENCY DESIGN BOOTH CEBRO AGENCY
DESIGN BOOTH CEBRO AGENCY
 
2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang
2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang
2017 BUKU EKRAF sub sektor Aplikasi dan Game Kota Malang
 
2017 BUKU EKRAF sub sektor film, video, animasi kota malang
2017 BUKU EKRAF sub sektor film, video, animasi kota malang2017 BUKU EKRAF sub sektor film, video, animasi kota malang
2017 BUKU EKRAF sub sektor film, video, animasi kota malang
 
VISUAL GUIDELINE Pencitraan Malang Kota Kreatif
VISUAL GUIDELINE Pencitraan Malang Kota Kreatif VISUAL GUIDELINE Pencitraan Malang Kota Kreatif
VISUAL GUIDELINE Pencitraan Malang Kota Kreatif
 
Roadmap pencitraan diskopindag min
Roadmap pencitraan diskopindag  minRoadmap pencitraan diskopindag  min
Roadmap pencitraan diskopindag min
 
BUKU EKRAF sub sektor Film, Video, Animasi Kota Malang
BUKU EKRAF sub sektor Film, Video, Animasi Kota MalangBUKU EKRAF sub sektor Film, Video, Animasi Kota Malang
BUKU EKRAF sub sektor Film, Video, Animasi Kota Malang
 
BUKU EKRAF sub sektor Kuliner Kota Malang
BUKU EKRAF sub sektor Kuliner Kota MalangBUKU EKRAF sub sektor Kuliner Kota Malang
BUKU EKRAF sub sektor Kuliner Kota Malang
 
MALANG CREATIVE CENTER
MALANG CREATIVE CENTERMALANG CREATIVE CENTER
MALANG CREATIVE CENTER
 
CALENDAR UWG 2021
CALENDAR UWG 2021CALENDAR UWG 2021
CALENDAR UWG 2021
 
BUKU KOLABORASI RAYA DI BUMI AREMA
BUKU KOLABORASI RAYA DI BUMI AREMABUKU KOLABORASI RAYA DI BUMI AREMA
BUKU KOLABORASI RAYA DI BUMI AREMA
 
BUKU PUTIH KOTA KREATIF
BUKU PUTIH KOTA KREATIFBUKU PUTIH KOTA KREATIF
BUKU PUTIH KOTA KREATIF
 
BUKU KATA KREATIF
BUKU KATA KREATIFBUKU KATA KREATIF
BUKU KATA KREATIF
 
YOUTUBE PACKAGE - SI GEMBEL
YOUTUBE PACKAGE - SI GEMBELYOUTUBE PACKAGE - SI GEMBEL
YOUTUBE PACKAGE - SI GEMBEL
 
YOUTUBE PACKAGE - JAGOAN BETON
YOUTUBE PACKAGE - JAGOAN BETONYOUTUBE PACKAGE - JAGOAN BETON
YOUTUBE PACKAGE - JAGOAN BETON
 

Dinar Kebaya

  • 1. G r a p h i c S t a n d a r d M a n u a l dinar kebayaspesialis kebaya & make up
  • 2. G r a p h i c S t a n d a r d M a n u a l
  • 3.
  • 4. DAFTAR ISI Daftar Isi Kata Pengantar Identitas Logo Elemen Pembentuk Logo Logo Primer & Sekunder Konsep Logo & Teks Lampiran (tagline) Konsep Warna Background Ilustrasi Ukuran Standar Skala Minimal Konfigurasi Clearspace Gridlines Typeface Co Branded Logos Target Penempatan Logo Logo 3d 1 2 5 6 10 15 16 17 19 21 23 25 31 33 37
  • 5. DAFTAR ISI Media Aplikasi Logo Stationery and administrative Web sites PR / IR Communications Letterheads Envelope Name Card Fax Cover Sheet Notepad Bill / Nota Mailing label Presentation Slide Map Brosur Sertifikat CD Case Leaflet 38 40 41 43 44 45 46 47 48 49 51 52 53 55
  • 6. DAFTAR ISI Penutup Marketing / Sales Identity Introduction Pricelist Poster Banner X Banner Seragam Gift/ Merchandise HR Communications Facilities Signs Vehicles Recruitment Ad Form Neon Box Alternatif Grafis Channel Letter Umbul-umbul 65 67 70 72 73 76 63 56 57 60 61 62
  • 7.
  • 8. SalamSejahtera, Pertama, saya sangat bersyukur kepadaT uhanYME karena buku panduan ini telah selesai denganlancar.Dengan rasabanggadanbahagiasayamempersembahkan pedomanaplikasilogo atau Graphic Standart Manual Dinar Kebaya. Dalam revisi logo yang baru ini saya berharap peningkatan citra positif yang muncul secara internal dan eksternal. Selain itu, buku ini juga diharapkandapatmelindungipenggunaan logosecarabaikdantepatdemitercapainyaVisidanMisi perusahaan. Pedoman aplikasi logo ini berisi tentang penjelasan dan panduan dalam aplikasi logo secaratepatdan benar. Hal ini ber tujuan menjaga estetika dan fungsional logo sebagai simbol yang mewakili perusahaan. Selain juga agar tidak terjadi kesalahpenggunaan diluar dari peraturan- peraturanperusahaan. Semoga buku ini dapat bermanfaat bagi pihak yang bersangkutan terutama perusahaan Dinar Kebaya. Hal-hal yang mungkin perlu revisi di dalam buku ini, penyusun menerima kritik dan saran. Pada akhirnya buku ini bertujuan untuk membantu mewujudkan Visi dan Misi Perusahaan Dinar Kebaya. Demikian dari saya. T erima kasih atas dukungan dari semua pihak yang terkait. Semogabermanfaat.
  • 9. PROFIL PERUSAHAAN Dinar Kebaya merupakan sebuah perusahaan yang berdiri pada tahun 2007. Perusahaan inibergerakdibidangjasadanproduksikebaya.Jasayangditawarkanberpupa makeupdantatarias pengantin. Sedangkan untuk produksi kebaya, sebagian besar adalah modifikasi kebaya modern. Pada awalnya, usaha ini bertempat di rumah owner yaitu Dinar Rahadian. Kemudian pada tahun 2010 pindah ke ruko kalpataru dan kemudian berpindah lagi di ruko grahm utero soekarno hatta sampai saat ini. Pada perkembangannya, Dinar Kebaya mulai menambah jasa yang ditawarkan yaitu dengan menambahkan jasa wedding organizer.Tidak hanya make up dan rias pengantin saja, tetapi jugaadaperawatanprawedding,fotowedding,paketwisuda,dsb. Untuk produksi kebaya sendiri masih terus dikembangkan dengan inovasi yang tiada henti. Karena sebagian besar konsumen Dinar Kebaya adalah anak muda, maka modifikasi kebaya yang dilakukan adalah dengan gaya modern dan gaya baju anak muda yang ter update. Namun terdapat benang merah sendiri dari modifikasi kebaya ini, yaitu dengan tidak meninggalkan identitas tradisional kebaya itu sendiri. Dinar Kebaya memiliki visi untuk mengembangkan bisnis usahanyadanmengenalkankebayasampaikeranahinternasonal. GRAPHIC STANDART MANUAL
  • 10. Produk Dinar Kebaya berupa modifikasi kebaya modern dan tradisional. Sebagian besar adalah produk kebaya modern. Yang dimaksud dengan modifikasi kebaya modern ini adalah kebaya yang fashionable, perpaduan unsur etnik dan modern, dan juga permainan detail dari struktur kebaya itu sendiri(bisadaridetailborder,renda,payet,dsb). PRODUK PERUSAHAAN GRAPHIC STANDART MANUAL
  • 11. LOGO
  • 13. ELEMEN PEMBENTUK LOGO Cyan, Magenta, Yellow, Black (CMYK) Sistem warna yang lazim digunakan dalam proses cetak. Typeface (Font) : Nama jenis huruf yang digunakan didalam logo ini, antara lain Barkentina 1 dan Myriad Pro Picture Mark Text Mark Tagline Logo Pesan berupa teks yang diposisikan di bawah identitas logo Area sekitar logo yang sengaja dikosongkan dengan skala yang telah ditentukan untuk menghindari tabrakan dengan elemen desain lain, termasuk teks dan foto. Warna Teks (Type) Tagline Area Kosong (Clearspace) GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 1
  • 14. VERSI LOGO PRIMER & SEKUNDER Identitas logo Dinar Kebaya mempunyai dua komponen dasar, yaitu logogram (picture mark) dengan bentuk bulat dan logotype (text mark) dengan teks dinar kebaya . kedua elemen tersebutdiletakkandalamposisiratatengah. sebagai aturan pokok perusahaan, identitas ini wajib dipergunakan sebagai penanda perusahaan dalam produkdanatributperusahaan. Versi Primer / utama GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 2
  • 15. VERSI LOGO PRIMER & SEKUNDER Logo sekunder ini sebagai alternatif penempatan posisi logo selain dalam posisi rata tengah. posisi logo pada logo sekunder ini yaitu dengan arah horizontal. Dimana logogram diletakkan disebelahkiridanlogotypedisebelahkanannya. Dalam penerapannya, logo dalam versi primer lebih diutamakan. penempatan logo primer harus dimaksimalkan dan jika memang kurang sesuai dengan bidang yang dikomposisikan barulah diperbolehkan memakailogosekunder. Versi Sekunder Alternatif posisi GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 3
  • 16. Logo Sekunder Picturemark Pada perkembangannya, diharapkan pemakaian logo bisa sampai pada aplikasi logo picturemark saja. Yaitu berupa bentuk bulat. Sedangkan pada textmark tidak perlu dipakai. Setelah brand bisa kuat, teringa di pikiran target audiens, barulah logo picturemark ini bisa dipakai. Dengan pemakaian ini diharapkan brand dapat lebih diingatdandapatmenjagaefektivitaslogopadapeng-aplikasiannya. Perlu dilakukan penelitian lanjut mengenai ke-efektivitas logo picturemark ini. Diperlukan juga survei mengenai kekuatan logo dinar kebaya pada perkembangannya. Oleh karena itu, pemakaian logo picturemark ini harus setelah ada keputusan dari perusahaan mengenaikapanbisadipakai.! atau GRAPHIC STANDART MANUAL 4 VERSI LOGO PRIMER & SEKUNDER
  • 17. KONSEP LOGO DAN TEKS LAMPIRAN (TAGLINE) Berupa bentuk dasar bulat yang didalamnya terdapat bentuk salah satu sayap kupu-kupu. Sayap tersebut membentuk huruf D . Ide untuk mengambil bentuk sayap kupu-kupu dikarenakan Dinar Kebaya ingin ber kembang dan bermetamorfosa dari perusahaan yang kecil menjadi perusahaan yang besar. bentuk bulat sebagai dasarnya yaitu karena Dinar Kebaya memiliki visi untuk memperkenalkan produknya sampai ke ranah International. dari visi tersebut terpikirkanbentukbumi,sebagaitandaglobal. Logogram Logotype Dinar Kebaya berupa text Dinar Kebaya dengan menggunakan jenis huruf barkentina. jenis huruf ini berkesan etnik sehingga cocok dengan karakter Dinar Kebaya. spesialis kebaya & make up adalah taglin euntuk memperjelas identitasperusahaan. Logotype GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 5
  • 18. KONSEP WARNA Warna logo Dinar Kebaya adalah gradasi dari merah jambu menuju ungu, kemudian ada merah muda pastel disalah satu bagiannya. Merah jambu melambangkan feminim, kewanitaan kemudian ungu mewahsedangkanmerahmudapastelmelambangkananakmuda.secara keseluruhan,warnayangada pada logo ini adalah melambangkan tentang feminim, kewanitaan, anggun, mewah dengan spirit anak muda. warna sekunder untuk logo dinar kebaya yaitu putih, hitam dan silver. Warna ini digunakan untuk kebutuhantertentu(dibahasdibagianberikutnya). Konsep Warna GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 6
  • 19. C : 38 M : 99 Y : 2 K : 0 R : 169 G : 56 B : 144 C : 9 M : 87 Y : 27 K : 0 R : 221 G : 82 B : 128 WARNA KORPORAT GRAPHIC STANDART MANUAL r kebaya C : 2 M : 26 Y : 0 K : 0 R : 243 G : 200 B : 222 C : 0 M : 0 Y : 0 K : 100 R : 55 G : 52 B : 53 Untuk kebutuhan media cetak dan digital, desain logo dinar kebaya telah dipatenkan agar menjaga konsistensibranddinarkebaya. Warna primer dipakai dalam semua aplikasi media dan atribut perusahaan. kecuali untuk kondisi tertentu logo dinar kebaya diperbolehkan memakai warna sekunder. (dijelaskan di bab warna sekunder) Warna Warna Primer 7
  • 20. WARNA KORPORAT Warna sekunder dipakai sebagai alternatif dalam kebutuhan desain agar lebih bervariasi dan sesuai dengan estetika dan fungsionalnya. Warna Sekunder Warna Putih Warna putih digunakan pada desain grafis dengan variasi warna warna muda dan pastel. warna logo putih ini ditujukan untuk mendukung kesan muda, bersih dan cerah. penggunaan logo putih dengan background cerah pada prosentasi terntentu agar logo tetap bisa terlihat. warna logo putih ini bisa digunakan seagai alternatif terakhirjikasemuawarnakurangcocokuntukdikomposisikandenganwarnaprimerlogodinarkebaya. Warna Silver Warna silver digunakan pada desain grafis dengan variasi warna yang didominasi putih atau hitam. hal ini bertujuanuntukmemberikesaneleganpadatampilangrafisyangbuat. Warna Hitam Warna hitam bisa difungsionalkan seperti warna putih yang netral yaitu jika warna primer sudah tidak cocok dipakaiuntukkebutuhankomposisiwarnapadatampilangrafis. C : O M : 0 Y : 0 K : 0 R : 255 G : 255 B : 255 C : O M : 0 Y : 0 K : 60 R : 132 G : 134 B : 136 C : O M : 0 Y : 0 K : 100 R : 55 G : 52 B : 53 GRAPHIC STANDART MANUAL 8
  • 21. MODE SINGLE COLOR WARNA KORPORAT MODE PRIMER MODE GRAYSCALE MODE SINGLE COLOR penambahan line untuk single color logo GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up MODE BLACK & WHITE dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up MODE DOUBLE COLOR dinar kebayaspesialis kebaya & make up MODE DOUBLE COLOR dinar kebayaspesialis kebaya & make up GRAY SINGLE COLOR dinar kebayaspesialis kebaya & make up warna gray single color mulai black 60 sampai 30. 9
  • 22. BACKGROUND Background dapat menjadi penentuan dalam pemakaian logo. Apakah memakai logo primer atau sekunder. ataukah memakai warna primer atau sekunder. Background yang bervariasi tentunya memiliki pertimbangan- pertimbangansendiridalamaplikasilogo. Positive Reserved Reserved B / W Background foto Background foto Backround logo primer harus warna putih atau abu-abu 10 %. logo black dengan background putih, begitu juga sebaliknya. Background Background sebaiknya menggunakan warna warna yang ada dalam logo primer warna background foto yang cenderung gelap menggunakan logo single color putih, sedangkan warna background yang cenderung cerah menggunakan logo single color hitam. GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 10
  • 23. BACKGROUND Ornamen khusus ini berupa visualisasi gambar bunga yang sering digunakan untuk bordir dan payet kebaya. Dibuatuntukmemenuhikebutuhangrafistampilanbranddinarkebaya.backgroundinitidakharusselaludipakai, bisa disesuaikan dengan fungsionalnya. namun untuk menjaga konsistensi brand dinar kebaya, sebaiknya setiap mediayangakandipakai,jikamemungkinkanornameninibisadipakaimeskipunhanyasebagaiaksen. Ornamen Khusus! warna ornamen tidak boleh menonjol dari logo atau objek yang ada di atasnya. kecuali ornamen ini ditujukan sebagai wallpaper .! GRAPHIC STANDART MANUAL 11
  • 24. BACKGROUND Ornamen Khusus! GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 12
  • 25. BACKGROUND Alternatif Perpaduan Warna GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Warnabackgroundyangdipakaiharussenadasekitarwarnamerahmuda,ungu,danmerahmudapastel.selainitu jika tidak ada pilihan dapat menggunakan warna background putih, abu-abu muda (k:10), hitam, atau foto. foto punharusdenganprosentasegelapterangyangdapatmemudahkanlogotetapterbaca. 13
  • 26. BACKGROUND Perpaduan Warna yang Salah GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 14
  • 27. ILUSTRASI Untuk memaksimalkan karakter perusahaan, maka tema ilustrasi dari semua grafis identitas harus seragam Ilustrasi berupa foto dan ornamen korporat ilustrasi dalam bentuk lain kurang diperkenankan diaplikasikan Tema yang Seragam Muda Modern Profesional Feminim 15
  • 28. UKURAN MINIMAL, CLEARSPACE & GUIDELINES Ukuran logo pada setiap aplikasinya tidak boleh lebih kecil dari ukuran yang telah ditetapkan. Hal ini berguna agar logo tetap dalam proporsi yang baik dan tetap mudahdikenalidanataudibaca. dinar kebayaspesialis kebaya & make up 30 mm 7 mm 22 mm 6.7 mm 4 mm 7 mm 30 mm 16 mm 9 mm 5.5 mm 9.4 mm Untuk ukuran terkecil ini boleh tidak menggunakan tagline. karena kemungkinan akansulituntukdibaca. GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 16 Ukuran standar
  • 29. UKURAN MINIMAL, CLEARSPACE & GUIDELINES dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up SKALA MINIMAL LOGO 100 % 75 % 60 x 31 mm 45 x 23 mm dinar kebaya 50 % 30 x 16 mm ukuran terkecil maksimal GRAPHIC STANDART MANUAL 17
  • 30. UKURAN MINIMAL, CLEARSPACE & GUIDELINES SKALA MINIMAL LOGO picturemark 10 x 10 mm ukuran terkecil hanya dapat dipakai untuk picturemark saja diharapkan ukuran ini digunakan dengan baik karena mempengaruhi redibility dari textmark. untuk picturemark masih bisa terlihat walau dalam ukuran terkecil sekalipun. pada penggunaannya kalau bisa tidak sering memakai ukuran terkecil ini. untuk skala maksimal tidak dibatasi sampai ukuran berapapun yang terpenting adalah ukuran dengan skala yang proporsional. GRAPHIC STANDART MANUAL 18
  • 31. UKURAN MINIMAL, CLEARSPACE & GUIDELINES KONFIGURASI LOGO GRAPHIC STANDART MANUAL 19 x 0.5x 0.5x 4x 2.4x1.7x 12.5x 4x Konfigurasi berfungsi sebagai anatomi logo. Ketetapan konfigurasi simbol dan tulisan identitas menggunakan acuan skala karakter huruf. Satuan karakter yang dipakai dalam skala ini diambil dari komponen huruf 'X
  • 32. UKURAN MINIMAL, CLEARSPACE & GUIDELINES KONFIGURASI LOGO Konfigurasi berfungsi sebagai anatomi logo. Ketetapan konfigurasi simbol dan tulisan identitas menggunakan acuan skala karakter huruf. Satuan karakter yang dipakai dalam skala ini diambil dari komponen huruf 'X dinar kebayaspesialis kebaya & make up 1.8x 1.9x 1x 1.2x1.2x 8.5 x0.3 x 0.15x 0.18x GRAPHIC STANDART MANUAL 20
  • 33. x Zona yang bersih atau kosong diciptakan untuk memastikan logo masih menonjol dan tampak jelas. Ruangan yang kosong diukur dengan X. Ruangan kosong di sekitar logo berguna untuk menonjolkan penampilan logo Dinar Kebaya dibandingkan elemen gambar atau lainnya. UKURAN MINIMAL, CLEARSPACE & GUIDELINES CLEARSPACE / AREA KOSONG GRAPHIC STANDART MANUAL 21
  • 34. Area kosong diberikan disekitar logo dengan skala yang telah ditentukan. Elemen visual lain tidak diperkenankan masuk dalam area ini. Hal ini bertujuan agar tidak mengganggu readibilitas dan estetika logo. UKURAN MINIMAL, CLEARSPACE & GUIDELINES CLEARSPACE / AREA KOSONG GRAPHIC STANDART MANUAL 22 xdinar kebayaspesialis kebaya & make up
  • 35. UKURAN MINIMAL, CLEARSPACE & GUIDELINES GRIDLINES / GARIS BANTU Gridlines adalah sekumpulan garis bantu yang berfungsi menjaga konsistensi visual logo sehingga pada penerapannya tidak terjadi kesalahan pada proporsi bentuk logo. GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 23
  • 36. UKURAN MINIMAL, CLEARSPACE & GUIDELINES UKURAN POSISI YANG SALAH GRAPHIC STANDART MANUAL dinar kebaya spesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 24
  • 37. TYPEFACE Myriad Pro BARKENTINA The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 The quick brown fox jumps over the lazy dog. 1234567890 GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up 25
  • 38. TYPEFACE BARKENTINA Myriad Pro Jenis font ini dipilih karena berkesan etnik dan elegan. Sebagai jenis huruf serif, Barkentina meiliki bentuk yang luwes dan dinamis. Setiap ujung kaitnya juga seperti bentuk sulur yang luwes, sangat cocok dengan karakter perusahaan DinarKebayayangluwesdanterkesanfeminim. Jenis font ini dipilih untuk diaplikasikan pada tagline Dinar Kebaya. bentuk huruf ini tegas dan jelas dibaca, mengimbangi font logo yang terkesan luwes. meskipun jenis huruf ini terkesan tegas namun ukurannya diperkecil untuk menghindarikesan kaku. Penggunaan jenis huruf ini adalah paten / wajib. text mark utama adalah memakaijenishurufini.tidakdiperbolehkanmemakaijenishurufapapun. Penggunaan jenis huruf ini adalah paten / wajib karena sudah disesuaikan dengantextmarkutama. PointdariTextMarkiniadalahReadibilitydansesuaidengankarakterperusahaan yang luwes,elegan,danetnik.Aplikasitextmarkinisesuaidenganperaturanyang sudahdibuat(skala,jarakminimaltepi,dll). ! GRAPHIC STANDART MANUAL 26
  • 39. Untuk font primer. dianjurkan untuk menggunakan jenis huruf yang berkait (serif). haliniditujukankarenahurufdengankaitakanterlihatluwes. FontPrimeryangdigunakanmisalnya: FONT PRIMER Selainfontuntuklogo.Terdapatjugapanduanuntukfont yangdiaplikasikandalamsemuamediaDinarKebaya yangmenggunakanhuruf. Untuk font sekunder bisa menggunakan jenis huruf tanpa kait (san serif). pemakaian font sekunder ini dipakai ketika font primer dirasa kurang cocok dengan halyangakandiaplikasikan.Namunpenggunaanfont primertetapdiutamakan. FontSekunderyangdigunakanmisalnya: FONT SEKUNDER Times New Roman Californan FB Adobe Hebrew dll. meskipun terdapat banyak pilihan, namun sebagai panduan, huruf serif yang digunakan harusreadibility. TYPEFACE Franklin Gothic Kozuka Gothic Pr6N M Browallia New dll. Selain jenis huruf yang dicontohkan, dianjurkan tidak terlalu jauh beda dengan jenis huruf yang dicontohkan. GRAPHIC STANDART MANUAL 27
  • 40. spectacular event @ MOG 22 -24 Juni 2013 rias pengantin paket wisuda spesialis kebaya prawedding FONT PRIMER Paket Wisuda + Foto Wisuda dinar kebayaspesialis kebaya & make up FONT SEKUNDER contoh penggunaan jenis huruf serif sehingga lebih berkesan luwes dan mendukungnuansaklasik. contoh penggunaan jenis huruf san serif membuat kesan yang tegas dan moderen. Dinar Kebaya tidak harus berkesan klasik dan etnik, bisa juga berkesan moderen tetapi tetap harus dicantumkanlogo. Dalam setiap media yang digunakan Dinar Kebaya, tidak harus selalu berkesan etnik dan klasik karena Dinar Kebaya sendiri juga memiliki karakter moderen dan dinamis. Atau perpaduan dari keduanya karena Dinar Kebaya adalah industri kreatif yang bergerak dibidangmodifikasiKebayamoderen. TYPEFACE ! GRAPHIC STANDART MANUAL 28
  • 41. TYPEFACE. PENERAPAN FONT YANG SALAH dinar kebaya s p e s i a l i s k e b a y a & m a k e u p dinar kebayaspesialis kebaya & make up DINAR KEBAYAspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up GRAPHIC STANDART MANUAL 29
  • 42. PENERAPAN FONT YANG SALAH K e b a y a a d a l a h b l u s tradisional yang dikenakan oleh wanita Indonesia yang terbuat dari bahan tipis yang dikenakan dengan sarung, batik, atau pakaian rajutan tradisional lainnya seperti songket dengan motifwarna-warni. Mengenai Dinar Kebaya Kebaya adalah blus t r a d i s i o n a l y a n g dikenakan oleh wanita Indonesia yang terbuat dari bahan tipis yang d i k e n a k a n d e n g a n sarung, batik, atau p a k a i a n r a j u t a n tradisional lainnya seperti songket dengan motif warna-warni. Mengenai Dinar Kebaya Kebaya adalah blus t r a d i s i o n a l y a n g dikenakan oleh wanita Indonesia yang terbuat dari bahan tipis yang d i k e n a k a n d e n g a n sarung, batik, atau p a k a i a n r a j u t a n tradisional lainnya seperti songket dengan motif warna-warni. Mengenai Dinar Kebaya bentuk font terlalu kaku font ini memberi kesan anak-anak. tidak sesuai dengan karakter perusahaan kerterbacaan kurang! ! ! TYPEFACE GRAPHIC STANDART MANUAL 30
  • 43. dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up CO BRANDED LOGOS CO BRANDED LOGOS. Logo dengan text mark Posisi co-brandedlogodisertai textmarkdantagline. Spasi minimum (jarak terdekat) antar logo mengacu pada 1/4 rataratapanjang logo. Hal ini juga diterapkan jika co-branded logodisusunsecaravertikal. ASDFGQWERTY z ASDFGQWERTY z Spasi Minimum A B A B 1/4 [(A=B):2] GRAPHIC STANDART MANUAL 31
  • 44. Z CO BRANDED LOGOS. Logo dengan text mark CO BRANDED LOGOS Z Posisico-brandedlogotanpatextmarkdantagline. logoDinarKebayadanLogolainmemilikiukuranyangsama. Sedangkan spasi antar logo mengacu pada panjang dan lebar masing-masinglogo. GRAPHIC STANDART MANUAL 32
  • 45. TARGET PENEMPATAN LOGO Jika logo disertai tagline dan text mark, maka ukuran logo serta batas dengan ukuran area yang telah ditentukan mengacu pada Clean area logo. mengenai skala ukuran logo sudah dijelaskan di penjelasan skala minimal,dll.haliniberlakuuntuksemuaukuranApaper. area margin clear space ukuran A Paper Target Penempatan Logo GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 33
  • 46. TARGET PENEMPATAN LOGO AreaselainA Paper,tetapmenggunakanacuanskalalogodanclearspacearea. tidak dianjurkan memakai area bidang non geometris / tidak beraturan! GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 34
  • 47. TARGET PENEMPATAN LOGO Penempatan Logo yang tidak sesuai clear space keluar area clear space masuk ke dalam area margin tidak menghiraukan clear space dan area margin GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 35
  • 48. Penempatan Logo yang tidak sesuai TARGET PENEMPATAN LOGO GRAPHIC STANDART MANUAL dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up 36
  • 49. LOGO 3D Logo dalam bentuk tiga dimensi GRAPHIC STANDART MANUAL 37
  • 51. STATIONERY AND ADMINISTRATIVE Letterheads kop surat untuk Dinar Kebaya dibagi menjadi dua pilihan. yaitu untuk kertas berukuran A4 dan ukuran F4. untuk ukuran A4 alamat di letakkan diatas kop surat. sedangkan untuk ukuran F4 diletakkan diibawah. Untuk pemakaian disesuaikan dengan kebutuhan. jika membutuhkan space yang banyak dapat menggunakan ukuran F4. GRAPHIC STANDART MANUAL 38
  • 53. STATIONERY AND ADMINISTRATIVE Envelopes ukuran 23 x 11.5 cm alamat selalu dibelakang amplop dengan font lucida bright label ditempelkan disini alamat & kontak d : 2.5 cm 1.2 cm1.2 cm 2.6 cm 0.6 cm 10 cm 2.5 cm 1.5 cm 3.5 cm 1 cm 3 cm 2.5 cm dinar kebayaspesialis kebaya & make up 7 cm 5.5 cm2 cm GRAPHIC STANDART MANUAL 40
  • 54. STATIONERY AND ADMINISTRATIVE Business Card centre GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 email : dinarkebaya26@yahoo.com f : facebook.com/dinar.rahadian.7 Name Position Contact Person 1.6 cm 3 cm 1 cm 1.5 cm dinar kebayaspesialis kebaya & make up 4 cm 2 cm promotion 3 cm 3.5 cm 3.5 cm 3.5 cm 2 cm 1 cm1 cm ukuran 9 x 5.5 cm BELAKANGDEPAN Kartu nama 2 sisi (eksklusif) sisi belakang dapat digunakan untuk promo. untuk kartunama eksklusif harus memakai laminasi dof GRAPHIC STANDART MANUAL 41
  • 55. dinar kebayaspesialis kebaya & make up GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 email : dinarkebaya26@yahoo.com f : facebook.com/dinar.rahadian.7 0.5 cm 1.3 cm 1.5 cm 0.5 cm Nama Jabatan Contact Person 1 cm 0.7 cm 1.5 cm 1.5 cm 1.5 cm 5 cm 2.5 cm 2.5 cm1 cm Kartu nama 1 sisi ukuran 9 x 5.5 cm STATIONERY AND ADMINISTRATIVE Business Card GRAPHIC STANDART MANUAL 42
  • 56. STATIONERY AND ADMINISTRATIVE ukuran 21 x 29.7 cm Fax Cover Sheet dinar kebayaspesialis kebaya & make up 1.5 cm 1.5 cm 2.6 cm 5 cm 2.5 cm2.5 cm FAXCOVER SHEET To : Company : Fax : Phone : Pages : From : Fax : Phone : NOTES: 3 cm GRAPHIC STANDART MANUAL 43
  • 57. STATIONERY AND ADMINISTRATIVE Note pads ukuran A5 dinar kebayaspesialis kebaya & make up 1.8 cm 2 cm 1.5 cm 3.5 cm uk. 10.5 x 14.8 cm notes ...... , .......................... Jl. Soekarno Hatta 2B - Malang 65141 Telp. 0341 - 5446071 / 081803813154 space untuk lem 0.7 cm 0.8 cm 1.3 cm 0.8 cm 0.7 cmSampul Isi GRAPHIC STANDART MANUAL 44
  • 58. STATIONERY AND ADMINISTRATIVE Bills isi depan GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur Telp. 0341 - 5446071 / 081803813154 email : dinarkebaya26@yahoo.com dinar kebayaspesialis kebaya & make up Nota pembayaran 0.6 cm 0.8 cm 2.1 cm 1.4 cm 8.3 cm 3.1 cm 1.1 cm 4 cm 0.9 cm 3.9 cm 0.4 cm 1 cm 5.5 cm Nota/ bill uk. 10.5 x 16.4 cm GRAPHIC STANDART MANUAL 45
  • 59. STATIONERY AND ADMINISTRATIVE Mailing Label Kepada : text 0.8 cm Ny. Mutiara Larasati Jl. Wijayakusuma, Tegal mindi, Sinduadi, Sleman, Yogyakarta 54451 Kepada : centre text Mailing label uk. 6.7 x 3.2 cm GRAPHIC STANDART MANUAL 46
  • 60. STATIONERY AND ADMINISTRATIVE Presentation Slide dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Produk Kami ukuran disesuaikan dengan kebutuhan secara garis besar ada tiga macam style yang dapat digunakan. background putih background full warna korporat, dan background ornament. dianjurkan untuk memakai ornament dan abstrak bentuk logo untuk memperkuat identitas perusahaan. contoh aplikasi dengan konten GRAPHIC STANDART MANUAL 47
  • 61. WEB SITES Web Sites www.dinarkebaya.com tampilan interface yang simple. mengutamakan foto. dinar kebayaspesialis kebaya & make up artikel spoiler dinar kebayaspesialis kebaya & make up Make Up Home Profile Gallery Contact dinar kebayaspesialis kebaya & make up Home Profile Gallery Contact dinar kebayaspesialis kebaya & make up photo menu menu menu menu Dinar Kebaya adress menu menu menu menu Dinar Kebaya adress text Template desain website Contoh aplikasi desain website GRAPHIC STANDART MANUAL 48
  • 62. PR / IR COMMUNICATIONS Press Kit Folder dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, JawaTimur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com www.dinarkebaya.com 49 CM 22 CM 5 CM 34 CM map tampak luar dilipat kedalam GRAPHIC STANDART MANUAL 49
  • 63. PR / IR COMMUNICATIONS Press Kit Folder dinar kebayaspesialis kebaya & make up 9 CM map tampak dalam rongga untuk menyelipkan kartunama GRAPHIC STANDART MANUAL 50
  • 64. PR / IR COMMUNICATIONS Press Kit Folder dinar kebayaspesialis kebaya & make up center 11 cm 21 cm 3.2 cm 2.3 cm center ilustrasi text text text brosur 2 sisi GRAPHIC STANDART MANUAL 51
  • 65. PR / IR COMMUNICATIONS Certificate dinar kebayaspesialis kebaya & make up Certificateof ........................ This is to certify that name position .............., area alamat dan kontak Dinar Kebaya ukuran 29.7 x 21 cm 10 x 4 cm GRAPHIC STANDART MANUAL 52
  • 66. PR / IR COMMUNICATIONS Press Kit Folder CD case dinar kebayaspesialis kebaya & make up area alamat dan kontak Dinar Kebaya GRAPHIC STANDART MANUAL 53
  • 67. PR / IR COMMUNICATIONS Press Kit Folder 13 cm 13 cm 6,5 cm 1,5 cm 13 cm dinar kebayaspesialis kebaya & make up CD case & label GRAPHIC STANDART MANUAL 54
  • 68. PR / IR COMMUNICATIONS Press Kit Folder leaflet uk. A6 1 sisi (10.5 x 14.8 cm) ilustration text text text ilustration GRAPHIC STANDART MANUAL 55
  • 69. HR Communications Recruitmen Ad Format Open Recruitmen sebagai karyawati di Dinar Kebaya dengan syarat : wanita 18- 30 tahun berpenampilan menarik keterampilan tata rias & busana diutamakan Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com www.dinarkebaya.com dinar kebayaspesialis kebaya & make up Kirim lamaran ke : dinar kebayaspesialis kebaya & make up 21 cm 23 cm 2.5 cm 3.2 cm 2.3 cm text contoh aplikasi template GRAPHIC STANDART MANUAL 56
  • 70. FACILITIES SIGNS Building Signage dinar kebayaspesialis kebaya & make up Building Signage dibagi menjadi dua macam, yaitu neon box dan channel letter. ukuran menyesuaikan bangunan dengan skala yang proporsional dengan logo. building signage sangat penting untuk menandai bahwa bangunan atau tempat tertentu adalah galery atau butik dinar kebaya. ukuran menyesuaikan dengan skala proporsional GRAPHIC STANDART MANUAL 57
  • 71. FACILITIES SIGNS Building Signage dinar kebaya spesialis kebaya & make up NEON BOX Berupa print backlight dengan lampu dari dalam. jika memakai bahan stiker maka bahan background dari neon box dengan logo memakai warna blok (bukan gradasi). namn lebih diutamakan jika menggunakan logo gradasi. GRAPHIC STANDART MANUAL 58
  • 72. FACILITIES SIGNS Building Signage dinar kebayaspesialis kebaya & make up VARIASI GRAFIS NEON BOX Neon Box bisa ditambahkan dengan background ornament namun tidak bertumpuk dengan logo. logo harus selalu dengan background putih untuk building signage. tidak diperkenankan menambah apapun pada background kecuali ornament yang telah di contohkan diatas. bila ada promo atau unsur image lain dapat menggunakan media yang terpisah dari building signage ini. hal ini bertujuan untuk menjaga tanda identitas gallery atau butik dinar kebaya Penggunaaan channel letter hany pada logo, sedangkan background tetap dengan print backlight. GRAPHIC STANDART MANUAL 59
  • 73. FACILITIES SIGNS Building Signage ALTERNATIF SIGNAGE Bentuk signage seperti disamping dapat diaplikasikan bila signage building yang dijelaskan sebelumnya menempati posisi yang kurang bisa dilihat oleh publik. misalkan antara butik dengan jalan raya terlalu jauh. hal-hal lain dapat menjadi pertimbangan untuk dapat menggunakan alternatif signage ini. logo tetap harus dengan background putih neon box tembok dinar kebayaspesialis kebaya & make up alamat website ilustrasi 95 cm 112 cm 51 cm 40 cm 240 cm 130 cm GRAPHIC STANDART MANUAL 60
  • 74. FACILITIES SIGNS Building Signage CHANNEL LETTER Ketebalan huruf menyesuaikan dengan huruf. warna yang ada disamping harus sama dengan warna yang didepannya. lampu bisa dtempatkan di didalam huruf. dinar kebaya spesialis kebaya & make up dinar kebaya spesialis kebaya & make up dd GRAPHIC STANDART MANUAL 61
  • 75. FACILITIES SIGNS Umbul-umbul dinar kebayaspesialis kebaya & make up Spesialis Make Up dan Kebaya dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Bentuk yang diperbolehkan panjang : 3.5 m lebar : menyesuaikan GRAPHIC STANDART MANUAL 62
  • 76. VEHICLE Car Branding Daihatsu Gran Max panjang = 4,045 mm, tinggi = 1,900 (with tires) mm WiFi dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Lampu Lampu N 1111 ilustrasi logo text promo GRAPHIC STANDART MANUAL 63
  • 77. N 1111 Lampu Lampu dinar kebayaspesialis kebaya & make up Lampu Lampu N 1111 kebaya selalu membuat Anda Cantik! jika Anda tahu bagaimana menemukannya KONSULTASIKAN DESAIN BA JU KEBAYA ANDA TERLEBIH DAHULU, KAMI AKAN MEMBERIK AN YANG TERBAIK dinar kebayaspesialis kebaya & make up contoh aplikasi untuk konten VEHICLE Car Branding Daihatsu Gran Max panjang = 4,045 mm, tinggi = 1,900 (with tires) mm GRAPHIC STANDART MANUAL 64
  • 78. MARKETING SALES Brochures (Pricelist) text ilustrasi dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up text text text ukuran 21 x 33 cm GRAPHIC STANDART MANUAL 65
  • 79. MARKETING SALES Brochures (Pricelist) GAYATRIpackage Gayatri I 7 Juta Gayatri II 10 Juta Make Up Pengantin Hijab / Hairdo Akad Resepsi 2 Sepasang Kebaya Ibu Dan Besan Make Up + Sanggul / Hijab (akad) Make Up + Sanggul / Hijab (resepsi) Bapak Dan Besan Basofi / Beskap (resepsi) Kembar Mayang 2 Make Up + Sanggul / Hijab + Kebaya 2 Basofi / Beskap Remaja Putra Mc Akad Resepsi Dekor Akad Nikah BONUS PERAWATAN PREWEDDING Make Up Pengantin Hijab / Hairdo Akad Resepsi 2 Sepasang Kebaya Ibu Dan Besan Make Up + Sanggul / Hijab (akad) Make Up + Sanggul / Hijab (resepsi) Bapak Dan Besan Basofi / Beskap (resepsi) Kembar Mayang 2 Make Up + Sanggul / Hijab + Kebaya 2 Basofi / Beskap Remaja Putra pricelist/peritem MAHISApackage TRIBUANApackage GAYATRIipackage dinar kebayaspesialis kebaya & make up Price List Packages Wedding & PACKAGE PACKAGE PACKAGE PACKAGE dinar kebayaspesialis kebaya & make up TEXT ILUSTRASI UK. 15 X 19 cm contoh dengan konten GRAPHIC STANDART MANUAL 66
  • 80. MARKETING SALES Poster/ Print Ad ilustrasi foto head text & keterangan alamat & kontak logo komposisi GRAPHIC STANDART MANUAL 67
  • 81. MARKETING SALES Poster/ Print Ad GRAPHIC STANDART MANUAL 68 ukuran A3. konten poster hanya sebagai contoh Paket Wisuda gratis foto wisuda Desain dan Jahit Kebaya, Traditional & Modern Make up, Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin, Foto & Shooting, Dekorasi Dll GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 email : dinarkebaya26@yahoo.com dinar kebaya @dinarkebaya www.dinarkebaya.com dinar kebayaspesialis kebaya & make up ilustrasi foto model kebaya dengan background putih atau abu-abu ilustrasi foto model kebaya dengan background putih atau abu-abu alamat Dinar Kebaya dan kontak logo diatas
  • 82. MARKETING SALES Poster/ Print Ad GRAPHIC STANDART MANUAL 69 ukuran A3. alternatif layout. konten poster hanya sebagai contoh Wedding Exhibition dinar kebaya gracia wedding organizer p r e s e n t tata rias dan busana pengantin, bridal, wedding documentation, decoration, wedding organizer, dll (all about wedding) 5-7 September, Grand Hall MATOS DAPATKAN UNDIAN SEPASANG CINCIN BERLIAN DAN TIKET HONEYMOON KE BALI CONTACT : Gracia WO 081803888222 Dinar Kebaya 0341 5446071 www.graciawo.com www.dinarkebaya.com dinar kebaya Gracia ilustrasi foto model kebaya dengan background putih atau abu-abu 29.7 cm 11 cm 3.5 cm 10.5 cm 42cm head text memakai jenis huruf yang berbeda dengan keterangan keterangan alamat Dinar Kebaya dan kontak
  • 83. MARKETING SALES Banner / Spanduk Head Text dinar kebayaspesialis kebaya & make up sub keterangan alamat dan kontak Dinar Kebaya keterangan Paket Wisuda Gratis Foto Wisuda! dinar kebayaspesialis kebaya & make up Desain dan Jahit Kebaya, Traditional & Modern Make up, Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin, Foto & Shooting, Dekorasi Dll GRAHA UTERO SOEKARNO HATTA 2B - Malang 0341 - 5446071 / 081803813154 www.dinarkebaya.com contoh aplikasi template dan komposisi banner uk. 2 x 1 m (ukuran dapat diubah namun tetap proporsi) template banner ilustrasi GRAPHIC STANDART MANUAL 70
  • 84. dinar kebayaspesialis kebaya & make up Wedding Package (Mahisa,Tribuana,Gayatri) Desain dan Jahit Kebaya, Traditional & Modern Make up, Tata Rias Pengantin, Prewedding, Wisuda, Sewa Baju Pengantin, Foto & Shooting, Dekorasi Dll GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Telp. 0341 - 5446071 / 081803813154 www.dinarkebaya.com dinar kebayaspesialis kebaya & make up Head Text keterangan sub keterangan ilustrasiilustrasi alamat dan kontak Dinar Kebaya template banner/ spanduk contoh aplikasi template dan komposisi banner uk. 4 x 1 m (ukuran dapat diubah namun tetap proporsi) MARKETING SALES Banner / Spanduk GRAPHIC STANDART MANUAL 71
  • 85. MARKETING SALES X banner dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up Text Text ilustration Text Text center ilustration Text uk. 60 x 160 cm GRAPHIC STANDART MANUAL 72
  • 86. IDENTITY INTRODUCTION Seragam Karyawan Seragam Formal. seragm ini dipakai untuk acara formal. bawahan berupa rok batik. Bordir penambahan bros GRAPHIC STANDART MANUAL 73
  • 87. IDENTITY INTRODUCTION Seragam Karyawan Seragam Semi formal berupa blazer yang bisa dipadupadankan dengan baju lain. dapat memakai bawahan rok ataupun celana. warna bawahan yang digunakan meliputi warna yang senada dengan blazer, hitam, atau bisa juga dengan memakai jeans. Memakai warna lain tidak diperbolehkan karena dapat mengganggu kejelasan identitas Dinar Kebaya. Bordir Bros GRAPHIC STANDART MANUAL 74
  • 88. IDENTITY INTRODUCTION dinar kebayaspesialis kebaya & make up dapat dipakai oleh karyawan ketika dalam suasana santai dan bekerja sehari hari. Seragam Karyawan GRAPHIC STANDART MANUAL 75
  • 89. IDENTITY INTRODUCTION Merchandise / Gifts BROS d: 2 cm d: 2 cm khusus bros boleh memakai warna emas/ warna dari bahan www.dinarkebaya.com d: 3 cm bahan akrilik bening dinar kebayaspesialis kebaya & make up uk: 5 x 1.5 cm GANTUNGAN KUNCI GRAPHIC STANDART MANUAL 76
  • 90. IDENTITY INTRODUCTION Merchandise / Gifts dinar kebayaspesialis kebaya & make up Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com www.dinarkebaya.com Galeri Pusat di GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang, Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 e-mail :dinarkebaya26@yahoo.com www.dinarkebaya.com dinar kebayaspesialis kebaya & make up Paper Bag GRAPHIC STANDART MANUAL 77
  • 91. IDENTITY INTRODUCTION Merchandise / Gifts dinar kebayaspesialis kebaya & make up MUG / Gelas Bolpoin diameter logo: 8 cm uk : 4 x 0.9 cm uk : 4 x 0.9 cm GRAPHIC STANDART MANUAL 78
  • 92. IDENTITY INTRODUCTION Kaos dinar kebayaspesialis kebaya & make up dinar kebayaspesialis kebaya & make up depan belakang GRAPHIC STANDART MANUAL 79
  • 93. IDENTITY INTRODUCTION Hanger Baju dinar kebaya dinar kebayaspesialis kebaya & make up dinar kebaya 80 cm 16 cm 30 cm GRAPHIC STANDART MANUAL 80
  • 94. 1.5 x 1.5 cm dinar kebaya 3 x 1 cm dinar kebaya 3 x 1.5 cm baju kebaya baju kebaya IDENTITY INTRODUCTION Label baju GRAPHIC STANDART MANUAL 81
  • 95. Demikianpenjelasan GraphicStandardManualDinarKebaya. Hal ini tidak akan dapat banyak manfaat kecuali dengan penerapan yang baik dan sesuai. Semoga dengan adanya logo baru Dinar Kebaya ini dapat memberikan semangat kerja bagi karyawansecarapersonal,sertapihak-pihakyangmendukungperusahaanDinarKebaya. Visi perusahaan untuk bertandang di kancah global tidaklah tidak mungkin karena dengan tekad yang kuat dan terus berproses berkembang maju, Dinar Kebaya dapat sukses menggapai visi perusahaan. Pada penerapan media, masih banyak media yang belum dicantumkan pada GSM ini karena media terus berkembang. Namun, benang merah dari acuan media aplikasi corporate identity Dinar Kebaya adalah muda, modern, feminim. Aspek-aspek dari penataan yang baik sesuai denganmediajugaperludiperhatikan. Sukses untuk Dinar Kebaya! PENUTUP
  • 96. Alamat : GRAHA UTERO SOEKARNO HATTA Jl. Soekarno Hatta 2B - Malang Jawa Timur - Indonesia - 65141 Telp. 0341 - 5446071 / 081803813154 branch office : Jl. Aris Munandar no. 105 Malang Telp - 0341 - 7588833 appoinment at 08133309191 www.dinarkebaya.com email : dinarkebaya26@yahoo.com f : facebook.com/dinar.rahadian.7 dinar kebayaspesialis kebaya & make up Corporate Identity Design by: Naila Conita email: nailaconita@gmail.com @2014 woman own ” ”
  • 97.