Successfully reported this slideshow.

Mantap5

892 views

Published on

ne tgs kmi berdua

Published in: Health & Medicine
  • Be the first to comment

  • Be the first to like this

Mantap5

  1. 1. PENGENALAN TEKNOLOGIINFORMASI  Santri hidayah  Nur’aiNi STMIK ATMA LUHUR Santri &Ari AA, S.Kom Aini
  2. 2. PENGENALAN TEKNOLOGI INFORMASI Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  3. 3. KATA PENGANTAR Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  4. 4. DAFTER ISI Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  5. 5. BAB I PENDAHULUAN Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  6. 6. BAB II PERMASALAHAN Teknologi Informasi (TI) Sejarah perkembangan teknologi Pengertian komputer Komputer dan siklus penggolahan data Sejarah internet Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  7. 7. BAB III PEMBAHASANTEKNOLOGI BERASAL DARI BAHASA YUNANI YAITU : TEKNOS & LOGOS SUATU ALAT YANG DICIPTAKAN OLEH MANUSIA YANG DIGUNAKAN UNTUK MEMUDAHKAN PEKERJAAN MANUSIA. “ HASIL PERKEMBANGAN DARI ILMU PENGETAHUAN YANG ADA “ Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  8. 8. KOMUNIKASI Kata atau istilah komunikasi (dari bahasa Inggris “communication”),secara etimologis atau menurut asal katanya adalah dari bahasa Latin communicatus, dan perkataan ini bersumber pada kata communis Dalam kata communis ini memiliki makna „berbagi‟ atau „menjadi milik bersama‟ yaitu suatu usaha yang memiliki tujuan untuk kebersamaan atau kesamaan makna Ari AA, S.Kom Pegenalan Teknologi InformasiARI AA,S.Kom Pengantar Teknologi Informasi
  9. 9. KOMUNIKASI Komunikasi secara terminologis merujuk pada adanya proses penyampaian suatu pernyataan oleh seseorang kepada orang lain. Jadi berdasarkan paradigma Lasswell tersebut, secara sederhana proses komunikasi adalah pihak komunikator membentuk (encode) pesan dan menyampaikannya melalui suatu saluran tertentu kepada pihak penerima yang menimbulkan efek tertentu Ari AA, S.Kom Pegenalan Teknologi InformasiARI AA,S.Kom Pengantar Teknologi Informasi
  10. 10. Teknologi Informasi Pengertian Teknologi Informasi (TI) TI adalah istilah terhadap berbagai macam hal dan kemampuan yang digunakan dalam pembentukan, penyimpanan, dan penyebaran informasi. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  11. 11. Teknologi Informasi Perlunya Teknologi Informasi, karena:  Kompleksitas tugas manajemen  Pengaruh globalisasi  Perlunya response time cepat  Tekanan persaingan bisnis Sistem Informasi Pengertian : sistem yang menggunakan Teknologi komputer untuk mengumpulkan, memproses, menyimpan, menganalisis dan menyebarkan informasi. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  12. 12. Teknologi Informasi Sistem Informasi  Data : fakta mentah.  Informasi : data yang telah diorganisir sehingga memberi arti.  Pengetahuan :informasi yang diproses sehingga memberikan pembelajaran, pemahaman untuk dapat diaplikasikan. Sistem Informasi Berbasis Komputer atau Computer Based Information System (CBIS) Sistem Informasi yang menggunakan komputer dan teknologi komunikasi untuk melakukan tugas-tugas yang diinginkan. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  13. 13. Teknologi Informasi Infrastruktur Informasi  Perangkat Keras (Hardware)  Perangkat Lunak (Software)  Jaringan dan Komunikasi  Basis Data (Database)  Information Management Personnel Arsitektur Informasi  Perencanaan terhadap kebutuhan informasi Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  14. 14. Teknologi Informasi Kemampuan Sistem Informasi  Proses transaksi cepat dan akurat  Kapasitas penyimpanan besar dan akses cepat  Komunikasi cepat, dll. Tujuan Teknologi Informasi  Memecahkan masalah, membuka kreativitas, efektivitas dan efisiensi. Prinsip Teknologi Informasi  High-Tech-High-Touch Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  15. 15. Teknologi Informasi Fungsi Teknologi Informasi  Menangkap (Capture), Mengolah (Processing), Menghasilkan (Generating), Menyimpan (Storage), Mencari Kembali (Retrieval), Melakukan Transmisi (Transmission). Keuntungan Teknologi Informasi  Speed, Consistency, Precision, Reliability Teknologi Informasi dalam Berbagai Bidang  Akuntansi, Finance, Marketing, Produksi atau Manajemen Produksi, Manajemen Sumber Daya Manusia Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  16. 16. TEKNOLOGI INFORMASI Ari AA, S.Kom Pegenalan Teknologi Informasi ARI AA,S.Kom Pengantar Teknologi Informasi
  17. 17. SEJARAH PERKEMBANGANKOMPUTER SEJARAH PERKEMBAGAN KOMPUTERSejarah Komputer dan Perkembanganya – Sejak dahulu, proses pengolahan data telahdilakukan oleh manusia. Manusia juga menemukan alat-alat mekanik dan elektronik untukmembantu manusia dalam penghitungan dan pengolahan data supaya bisa mendapatkan hasillebih cepat. Komputer yang kita temui saat ini adalah suatu evolusi panjang dari penemuan-penemuan manusia sejak dahulu kala berupa alat mekanik maupun elektronikSaat ini komputer dan piranti pendukungnya telah masuk dalam setiap aspek kehidupan danpekerjaan. Komputer yang ada sekarang memiliki kemampuan yang lebih dari sekedarperhitungan matematik biasa. Diantaranya adalah sistem komputer di kassa supermarket yangmampu membaca kode barang belanja, sentral telepon yang menangani jutaan panggilan dankomunikasi, jaringan komputer dan internet yang menghubungkan berbagai tempat di dunia. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  18. 18. SEJARAH PERKEMBAGANKOMPUTER Alat pengolah data, dari yang paling sederhana sampai sekarang, digolongkan kedalam 4: 1. alat manual (manual device) 2. alat mekanik 3. alat mekanik elektronik 4. alat elektronik Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  19. 19. Alat Manual Th 300000 sm TULANG untuk mengingat dan berkomunikasi, contoh: menghitung umur, mengukur jarak Th 300000-14000 sm Petroglyphs batu karang yang digores, bangsa barbar menggunakan petroglyphs untuk mencatat data. Kadang kadang digores membentuk gambar yang menunjukkan suatu kejadian Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  20. 20.  Th 9000 sm Lempengan tanah liat digunakan di timur tengah sebagai alat perhitungan. Mempunyai bentuk yang berbeda yang menunjukkan bilangan 10 dan 60. Th 5000 sm Tablet Tanah Liat digunakandi timur tengah oleh bangsa Babylonia untuk : perhitungan, kalender, rumus rumus dan instruksi instruksi untuk menghitung suatu nilai tengah Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  21. 21.  Th 3500 sm Tablet Tanah Liat digunakan di timur tengah oleh bangsa sumeria untuk mencatat informasi. Bangsa sumeria menggunakan alat berbentuk huruf V untuk menulis huruf dan simbol kemudian dikeringkan dan disimpan (Cuneiform) Th 2600 sm Tablet Tanah Liat & Papyrus digunakan di timur tengah oleh bangsa babylonia untuk : mencatat penerimaan, pembayaran, kontrak-kontrak transaksi dan pinjaman-pinjaman. Tablet ini disimpan ditempayan yang berfungsi sebagai almari arsip. Bangsa mesir menggunakan daun Papyrus Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  22. 22.  Th 1200 sm Quipus Adalah tali simpul yang digunakan nenek moyang bangsa peru digunakan untuk : mencatat data administrasi, pajak dan perhitungan populasi Th 400 sm Lempengan Kayu & Kulit Binatang digunakan oleh bangsa yunani dan romawi untuk mencatat data. Alat penulisnya berupa kayu, tulang atau metal yang runcing. Alat ini digunakan untuk data transaksi hutang piutang, pengeluaran atau untuk mencatat barang yang dimiliki Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  23. 23.  Th 2500 sm Abacus Alat untuk menghitung agar lebih cepat. Alat ini merupakan alat digital yang pertama kali. Diperkirakan alat ini berasal dari Babylonia. jepang – soroban unisoviet – Schyoty cina - Suan pan Yunani - Abakion Th 1900 sm Stonehenge Merupakan batu yang terstruktur di salisbury plain sebelah selatan inggris digunakan untuk observasi peramalan musim panas dan gerhana Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  24. 24.  Th 1150 Kertas diperkenalkan oleh Moors di spanyol (eropa) untuk mencatat data Th 1200 Abacus dikembangkan dicina dengan dasar sistem bilangan desimal Th 1455 Alat Cetak Ditemukan oleh Johann Gutenberg dari Mainz, Jerman untuk menertibkan salinan salinan injil. Alat ini adalah dasar dari alat cetak printer Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  25. 25.  Th 1614 Napier’s Bones terbuat dari tulang ditemukan oleh John Napier (1550-1617) ahli matematika Scotlandia. Digunakan untuk perhitungan perkalian. John dianggap sebagai penemu perhitungan dan alatnya sebagi dasar mistar hitung Th 1621 Oughtred’s Slide rule Ditemukan William Oughtred (1575-1660) ahli matematika inggris. Alat ini terdiri dari 2 mistar terletak pada suatu piringan yang bisa digerakkan satu dengan lainnya. Dengan menggeser salah satu mistar pada posisi tertentu akan didapat hasil perhitungan Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  26. 26. ALAT MEKANIK Th 1623 Mesin Penghitung Yang pertama Th 1642 Mesin penghitung otomatis yang pertama Th 1666 Mesin pengali yang pertama Th 1673 Leibnitz‟s Calculating Machine Th 1777 Mesin Logika Yang Pertama Th 1804 Mesin Kartu Yang Pertama Th 1820 Mesin penghitung komersial pertama yang sukses Th 1822 Babbage‟s Difference Engine Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  27. 27.  Th 1833 Babbage Analytical Engine Prinsip kerjanya merupakan dasar kerja dari komputer sekarang Simpanan Dengan kapasitas 1000 angka masing masing digit 50 digit Keluaran Masukkan Program untuk Berupa kartu PlongBerupa kartu Plong Mengontrol atau printer Operasi Unit aritmathika untuk menambah dan mengurangi Dalam waktu 1 detik, mengalikan dan membagi dalam Waktu 1 menit Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  28. 28.  Th 1850 Mesin Penghitung Dengan Keyboard yang pertama Th 1854 Aljabar Boolean Yang pertama didasarkan pada operasi logika AND, OR, NOT, teori ini mendasari cara kerja sirkuit komputer sekarang th 1868 The ADDER Th 1869 Logika Aljabar Boolean Yang Pertama Th 1872 The Baldwin Th 1874 Odhner‟s Adding Machine Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  29. 29.  Th 1879 Mesin Kas Yang Pertama Th 1884 Mesin Penghitung Dengan Alat Cetak Yang Pertama Th 1885 Macaroni BOX Th 1887 First Comptometer Th 1893 Mesin Penghitung Saintifik Yang Pertama Th 1911 Monroe Calculator Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  30. 30. ALAT MEKANIK ELEKTRONIK Th 1890 Mesin Tabulasi Kartu Plong IBM (sekarang) Th 1920 Mesin Penghitung Otomatis Yang Pertama Th 1931Komputer analog yang pertama (Differential Analyzer) Th 1938 Mesin Hitung Mekanik-Elektronik Yang Pertama Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  31. 31. ALAT ELEKTRONIK Th 1942 Komputer Digital Yang Pertama menggunakan tabung hampa udara Th 1944 Harvard Mark I ASCC mampu melakukan operasi arithmatika dan logika secara otomatis. pertambahan dan pengurangan 23 digit angka dalam waktu 0,3 dt. perkalian 23 digit angka dalam waktu 6 dt. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  32. 32. komputer generasi pertama (1946 -1959)  DenganterjadinyaPerangDuniaKedua,negara- negarayangterlibatdalamperangtersebutberusahamengembangkankomputeruntukmengeksploit potensistrategisyangdimilikikomputer.Halinimeningkatkanpendanaanpengembangankomputers ertamempercepatkemajuanteknikkomputer.Padatahun1941,KonradZuse,seoranginsinyurJerma nmembangunsebuahkomputer,Z3,untukmendesainpesawatterbangdanpelurukendali.BaikBada nSensusAmerikaSerikatdanGeneralElectricmemilikiUNIVAC.Salahsatuhasilmengesankanyang dicapaiolehUNIVACdalahkeberhasilannyadalammemprediksikemenanganDwilightD.Eisenhowe rdalampemilihanpresidentahun1952.KomputerGenerasipertamadikarakteristikdenganfaktabah wainstruksioperasidibuatsecaraspesifikuntuksuatutugastertentu.Setiapkomputermemilikiprogra mkode-bineryangberbedayangdisebut“bahasamesin” Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  33. 33. Komputer Generasi Pertama (1946- 1959) Komputer generasi pertama ini menggunakan tabung vakum untuk memproses dan menyimpan data. Ia menjadi cepat panas dan mudah terbakar, oleh karena itu beribu-ribu tabung vakum diperlukan untuk menjalankan operasi keseluruhan komputer. Ia juga memerlukan banyak tenaga elektrik yang menyebabkan gangguan elektrik di kawasan sekitarnya. Komputer generasi pertama ini 100% elektronik dan membantu para ahli dalam menyelesaikan masalah perhitungan dengan cepat dan tepat. Beberapa computer generasi pertama : Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  34. 34. JENIS-JENIS KOMPUTER GENERASIPERTYAMAa. ENIAC (Electronic Numerical IntegratorAnd Calculator ) Dirancang oleh Dr John Mauchly dan Presper Eckert pada tahun 1946. Komputer generasi ini sudah mulai menyimpan data yang dikenal sebagai konsep penyimpanan data (stored program concept) yang dikemukakan oleh John Von Neuman. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  35. 35. b. EDVAC Computer. Penggunaan tabung vakum juga telah dikurangi di dalam perancangan computer EDVAC (Electronic Discrete Variable Automatic Computer) di mana proses perhitungan menjadi lebih cepat dibandingkan ENIAC.c. EDSAC COMPUTER (Electonic Delay • Storage Automatic Calculator) memperkenalkan penggunaan raksa (merkuri) dalam tabung untuk menyimpan data. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  36. 36. Ciri-ciri komputer generasi pertama :  Komponen yang digunakan adalah tabung hampa udara (Vacuum tube) untuk sirkuitnya  Program hanya dapat dibuat dengan bahasa mesin  Menggunakan simpanan luar, magnetic tape & magnetic disk  Ukuran fisik komputer besar  Cepat panas sehingga memerlukan pendingin  Prosesnya kurang cepat  Simpananya kecil  Membutuhkan daya listrik yang besar  Orientasi utamanya dalam aplikasi bisnis Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  37. 37. • Sirkuitnya menggunakan Vacum Tube• Program dibuat dengan bahasa mesin ; ASSEMBLER• Ukuran fisik komputer sangat besar, Cepat panas• Proses kurang cepat , Kapasitas penyimpanan kecil• Memerlukan daya listrik yang besar • 1946 : ENIAC, komputer elektronik pertama didunia yang• Orientasi pada aplikasi bisnis mempunyai bobot seberat 30 ton, panjang 30 M dan tinggi 2.4 M dan membutuhkan daya listrik 174 kilowatts 1953 : IBM 701, komputer komersial berukuran besar, komputer generasi pertama yang paling populer Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  38. 38. 1. Th 1946 KG I yang pertama ciri-ciri  Ukuran fisik besar  Terdiri dari 18000 tabung hampa udara  75000 relay dan sakelar serta 10000 kapasitor dan 70000 resistor  Memiliki 1 memory yang terdiri dari 20 buah accumulator dengan masing-masing accumulator dapat menyimpan 10 digit bilangan (1 digit bilangan membutuhkan 10 tabung hampa udara)  Mampu melakukan 5000 buah pertambahan 10 digit angka dalam waktu 1 menit dan 300 perkalian dalam waktu 1 menit  Semua input dan output dilakukan dengan kartu plong Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  39. 39. 2. Th 1947 Harvard Mark II kemampuan 12x lebih besar dari Havard Mark I2. Th 1947 Transistor yang pertama (dasar komponen untuk komp generasi II)2. Th 1948 IBM Selective sequence Electrnic Calculator3. Th 1949 Komputer yang sepenuhnya Stored-program yang pertama4. Th 1949 Harvard Mark III5. 1950 Komputer digital elektronik ukuran besar di Inggris yang pertama Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  40. 40. 6. Th 1950 SEC7. Th 1951 Komputer komersial di inggris yang pertama8. Th 1951 Komputer yang menggunakan pita magnetik yang pertama9. Th 1952 komputer yang sepenuhnya stored-program di amerika yang pertama10. Th 1953 Komputer yang menggunakan core memory yang pertama11. Th 1953 IBM 701 Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  41. 41. 12. Th 1954 Komputer komersial generasi pertama paling populer berorientasi pada aplikasi bisnis12. Th 1956 komputer yang menggunakan simpanan luar dengan akses secara random yang pertama13. Th 1959 IBM 705 (dibuat utk mengganti 701) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  42. 42. Komputer Generasi Kedua (1959-1964) Komputer-komputer generasi kedua ini merupakan komputer yang sepenuhnya menggunakan transistor. Bahasa pemrograman Common Business-Oriented Language (COBOL) dan Formula Translator (FORTRAN) mulai umum digunakan. Bahasa pemrograman ini menggantikan kode mesin yang rumit dengan kata-kata, kalimat, dan formula matematika yang lebih mudah dipahami oleh manusia. Komputer yang paling banyak digunakan pada generasi kedua ini adalah IBM 401 untuk aplikasi bisnis, IBM 1602, IBM 7094 dan IBM 7090. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  43. 43. CIRI-CIRI KOMPUTER GENERASIKE DUA Komponen yang digunakan adalah transistor untuk sirkuitnya Program dapat dibuat dengan bahasa tingkat tinggi EX: Fortran, Cobol Kapasitor memori utama sudah cukup besar Menggunakan simpanan luar Mempunyai kemampuan real-time & times sharing Ukuran fisik lebih kecil dibanding KG I Proses operasi sudah cepat dapat memproses jutaan operasi per detik Membutuhkan lebih sedikit daya listrik orientasi tidak hanya pada aplikasi bisnis, tetapi juga pada aplikasi teknik Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  44. 44. • Sirkuitnya berupa transistor• Program dapat dibuat dengan bahasa tingkat tinggi ; COBOL, FORTRAN, ALGOL• Kapasitas memori utama sudah cukup besar• Proses operasi sudah cepat• Membutuhkan lebih sedikit daya listrik• Berorientasi pada bisnis dan teknik. Komputer yang paling banyak digunakan pada generasi kedua ini adalah IBM 401 untuk aplikasi bisnis, IBM 1602 & IBM 7094 untuk aplikasi teknik Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  45. 45. Komputer-komputer KG II 1. Th 1959 PDP 1 2. Th 1961 Virtual memory yang pertama 3. Th 1963 Komputer mini Komersial yang pertama 4. UNIVAC III, UNIVAC SS80, UNIVAC SS90, UNIVAC 1107 5. Burroughs 200 6. IBM 7070, IBM 7080, IBM 1400, IBM 1600 7. NRC 300 8. Honeywell 400 & 800 9. CDC 1604, CDC 160A 10. GE 635, GE 645, GE 200 Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  46. 46. Komputer Generasi ke Tiga (1964-1970  Walaupuntransistordalambanyakhalmengunggulitubevakum,namuntransistormenghasilkanp anasyangcukupbesar,yangdapatberpotensimerusakbagian- bagianinternalkomputer.Batukuarsa(quartzrock)menghilangkanmasalahini.JackKilby,seoran ginsinyurdiTexasInstrument,mengembangkansirkuitterintegrasi(IC:integratedcircuit)ditahun1 958.ICmengkombinasikantigakomponenelektronikdalamsebuahpiringansilikonkecilyangterb uatdaripasirkuarsa.Padailmuwankemudianberhasilmemasukkanlebihbanyakkomponen- komponenkedalamsuatuchiptunggalyangdisebutsemikonduktor.Hasilnya,komputermenjadis emakinkecilkarenakomponenkoponendapatdipadatkandalamchip.Kemajuankomputergener asiketigalainnyaadalahpenggunaansistemoperasi(operatingsystem)yangmemungkinkanmes inuntukmenjalankanberbagaiprogramyangberbedasecaraserentakdengansebuahprogramut amayangmemonitordanmengkoordinasimemorikompute Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  47. 47. CIRI-CIRI KOMPUTERGENERASI KE TIGA Komponen yang dipergunakan adalah IC (Integrated Circuits), yang berbentuk Hybrid Integrated circuits yaitu transistor dan dioda yang diletakkan secara terpisah dalam satu tempat, dan Monolithic System Technology (MST) yaitu elemen-elemen sirkuit yang diletakkan dalam satu chip PenggunaanIC(IntregratedCircuit) •Ukurankomputermenjadilebihkecil •DitemukannyaSistemOperasi Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  48. 48.  Penggunaan listrik lebih hemat Memungkinkan untuk melakukan multiprocessing, yaitu dapat memproses sejumlah data dari sumber-sumber yang berbeda pada waktu bersamaan dan multiprogramming yaitu dapat mengerjakan beberapa program sekaligus Bisa menampilkan gambar dan grafik Harga semakin murah Kemampuan melakukan komunikasi data dari satu komputer dengan komputer lainnya Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  49. 49.  Peningkatan dari softwarenya Lebih cepat dan lebih tepat kecepatanya hampir 10000 kali dari komputer generasi pertama Kapasitas memori lebih besar, dapat menyimpan ratusan ribu karakter Menggunakan simpanan luar yang sifatnya random access (dapat memasukkan record data secara random) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  50. 50. • Menggunakan IC ( Integrated Circuit )• Pemrosesan lebih cepat• Kapasitas memori lebih besar lagi• Penggunaan listrik lebih hemat• Bentuk fisik lebih kecil  1964 : IBM S/360, komputer generasi ketiga pertama• Banyak bermunculan application software digunakan untuk aplikasi bisnis dan teknik.  1969 : NOVA, dikembangkan oleh Data General Corporation, komputer mini 16 bit pertama Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  51. 51. Komputer-komputer KG III  Th 1964 KG III yang pertama IBM S/360  Th 1969 Komputer mini 16 bit pertama  UNIVAC 1108, 9000  Burroughs 5700,6700,7700  NCR seri Century  GE 600. 235  CDC 3000,6000, 7000  PDP-8, 11 Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  52. 52. Komputer Generasi ke empat (sejak1970)  ChipIntel4004yangdibuatpadatahun1971membawakemajuanpadaICdenganmeletakkanseluruhko mponendarisebuahkomputer(centralprocessingunit,memori,dankendaliinput/output)dalamsebuahc hipyangsangatkecil.Sebelumnya,ICdibuatuntukmengerjakansuatutugastertentuyangspesifik.Sekar ang,sebuahmikroprosesordapatdiproduksidankemudiandiprogramuntukmemenuhiseluruhkebutuha nyangdiinginkan.Tidaklamakemudian,setiapperangkatrumahtanggasepertimicrowaveoven,televisi, danmobildenganelectronicfuelinjectiondilengkapidenganmikroprosesor.Padatahun1981,IBMmemp erkenalkanpenggunaanPersonalComputer(PC)untukpenggunaandirumah,kantor,dansekolah.Juml ahPCyangdigunakanmelonjakdari2jutaunitditahun1981menjadi5,5jutaunitditahun1982.Sepuluhtahu nkemudian,65jutaPCdigunakan.Komputermelanjutkanevolusinyamenujuukuranyanglebihkecil,darik omputeryangberadadiatasmeja(desktopcomputer)menjadikomputeryangdapatdimasukkankedalam tas(laptop),ataubahkankomputeryangdapatdigenggam(palmtop Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  53. 53. Ciri-cirikomputer generasi keempat: • penggunaan LSI (large scale integration) yang merupakan pemadatan beribu ribu IC dalam satu chip.  Dikembangkan komputer mikro yang menggunakan mikroprosesor dan semikonduktor yang berbentuk chip untuk memori komputer (internal memori)  DigunakannyaLSI,VLSI,ULSI  •Digunakannyamikroprosesor Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  54. 54. • Menggunakaan Large Scale Integration ( LSI )• Dikembangkan komputer micro yang menggunakan microprocessor dan semiconductor yg berbentuk chip untuk memori komputer • IBM 370, komputer generasi keempat yang pertama • Cray 1, Komputer super pertama • Apole II, Personal Computer pertama • Komputer IBM PC yang pertama • Pentium II • AMD K6 3D Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  55. 55. Komputer-komputer KG IV Th 1970 KG IV yang pertama (IBM 370) Th 1971 Microprosesor yang pertama Th 1974 Komputer mikro komersial yang pertama (mikro altair) Th 1975 Komputer super Komersial yang pertama (Cray-1) Th 1977 Local Area Network (LAN) yang pertama Th 1977 PC yang pertama (Apple II, Radio shack) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  56. 56.  Th 1981 komputer sistem windows dan menggunakan mouse pertama (Xerox Corporation) Th 1981 Komputer IBM PC yang pertama menggunakan mikroprosesor buatan intel 8088 Th 1984 IBM PC/AT Th 1984 Machintosh dan GUI pertama sangat terkenal karena user friendly Th 1987 IBM PS/2 Th 1988 IBM PC/386 Komputer 32 Bit yang pertama Th 1990 IBM PC/486 Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  57. 57.  Th 1997 Pentium II beberapa seri pentium : * Pentium 66 * Pentium 75 * Pentium 200 pada mei 1997, perusahaan intel memperkenalkan microprosesor pentium II sebagai kelanjutan dari seri pentium : * Intel pentium 233 * Intel pentium 266 * Intel pentium 300 Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  58. 58.  Th 1998 AMD K6 3D pesaing intel meluncurkan AMD K6 3D, mempunyai kecepatan 300 MHz dan 350 MHz. mempunyai kemampuan memproses aplikasi grafik 3D lebih cepat dibanding prosesor sebelumnya Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  59. 59. Komputer generasi kelima  Banyakkemajuandibidangdesainkomputerdanteknologisemkainmemungkinkanpembuatanko mputergenerasikelima.Duakemajuanrekayasayangterutamaadalahkemampuanpemrosesanp aralel,yangakanmenggantikanmodelnonNeumann.ModelnonNeumannakandigantikandengan sistemyangmampumengkoordinasikanbanyakCPUuntukbekerjasecaraserempakKemajuanlai nadalahteknologisuperkonduktoryangmemungkinkanaliranelektriktanpaadahambatanapapun, yangnantinyadapatmempercepatkecepataninformasi Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  60. 60. Komputer Generasi ke Lima Komponen yang dipergunakan adalah VLSI (veri large scale integration). Teknologi ini mampu memproses trilyun operasi per detik, sedang ship hanya milyard operasi per detik.Negara pelopor --- JEPANGDengan mendirikan ICOT (institute for new computer technology) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  61. 61. Ciri-ciri Keberhasilan Komputergenerasi ke lima  Menterjemahkan bahasa manusia sehingga manusia dapat bercakap cakap langsung dengan komputer  Penghematan energi komputer  Dapat melakukan diagnosa penyakit yang lebih akurat,dsb Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  62. 62. • Menggunakaan Very Large Scale Integration (VLSI )• Adanya microprocessor dan semi conductor• Komputer pada generasi ini mengembangkan komputer yang bisa bercakap dengan manusia sehingga bisa meniru intelegensi manusia• Dikenal juga dengan sebutan Generasi Pentium. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  63. 63. Komputer Generasi Keenam (Abad 21)• Generasi ini adalah generasi masa depanyang nantinya dikenal dengan Generasi Titanium. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  64. 64. Komputer Masa Depan Komputer masa depan diramalkan akan dapat berpikir dan mempunyai perasaan seperti manusia. Beberapa ilmuan komputer yakin, suatu ketika akan tercipta suatu komponen yang disebut dengan nama BIOCHIP yang terbuat dari bahan protein sintesis yang merupakan bahan dari robot yang akan menjadi manusia tiruan Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  65. 65. KOMPUTER DAN SIKLUS PENGOLAHAN DATADEFINISI KOMPUTER “ALAT ELEKTRONIK YANG DAPAT MENERIMA INPUT DATA DAN MENGOLAHNYA MENJADI SUATU INFORMASI YANG DIINGINKAN,DENGAN MENGGUNAKAN SUATU PROGRAM YANG TERSIMPAN DI MEMORINYA, SERTA DAPAT MENYIMPAN PROGRAM DAN HASIL PENGOLAHANNYA, DIMANA BEKERJA SECARA OTOMATIS” Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  66. 66. Computare (Latin) to compute menghitung• Alat elektronik• Dapat menerima input data• Dapat mengolah data• Dapat memberikan informasi• Menggunakaan suatu program yang tersimpan di memori komputer• Dapat menyimpan program dan hasil pengolahan• Bekerja secara otomatis. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  67. 67.  Perangkat elektronika yang dapat menerima dan mengolah data menjadi informasi, menjalankan program yang tersimpan dalam memori, serta dapat bekerja secara otomatis dengan aturan tertentu. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  68. 68. TIGA KOMPONEN UTAMA KOMPUTER  OUTPUT UNIT SYSTEM UNIT  INPUT UNIT Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  69. 69. Perangkat Keras Komputer (Hardware) Komponen Hardware  Central Processing Unit(CPU)  Media Penyimpanan atau Memory  Input Device (Peralatan Input)  Output Device (Peralatan Output)  Communication Device (Peralatan Komunikasi) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  70. 70. Perangkat Keras Komputer (Hardware) (cont.) Central Processing Unit (CPU)  Komponen CPU :  Control Unit  Arithmatic Logic Unit (ALU) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  71. 71. Perangkat Keras Komputer (Hardware) (cont.) Machine Cycle (Siklus Mesin)  Fetch  Decode  Execute  Store  Communication Device (Peralatan Komunikasi) Faktor Penentu Kemampuan Prosesor:  System Clock  Bus Width  I/O Bus  Data Bus  Word Size Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  72. 72. Perangkat Keras Komputer (Hardware) (cont.) Jenis Proses :  Serial Processing  Parallel Processing  SIMD (Single Instructin Multiple Data)  MIMD (Multiple Instructin Multiple Data)  Pipeline Processing Tahapan Proses :  Pengambilan instruksi  Penerjamahan instruksi  Ekseskusi instruksi  Penulisan hasil instruksi Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  73. 73. Perangkat Keras Komputer (Hardware) (cont.) Media Penyimpanan (Storage)  Primary Storage  RAM (Random Access Memory)  DRAM (Dynamic RAM)  SRAM (Static RAM) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  74. 74. Perangkat Keras Komputer (Hardware) (cont.)  EDORAM (Extended Data Out RAM ) 72 pin  SDRAM 168 pin Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  75. 75. Perangkat Keras Komputer (Hardware) (cont.) ROM (Read Only Memory)  PROM  EPROM  EEPROM Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  76. 76. Perangkat Keras Komputer (Hardware) (cont.) Circuit Board  SIMM (Single In-line Memory Module)  DIMM (Dual In-line Memory Module) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  77. 77. Perangkat Keras Komputer (Hardware) (cont.)  Cache Memory (Flash RAM)  Video Memory (VRAM) Video Memory Stick Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  78. 78. Perangkat Keras Komputer (Hardware) (cont.)  Flash Memory Secondary Storage  Magnetic Storage  Magnetic tape Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  79. 79. Perangkat Keras Komputer (Hardware) (cont.)  Magnetic Disk  Hard Disk  Floppy Disk (Diskette)  Optical Storage Representasi data dalam memori : binary digit Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  80. 80. Perangkat Keras Komputer (Hardware) (cont.) Karakteristik Media Penyimpanan  Kecepatan  Volatility  Metode Akses  Serial Access  Random Access  Paralell Access  Portability  Capacity Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  81. 81. Perangkat Keras Komputer (Hardware) (cont.) Hirarki media penyimpanan memori berdasarkan karakteristiknya : Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  82. 82. Perangkat Keras Komputer (Hardware) (cont.) Perbandingan Primary Storage dan Secondary Storage :  Temporary vs Permanent  Hanya dapat menyimpan data jika komputer nyala vs Dapat menyimpan data jika komputer mati Peralatan Input (Input Device)  Keyboard Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  83. 83. Perangkat Keras Komputer (Hardware) (cont.) Pointing Device  Mouse  Trackball  Joystick Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  84. 84. Perangkat Keras Komputer (Hardware) (cont.) Terminal  Dumb terminal  ATM  Point of SalesTerminal Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  85. 85. Perangkat Keras Komputer (Hardware) (cont.) Optical Reading Device (scanner)  Barcode Reader  Handprint Reader  Image Scanner Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  86. 86. Perangkat Keras Komputer (Hardware) (cont.) Peralatan Output (Output Device)  Visual Display (Monitor)  Printer  Impact Printer : dot matrix printer  Non Impact Printer : inkjet printer Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  87. 87. Perangkat Keras Komputer (Hardware) (cont.) Plotters Computer Output Microfilm (COM) Audio Response Unit (ARU) Voice Output Device dalam bentuk Flash Memory Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  88. 88. Perangkat Keras Komputer (Hardware) (cont.) Peralatan Komunikasi (Communication Device)  Modem (Modulation Demodulation)  External vs Internal Modem  Smart Modem  Fax modem Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  89. 89. Perangkat Lunak Komputer (Software) (cont.) Sistem Operasi - Pengertian- Fungsi- Contoh sistem operasi- Penjelasan Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  90. 90. Perangkat Lunak Komputer (Software) (cont.) Sistem Perangkat Lunak  System Control Programs  System Support Program  System Utility Program  System Performance Monitor  System Security Monitor Jenis Aplikasi Perangkat Lunak  Proprietary Application Software  Off the shelf Application Software Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  91. 91. Perangkat Lunak Komputer (Software) (cont.) Permasalahan Software  Pemilihan dan Penilaian Software  Software Licensing  Software Upgrades  Open Systems  Open Source Software Bahasa Pemrograman  Bahasa Mesin (Machine Language)  Bahasa Rakitan (Assembly Language)  Bahasa Prosedural (Procedural Language)  Bahasa tidak Prosedural / terprosedure (Nonprocedural Language) Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  92. 92. Perangkat Lunak Komputer (Software) (cont.) Bahasa Pemrograman Natural (Natural Language) Bahasa Pemrograman Virtual HTML (Hypertext Markup Language) Extensible Markup Language (XML) Componentware Virtual Reality Modeling Object Bahasa Pemrograman Object Oriented Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  93. 93. SIKLUS PENGOLAHAN DATA SIKLUS PENGOLAHAN DATA (DATA PROCESSING CYCLE) INPUT PROSES OUTPUTSIKLUS PENGOLAHAN DATA YANG DIKEMBANGKAN ORIGINATION INPUT PROCESING OUTPUT DISTRIBUTION STORAGE Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  94. 94. PENJELASAN DIAGRAM PENGEMBANGAN PENGOLAHAN DATA ORIGINATIONPROSES PENGUMPULAN DATA / PENCATATAN DATA KEDOKUMEN DASAR. INPUTMEMASUKKAN DATA KEDALAM SISTEMKOMPUTER MELALUIALAT INPUT. PROCESSINGPROSES PENGOLAHAN DATA YANG SUDAH DI INPUT KEDALAMSISTEM KOMPUTER. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  95. 95. PENJELASAN DIAGRAM PENGEMBANGAN PENGOLAHAN DATA• OUTPUT MENGELUARKAN HASIL PROSES DARI PENGOLAHAN DATA BERUPA INFORMASI.• DISTRIBUTION MENDISTRIBUSIKAN HASIL PENGOLAHAN DATA KEPADA YANG MEMBUTUHKAN INFORMASI. STORAGEPEREKAMAN HASIL KE SIMPANAN LUAR, UNTUK DIGUNAKAN SEBAGAIINPUT PADA PROSES SELANJUTNYA. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  96. 96. Sejarah internet Internet merupakan jaringan komputer yang dibentuk oleh Departemen Pertahanan Amerika Serikat pada tahun 1969, melalui proyek ARPA yang disebut ARPANET (Advanced Research Project Agency Network), di mana mereka mendemonstrasikan bagaimana dengan hardware dan software komputer yang berbasis UNIX, kita bisa melakukan komunikasi dalam jarak yang tidak terhingga melalui saluran telepon. Proyek ARPANET merancang bentuk jaringan, kehandalan, seberapa besar informasi dapat dipindahkan, dan akhirnya semua standar yang mereka tentukan menjadi cikal bakal pembangunan protokol baru yang sekarang dikenal sebagai TCP/IP (Transmission Control Protocol/Internet Protocol). Tujuan awal dibangunnya proyek itu adalah untuk keperluan militer. Pada saat itu Departemen Pertahanan Amerika Serikat (US Department of Defense) membuat sistem jaringan komputer yang tersebar dengan menghubungkan komputer di daerah-daerah vital untuk mengatasi masalah bila terjadi serangan nuklir dan untuk menghindari terjadinya informasi terpusat, yang apabila terjadi perang dapat mudah dihancurkan. Ari AA, S.Kom . Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  97. 97. Sejarah internet . Pada mulanya ARPANET hanya menghubungkan 4 situs saja yaitu Stanford Research • Institute, University of California, Santa Barbara, University of Utah, di mana mereka membentuk satu jaringan terpadu pada tahun 1969, dan secara umum ARPANET diperkenalkan pada bulan Oktober 1972. Tidak lama kemudian proyek ini berkembang pesat di seluruh daerah, dan semua universitas di negara tersebut ingin bergabung, sehingga membuat ARPANET kesulitan untuk mengaturnya. • Oleh sebab itu ARPANET dipecah manjadi dua, yaitu "MILNET" untuk keperluan militer dan "ARPANET" baru yang lebih kecil untuk keperluan non-militer seperti, universitas-universitas. Gabungan kedua jaringan akhirnya dikenal dengan nama DARPA Internet, yang kemudian disederhanakan menjadi Internet. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  98. 98. INTERNET Pengertian Internet  Jaringan komputer terbesar di dunia, kumpulan jaringan-jaringan Evolusi Internet Infrastuktur dari Internet Penggunaan Internet  Alamat di Internet  Akses Internet  Dial-up  Landline Broadband  DSL  Cable Modem  Wi-Fi  Satellite  Cell Phones Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  99. 99. INTERNET Layanan yang Disediakan oleh Internet :  Layanan Komunikasi  e-mail  USENET Newsgroup(Forums)  LISTSERV  Chatting  Instant Messaging  Telnet  Internet Telephony  Internet Fax  Streaming Audio dan Video  Real-time Audio dan Video Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  100. 100. INTERNET Layanan Perolehan Informasi (Information Retrieval Services)  File Transfer Protocol (FTP)  Archie  Gophers  Veronica (Very Easy Rodent Oriental Netwide Index to Computer)  Wide Area Information Server (WAIS)  Web Services Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  101. 101. INTERNET World Wide Web  Browser  Offline Browser  Mesin Pencari (Search Engine)  Push Technology  Penyaring Informasi  Clipping Services  Personalized Web Service  Web Authoring Tantangan-tantangan Internet  Teknologi-Teknologi Baru  Peraturan Internet  Ekspansi Internet  Internet Privacy Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  102. 102. KESIMPULAN Setelah disusunya makalah ini dapat disimpulkan bahwa : 1. Karena sangat pentingnya komunikasi dalam kehidupan kita maka sangat penting pula alat komunikasi dalam kehidupan kita di masa kini. 2. Seiring dengan berkembangnya teknologi informasi dan komunikasi maka layanan informasi dan komunikasipun semakin cepat dan mudah. Hal tersebut menuntut manusia untuk memiliki alat komunikasi yang mendukung semua itu. 3. Selain media elektronik dan media cetak dengan perkembangannya, jaringan seluler dan internet merupakan alat komunikasi masa kini yang lebih maju dalam perkembangannya. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  103. 103. SARAN Bertolak dari betapa pentingnya teknologi informasi dan komunikasi pada saat ini karena perkembangannya yang begitu pesat, penyusun memberikan saran sebagai berikut : 1. Adanya lab komputer di sekolah untuk praktek TIK, atau paling tidak ada 1 atau 2 PC per kelas agar siswa bisa lebih memahami tentang pelajaran TIK 2. Penggunaan perangkat yang ada untuk mendemonstrasikan atau mempraktekkan setiap materi TIK karena kalau hanya materi kami tidak begitu paham. Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  104. 104. DAFTAR PUSTAKA http://jelitasarismansaku.blogspot.com/2012/05/tik-kelas-x.html http://hends25.blogspot.com/2011/06/makalah-tik-smp-2011.html http://www.slideshare.net/jumiathyasiz/pertemuan-1-sejarah-komputer-10626615 http://jelitasarismansaku.blogspot.com/2012/05/tik-kelas-x.html http://www.google.co.id/#hl=id&biw=1440&bih=714&sa=X&ei=EcAQUNXuPIarrAfquoHIAQ&ved=0CEsQBSgA&q= komputer+generasi+ketiga+dalam+bentuk+power+point&spell=1&bav=on.2,or.r_gc.r_pw.r_qf.,cf.osb&fp=93d99ac 811d5ed06 Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi
  105. 105. Thank‟s PENGENALAN TEKNOLOGI INFORMASI SANTRI HIDAYAH & NUR’AINI Ari AA, S.Kom Pegenalan Teknologi Informasi Pengantar Teknologi Informasi

×