EPIDEMIOLOGI NON MENULARGAGAL GINJAL AKUT DAN KRONIS            Oleh:        RYAN KOKOILMU KESEHATAN MASYARAKATFAKULTAS IL...
BAB I                            GAGAL GINJAL AKUTA. Definisi          Gagal Ginjal Akut adalah kemunduran yang cepat dari...
C. Klasifikasi   1. Gagal Ginjal Akut Prerenal          GGA Prerenal merupakan keadaan dimana aliran darah ke ginjal      ...
Penyebab tersering adalah obstruksi baik karena batu,jendalan      darah,tumor,dll.Kelainannya bersifat reversibel bila ob...
BAB II                      GAGAL GINJAL KRONISA. Definisi          GagalGinjalKronisadalahkemunduranperlahandarifungsigin...
meningkat diatas batas normal. Peningkatan konsentrasi BUN ini            berbeda beda, tergantung dari kadar protein dala...
Lelah dan lemah        Bermasalah dalam tidur         Penurunan mental secara tajam         Otot berkedut dan kejang      ...
G. Pencegahan GGA dan GGK  Beberapahal        yang     bisadilakukanuntukmencegahpenyakitgagalginjal  adalah:            M...
Misalnyabisamelakukanjalansantaisetiappagiataubersepeda 1-2 jamsetiapminggu.KurangiMakananBerlemak.Makananberlemakakanmeny...
9
Upcoming SlideShare
Loading in …5
×

GAGAL GINJAL AKUT DAN KRONIS

650 views

Published on

Published in: Education
0 Comments
1 Like
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
650
On SlideShare
0
From Embeds
0
Number of Embeds
2
Actions
Shares
0
Downloads
25
Comments
0
Likes
1
Embeds 0
No embeds

No notes for slide

GAGAL GINJAL AKUT DAN KRONIS

  1. 1. EPIDEMIOLOGI NON MENULARGAGAL GINJAL AKUT DAN KRONIS Oleh: RYAN KOKOILMU KESEHATAN MASYARAKATFAKULTAS ILMU KEOLAHRAGAANUNIVERSITAS NEGERI SEMARANG 2012 0
  2. 2. BAB I GAGAL GINJAL AKUTA. Definisi Gagal Ginjal Akut adalah kemunduran yang cepat dari kemampuan ginjal dalam membersihkan darah dari bahan-bahan racun, yang menyebabkan penimbunan limbah metabolik di dalam darah (misalnya urea) pada seseorang dengan ginjal sehat sebelumnya.B. Etiologi Gagal ginjal akut bisa merupakan akibat dari berbagai keadaan yang menyebabkan: 1. Berkurangnya aliran darah ke ginjal Kekurangandarahakibatperdarahan, dehidrasiataucederafisikygmenyebabkantersumbatnyapembuluhdar ah Dayapompajantungmenurun (kegagalanjantung) Tekanandarahygsangatrendah (syok) Kegagalanhati (sindromahepatorenalis) 2. Penyumbatan aliran kemih setelah meninggalkan ginjal Pembesaranprostat Tumor ygmenekansalurankemih 3. Trauma pada ginjal. Reaksialergi (misalnyaalergiterhadapzatradioopakygdigunakanpadapemeriksaan rontgen) Zat-zatracun Keadaanygmempengaruhi unit penyaringanginjal (nefron) Penyumbatanarteriatau vena di ginjal Kristal, protein ataubahanlainnyadalamginjal 1
  3. 3. C. Klasifikasi 1. Gagal Ginjal Akut Prerenal GGA Prerenal merupakan keadaan dimana aliran darah ke ginjal menurun sehingga mengganggu fungsi normal ginjal,serta bersifat paling ringan dan cepat dapat reversibel (dapat normal lagi) bila keadaan tersebut segera diperbaiki. Etiologi: Pendarahan;luka bakar,muntah,diare yang menyebabkan penurunan volume darah sehingga darah yang menuju ke ginjal juga mengalami penurunan. Infark miokard (kematian otot jantung),gagl jantung,mengakibatkan penurunan curah jantung (kegagalan jantung memompakan darah ke seluruh jaringan tubuh,termasuk ginjal). 2. Gagal Ginjal Akut Renal Nekrosis Tubuler Akut (NTA) GGA renal sebagian besar berupa NTA.Terjadi akibat / kelanjutan GGA prerenal yang terlambat atau kurang baik penanganannya sehingga ginjal kekurangan darah dalam waktu lama dan terjadi kerusakan ginjal. Penyakit Primer pada Ginjal GGA renal sebagian kecil disebabkan oleh penyakit primer pada ginjal,misalnya:Glomerulonefritis,Nefrosklerosis,Nefritis interstitialis akut karena obat, kimia, atau kuman 3. Gagal Ginjal Akut Postrenal GGA postrenal adalah suatu keadaan dimana pembentukan urin cukup,namun alirannya dalam saluran kemih terhambat.Disini terjadi gangguan aliran kencing pada kedua sisi ginjal dimana ginjal atau obstruksi (sumbatan) pada satu sisi ginjal akibat ginjal sebelah lainnya sudah diambil / sudah rusak sebelumnya.. 2
  4. 4. Penyebab tersering adalah obstruksi baik karena batu,jendalan darah,tumor,dll.Kelainannya bersifat reversibel bila obstruksi segera dihilangkan.D. Gejala Gejala-gejala yang dtemukan pada gagal ginjal akut: Berkurangnya produksi air kemih (oliguria=volume air kemih berkurang atau anuria=sama sekali tidak terbentuk air kemih) Nokturia (berkemih di malam hari) Pembengkakan tungkai, kaki atau pergelangan kaki Pembengkakan yang menyeluruh (karena terjadi penimbunan cairan) Berkurangnya rasa, terutama di tangan atau kaki Perubahan mental atau suasana hati Tremor tangan dan kejang Mual, muntahE. Pengobatan Tujuan dari pengobatan adalah menemukan dan mengobati penyebab dari gagal ginjal akut. Selain itu pengobatan dipusatkan untuk mencegah penimbunan cairan dan limbah metabolik yang berlebihan. Asupan cairan dibatasi dan disesuaikan dengan volume air kemih yangdikeluarkan. Asupan garam dan zat-zat yang dalam keadaan normal dibuang oleh ginjal, juga dibatasi. Penderita dianjurkan untuk menjalani diet kaya karbohidrat serta rendah protein, kalium, dan natrium. Memberikan natrium polistiren sulfonat untuk mengatasi hiperkalemia. Membuang kelebihan cairan dan limbah metabolik bisa dilakukan dialisa 3
  5. 5. BAB II GAGAL GINJAL KRONISA. Definisi GagalGinjalKronisadalahkemunduranperlahandarifungsiginjal yang menyebabkanpenimbunanlimbahmetabolik di dalamdarah (azotemia) dan bersifat menahun.B. Etiologi Penyebab dari gagal ginjal kronis adalah: Tekanandarahtinggi (hipertensi) Penyumbatansalurankemih Glomerulonefritis Kelainanginjal, misalnyapenyakitginjalpolikista Diabetes melitus (kencingmanis) Kelainanautoimun, misalnya lupus eritematosussistemik.C. Klasifikasi Berdasarkan derajat penurunan faal ginjal,GGK dapat diklasifikasikan sebagai berikut: StadiumI Penurunan cadangan ginjal (faal ginjal antar 50 % – 80 %). Tahap inilah yang paling ringan, dimana faal ginjal masih baik. Pada tahap ini penderita belum merasasakan gejala gejala dan pemeriksaan laboratorium faal ginjal masih dalam batas normal. Selama tahap ini kreatinin serum dan kadar BUN (Blood Urea Nitrogen) dalam batas normal dan penderita asimtomatik. StadiumII Insufiensi ginjal (faal ginjal antar 20 % – 50 %). Pada tahap ini penderita dapat melakukan tugas tugas seperti biasa padahal daya dan konsentrasi ginjal menurun. Pada tahap ini lebih dari 50 % jaringan yang berfungsi telah rusak. Kadar BUN baru mulai 4
  6. 6. meningkat diatas batas normal. Peningkatan konsentrasi BUN ini berbeda beda, tergantung dari kadar protein dalam diit. Pada stadium ini kadar kreatinin serum mulai meningkat melebihi kadar normal. StadiumIII Uremi gagal ginjal (faal ginjal sekitar 10-20%). Semua gejala sudah jelas dan penderita masuk dalam keadaan dimana tidak dapat melakukan tugas sehari hari sebagaimana mestinya.. Pada Stadium ini, sekitar 90 % dari massa nefron telah hancur. Nilai GFR nya 10- 20 % dari keadaan normal dan kadar kreatinin mungkin sebesar 5- 10 ml / menit atau kurang. StadiumIV Penyakit ginjal stadium akhir (ESRD), yang terjadi apabila GFR menurun menjadi kurang dari 5% dari normal. Hanya sedikit nefron fungsional yang tersisa. Di seluruh ginjal ditemukan jaringan parut dan atrofi tubulus.D. Prevalensi Indonesia sendiri belum memiliki sistem registri yang lengkap di bidang penyakit ginjal, namun di Indonesia diperkirakan 100 per sejuta penduduk atau sekitar 20.000 kasus baru dalam setahun. Survei Perhimpunan Nefrologi Indonesia menunjukkan, 12,5 persen dari populasi mengalami penurunan fungsi ginjal. Secara kasar itu berarti lebih dari 25 juta penduduk. Di seluruh dunia tahun 2005 ada 1,1 juta orang menjalani dialisis kronik. Tahun 2010, diproyeksikan lebih dari 2 juta orang.E. Gejala Gejala gagal ginjal kronis berkembang secara perlahan antara lain: Berkurangnya urin saat buang air seni Mual dan muntah Hilang nafsu makan 5
  7. 7. Lelah dan lemah Bermasalah dalam tidur Penurunan mental secara tajam Otot berkedut dan kejang Bengkak pada area kaki peradanganlapisanmulut (stomatitis) Rasatidakenak di mulut Malnutrisi penurunanberatbadan.F. Pengobatan Tujuan pengobatan adalah untuk mengendalikan gejala, meminimalkan komplikasi dan memperlambat perkembangan penyakit. Diet rendah protein (0,4-0,8 gram/kg BB) bisamemperlambatperkembangangagalginjalkronis. Tambahan vitamin B dan C diberikanjikapenderitamenjalani diet ketatataumenjalanidialisa. Memberikan gemfibrozil untuk menurunkan kadar trigliserida dalam darah Membatasiasupancairanuntukmencegahterlalurendahnyakadargara m (natrium) dalamdarah Menghentikan obat-obatan yang menyebabkan penyakit atau yang dapat merusak ginjal Mengobati infeksi dan masalah-masalah lain seperti diabetes dan tekanan darah tinggi Pengobatan lain seperti steroid Dialisis (pencucian darah) Removal Transplantasi Pemberian diuretik (meningkatkan jumlah cairan yang dibuang melalui ginjal) 6
  8. 8. G. Pencegahan GGA dan GGK Beberapahal yang bisadilakukanuntukmencegahpenyakitgagalginjal adalah: Mengontroltekanandarah. Tekanandarahtinggikronismerupakansalahsatupenyebab paling umumterjadinyagagalginjalakutpadalaki-lakidanperempuandewasa. Berhentimerokok. Asaprokokdapatmenyebabkanberbagaimasalahkesehatan, termasukmeningkatkanrisikoterjadinyagagalginjal.Gagalginjalmeru pakan stadium akhirdaripenyakitginjal.Gagalginjalterjadiketikaginjaltidaklagidapa tmemproses darahsecara normal.Bilagagalginjalterjadi, makaseseorangharusmenjalaniperawatandialisis, dimanamesinmenggantikanfungsi normal ginjal. Pemeriksaan x-ray. Sebelum melakukanPemeriksaan x-rayharus berkonsultasi terlebih dahulu dengandokter. MungkinAndaperluminumobatkhusussebelummelakukanpemeriksa an x-ray untukmencegah x-ray merusakginjal. Berhentiminumalkohol. Menghindariatauberhentiminumalkoholdapatmengurangiketeganga npadaginjal.Minumanalkoholmemaksaginjalbekerjakeras, sehinggamenghindarialkoholdapatmencegahterjadinyagagalginjal. Pemeriksaandarahdanurin. Mengunjungidokterdanlakukanpemeriksaandarahdanurinsecararuti n. Pemeriksaaniniakanmelihatadanyamasalahpadaginjal yang munculmeskipuntandadangejalanyabelumnampakataudirasakan. Olah Raga. Melakukanolah raga secararutindanteratur. Olah raga yang teratur - tidakterlaluberatakanlebihberdampakpositifbagitubuhdibandingkan denganolah raga beratnamuntidakteratur. 7
  9. 9. Misalnyabisamelakukanjalansantaisetiappagiataubersepeda 1-2 jamsetiapminggu.KurangiMakananBerlemak.MakananberlemakakanmenyebabkankandungankolesteroldalamdarahAndameningkat.Konsumsi Air Putih. Air membantudalam prosesmenghilangkandanmemangkasracundanbakteridalamtubuh.Iniadalahsalahsatu yang paling pentingdalammanfaat air itusendiri.Detoksifikasidapatmembantutubuhmelawanpenyakitdanmenyingkirkanbahankimia yang dapatmerusaksistem organtubuhmanusia.Bahkanbeberapajenispenyakitkronissekalipun.GeneralCheckup.Gagalginjaljugadapatdicegahmelaluipemeriksaankesehatan (medical checkup) secararutin,termasukpemeriksaanurindandarah.Memeriksakangangguanginjalsepertikencingbatu,prostatdapatmecegahmunculnyagagalginjal.Tidaksembaranganmengkonsumsiobat-obatan.Obat-obatanyangberbahayaakanmerusakfungsidariginjal.Selainitukonsumsiobatyangberlebihanjugabisamenggangukesehatanginjaldanorganlainnya.Suplemenbawangputih.Tanyakanpadadoktermengenaikemungkinanuntukmengambilsuplemenbawangputih.Suplemeninidapatmembantumengurangitekanandarahdengancepat.Namun, padasaat yang sama,suplemenbawangputihdapatmenghambatkemampuanpenggumpalandarah, sehinggaharusdiminum di bawahpengawasandokter. 8
  10. 10. 9

×