Tulevaisuus 4.0

803 views

Published on

Yamk Mikkeli 12.10.2009

Published in: Education
0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
803
On SlideShare
0
From Embeds
0
Number of Embeds
4
Actions
Shares
0
Downloads
7
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

Tulevaisuus 4.0

  1. 1. Tulevaisuus 4.0<br />HannuLinturi 12.10.2009<br />Hannu Linturi<br />
  2. 2. Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  3. 3. Uskomukset</li></ul>Tulevaisuusmetodit<br /><ul><li>Työkalut
  4. 4. Tekniikat</li></ul>Caseja<br /><ul><li>MetsäjaSuomi
  5. 5. Laadullinenennakointi (barometrit)
  6. 6. Ammattikeittiöntulevaisuus
  7. 7. Asiantuntijuus
  8. 8. Pitkätulevaisuus: kolmenäkökulmaa</li></li></ul><li>Herakleitos (535-474 eaa)<br /><ul><li>Ajasta: ”Ei ole mahdollista astua kahta kertaa samaan virtaan, sillä kaikki koko ajan hajoaa ja yhdistyy ja lähenee ja loittonee.”
  9. 9. Ristiriidasta: ’Vastaanhangoitteleva yhteensopiva’ syntyy niistä voimista, jotka pyrkivät eri suuntiin, mutta jotka kuitenkin liittyvät yhteen. Tästä liitosta kehittyy kaunein harmonia.
  10. 10. Harmoniasta: Herakleitos sätti ihmisiä, jotka eivät ymmärrä, miten siinä missä vedetään eri suuntiin, ollaankin sopusoinnussa. Arvokas harmonia on ’vastahakoista’ ja jännitteistä kuin jousi tai lyyra.
  11. 11. Paradoksista: Maailman kehityksen melodiana on vastakkaisuuksien ryskyminen ja sulautuminen. Kaiken muuttumisen taustalla on kuitenkin pyrkimys homeostasikseen eli tasapainoon. </li></li></ul><li>TULEVAISUDEN <br />TUTKIMUSKESKUS<br />
  12. 12. TULEVAISUDEN <br />VERKOSTOAKATEMIA<br />
  13. 13. TULEVAISUDEN <br />TUTKIMUKSEN SEURA<br />
  14. 14. Delfoi –kehittäjäyhteisö<br />
  15. 15. Kulttuurievoluutio<br /> ”Ne tavattomat erot, jotka ilmenevät pukeutumisessa ja seurustelutavoissa, elinympäristössä ja miellemaailmassa, aiheutuvat kulttuurievoluutiosta. Suunnilleen samalla tavoin kuin mutaatiot muuttavat biologista perintöainesta, mullistavat uudet ajatukset, löydöt ja keksinnöt kulttuuriperintöä. Sukupuoliyhteyttä biologisen perintöaineksen edelleen siirtämisessä vastaavat kulttuurin kehityksessä kasvatus, opinnot ja koulutus. --- Aatteet (ideat) puolestaan ovat erilaisia ajatusrakennelmia. Ne toimivat eräänlaisina kulttuurin perinnöllisyysmekanismin ’geeneinä’. Tässä sanan laajassa merkityksessä on kaikilla kansoilla ’kulttuuri’, koska ihmiset eivät yleensä voi elää yhdessä vaikuttamatta toistensa käyttäytymiseen. Jokainen kulttuuri kehittyy – vaihtelevan nopeasti – ja jokainen kulttuuritaso edustaa yhtä sivilisaatiota, sivistysmuotoa.”<br /><ul><li>Gerholm & Magnusson 1972, 5-6</li></li></ul><li>Paolo Freirejaajanteemat<br />Teematilmaisevatkussakinajassaratkaistaviatehtäviäjaongelmia. Ihmisenhumanisaatioriippuusiitä, kuinkahyvinhänkykeneeratkaisemaanaikakaudenteematjaintegroitumaanajanhenkeen. Aikakaudettäyttyvätsitämukaa, kun ihmisetkäsittävätsenteematjaratkaisevatsentehtävät. Aikojenmurroksessavaihtuvatpaitsiteematmyösajanjärki.<br />Paolo Freire 1970-luvun alussa<br />
  16. 16. Tofflerilaisetaikakaudet<br />
  17. 17. Kainja Abel<br />Ralf Kerbach Ks. www.poll-berlin.de/.../polleditionen/grafiken/<br />
  18. 18. Kainja Abel<br />
  19. 19. Pantheon<br />
  20. 20. Kruppinvaltakuntaa<br />
  21. 21. Teollistavapaa-aikaa<br />
  22. 22. n. 1970<br />n. 2020-40<br />Murroksen kehityskaari <br /> Tuotannon periaate<br />Yhteiskunnantoimintalogiikka<br />Yhteiskunnanmalli<br />Enemmän erilaista uudella tavalla tuotettuna<br />Enemmän ja parempaa vähemmästä<br />Enemmän enemmästä<br />Myöhäisteollinen murrosaika<br />INFORMATIONALISMI<br />INDUSTRIALISMI<br />Verkosto-yhteiskunta ?<br />Teollinen yhteiskunta<br />Tieto-yhteiskunta<br />Lähde: Malaska 1998; Aaltonen & Wilenius 2002<br />
  23. 23. Rakenneideat<br />
  24. 24. Yhteiskunta 3.0<br /><ul><li>Konerationalisointi: massatuotanto, suuruuden ekonomia
  25. 25. Standardi: samuus ja samuuden laatu, erilainen on hukka
  26. 26. Materiaalinen: luonnonvarat perustana, tavaran logiikka ja logistiikka, oleminen muuttuu omistamiseksi, hyvinvointi
  27. 27. Luokkaidentiteetti: yhteiskuntaluokat, professiot, asiantuntijuuden paradoksi
  28. 28. Asiantuntijuus: erikoistumisen logiikka, illichlainen paradoksi
  29. 29. Yhteiskunta 3.0: demokratia, kulutusyhteiskunta, sosialistinen ja kapitalistinen versio</li></li></ul><li>Y 3.5: dekonstruktio<br /><ul><li>Konerationalisointi: ?
  30. 30. Standardi: ?
  31. 31. Materiaalinen: ?
  32. 32. Luokkaidentiteetti: ?
  33. 33. Asiantuntijuus: ?
  34. 34. Yhteiskunta 3.5: ?</li></li></ul><li>Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  35. 35. Uskomukset</li></ul>Tulevaisuusmetodit<br /><ul><li>Työkalut
  36. 36. Tekniikat</li></ul>Caseja<br /><ul><li>MetsäjaSuomi
  37. 37. Laadullinenennakointi (barometrit)
  38. 38. Ammattikeittiöntulevaisuus
  39. 39. Asiantuntjuus
  40. 40. Pitkätulevaisuus: kolmenäkökulmaa</li></li></ul><li>Tulevaisuusmetodit<br />Futu–menetelmät tähtäävät usein käytännön ratkaisuihin. Tässä suhteessa menetelmiä käytetään enimmäkseen normatiivisesti (normative) eli etsitään tietoa siitä, mikä tulevaisuudentila (futurible) on sekä haluttava että mahdollinen. Menetelmätekniikat sallivat myös puhtaan tutkimuskäytön (exploratory) , jolloin tutkitaan mitä tahansa mahdollisia tulevaisuuksia. <br />Normatiivisuus-tutkimuksellisuus -jaottelun lisäksi tulevaisuusmenetelmät ovat luonteeltaan laadullisia (qualitative) tai määrällisiä (quantitative). Jälkimmäisiä ovat useimmat ekonometriset, systeemiset ja tilastolliset mallinnukset, indeksoinnit ja trendivaikutusanalyysit. Delfoi -tekniikka on laadullinen, mutta mahdollistaa myös ennustetyyppiset kyselytutkimukset, joita usein käytetään varsinkin teknologian diffuusioarvioinneissa (technologyforecasting). <br />Glenn, Jerome G. (2008) Introduction to the Futures Research Methods Series. <br />Futures Research Methodology – V2.0. AC/UNU Millennium Project.<br />
  41. 41. Futures Research Methodology V2.0<br /> 1. Introduction & Overview 15. Simulation and Games<br /> 2. Environmental Scanning 16. Genius Forecasting, Vision, and Int.<br /> 3. Delphi 17. Normative Forecasting<br /> 4. Futures Wheel 18. S&T Road Mapping<br /> 5. Trend Impact Analysis 19. Field Anomaly Relaxation (FAR)<br /> 6. Cross-Impact Analysis 20. Text Mining for Technology Foresight<br /> 7. Structural Analysis 21. Agent Modeling<br /> 8. Systems Perspectives 22. SOFI<br /> 9. Decision Modeling 23. SOFI Software<br />10. Statistical Modeling 24. The Multiple Perspective Concept<br />11. Technological Sequence Analysis 25. Tool Box for Scenario Planning<br />12. Relevance Trees and Morph. Analysis 26. Causal Layered Analysis <br />13. Scenarios 13.5 Interactive Scenarios 27. Integration, Comparisons, and <br />14. Participatory Methods Frontiers of Futures Research Methods<br />
  42. 42. 8.10.2009<br />23<br />Mahdollisetjatodennäköisettulevaisuudet<br />Kaikki sellainen, mikä on olemassa, mutta mitä emme osaa kuvitella.<br />Kaikki mikä on mahdollista<br />(rajoina mm. luonnonlaitjne.)<br />Kaikki mikä on todennäköistä<br /> Kaikki mitä voimme kuvitella<br /> (science fiction, myytit, sadut, tarinat, unet, jne.)<br />NYKYHETKI<br />Neut-raalit asiat<br />Toivottavat asiat<br />Vältettävät asiat<br />
  43. 43. 8.10.2009<br />24<br />Toimintaympäristön tarkastelu<br /><ul><li>tapahtumista, trendeistäjailmiöidenvälisistäsuhteistasaatavantiedonhyödyntämistäjakäyttöäorganisaationtoimintaympäristönmahdollistenmuutostenselvillesaamiseksi;
  44. 44. tarkastelunkohteenamyössisäisetjaulkoisetmuutosvoimat;
  45. 45. tavoitteenakehittäätehokkaitatapojaturvataomatulevatilanneja/tai vaikuttaamuutoksensuuntaan. </li></li></ul><li>8.10.2009<br />25<br />Toimintaympäristöntarkastelunedut<br />Toimintaympäristönmuutoksentarkastelunavullavoidaan<br />välttääyllätyksiä,<br />tunnistaauhkiajamahdollisuuksia,<br />parantaaosaamista,<br />saavuttaakilpailuetuaja<br />parantaasekäpitkänettälyhyenaikavälinstrategiatyöskentelynlaatuajatuloksia.<br />
  46. 46. 8.10.2009<br />26<br />Trendit<br /><ul><li> suuntaus, virtaus, muutoksen kaava;
  47. 47. pitkän ajanjakson kuluessa tapahtuva tarkasteltavan ilmiön yleinen kehityssuunta.</li></ul>Trendit ohjaavat päätöksentekoa vaikuttamalla valintoihin, makuun, arvostuksiin jne. Trendit voivat myös olla megatrendien osia. <br />
  48. 48. 8.10.2009<br />27<br />Syklit ja muutos<br />MUTTA:<br />Äkillinen muutos toimintaympäristössä<br />Kun tunnetaan kehityskulku n määrätyssä ajassa, voidaan tulevaa kehitystä ennustaa puolet niin pitkä aika eteenpäin (n/2)<br />x<br />&gt; kehitys muuttuu ennustamattomaksi<br />Ennustettava aika n/2<br />Mennyt aika n<br />NYT<br />Aika<br />Syklien pituus on ennustettava (pysyy aina samana): esim. ns. Kondratieffin taloudellinen sykli kestää 55 vuotta.<br />
  49. 49. 8.10.2009<br />28<br />Trendien ennakointi<br />Trendiekstrapolaatio on tulevaisuudenennakoimista, jokaperustuuoletukseen, ettätietytilmiöttodennäköisestijatkuvattulevaisuudessa. <br />Ennakoimisessaselvitetäänmyösilmiönsuunnandynamiikkaa (suunnanjavauhdinmahdollisiamuutoksia). Trenditvoivat olla siisnousevia, laskevia, murtuvia (=päättyviä) tai muuttumattomia.<br />Esim:Muotivirtaus, mm. minihame<br /> Uutiset joka puolen tunnin välein<br /> Väestön ikääntyminen<br />
  50. 50. 8.10.2009<br />29<br />Trendien lajit<br />x<br />NOUSEVA<br />VAKAA<br />LASKEVA<br />MURTUVA<br />MUUTTUVA<br />Aika<br />
  51. 51. 8.10.2009<br />30<br />Heikot signaalit<br />Heikko signaali on ensimmäinen ilmaus muutoksesta tai se voi olla juuri se sysäys, joka muuttaa tapahtumien kulkua ratkaisevasti erilaiseen suuntaan. <br />Sen yhteyttä tulevaan tilanteeseen ei välttämättä voida perustella tilastollisesti uskottavalla jatkuvuudella kuten historiallisella aikasarjalla. <br />
  52. 52. 8.10.2009<br />31<br />Heikot signaalit ja tulevaisuudentutkimus<br />Heikkojen signaalien jäljittäminen ja erilaisten ilmiöiden ymmärtäminen heikoiksi signaaleiksi muodostaa yhden haastavimmista tulevaisuudentutkimuksen osa-alueista. <br />Heikon signaalin jäljitys edellyttää useiden erilaisten ilmiöiden tai ilmiöalueiden tuntemusta ja tarkastelua, jossa on erotettava subjektiivisesti ja objektiivisesti uudet ilmiöt. <br />Synonyymi englanninkieliselle termille ”Emergingissues”<br />
  53. 53. 8.10.2009<br />32<br />Villit kortit (wildcards)<br />Yllättävästi ilmaantuvia muutostekijöitä, jotka muuttavat tapahtumisen kehityskulun äkillisesti epävarmaksi. <br />Villin kortin ominaisuudet:<br /><ul><li>sen tapahtumisen todennäköisyys on matala, mutta jos/kun se tapahtuu, sen vaikutukset tulevaan kehitykseen ovat huomattavat.
  54. 54. villillä kortilla ei ole historiaa, ts. sen tapahtumista ei voida ennakoida minkäänlaisten historiallisten tai aikasarjoihin liittyvien ilmiöiden tai lainomaisuuksien avulla. </li></ul>Esimerkki:äkillinen geenimuunnos; maanjäristys; 11.9. WTC, New York<br />
  55. 55. 8.10.2009<br />Megatrendit<br />Megatrendit ovat kehityksen suuria aaltoja tai linjoja ja ilmiöiden tunnistettavia ja havaittavan historian omaavia yhtenäisiä kokonaisuuksia, joilla on selkeä kehityssuunta. <br />Megatrendejä kutsutaan usein myös kriittisiksi trendeiksi.<br />Megatrendit muodostuvat useista samaan suuntaan kehittyvistä trendeistä -- ne ovat ikään kuin trendien kimppuja.<br />Megatrendin määritys tieteellisen täsmällisesti on vaikeaa – pikemminkin ne ovat arkiajattelun työkaluja.<br />
  56. 56. 8.10.2009<br />Megatrendin luonne<br />Megatrendin suuntaa ei voida määritellä pelkästään tarkastelemalla yksittäisiä toimijoita tai tekijöitä, vaan megatrendi on makrotason ilmiöiden ja tapahtumakuvausten laaja kokonaisuus, joka sisältää useita erilaisia ja jopa toisilleen vastakkaisia alailmiöitä ja tapahtumaketjuja. <br />Silti niistä muodostuvalla kokonaisuudella voidaan nähdä oma kehityssuunta, jonka uskotaan usein jatkuvan samansuuntaisesti myös tulevaisuudessa.<br />
  57. 57. MEGATRENDIT<br />ILMENEMISMUODOT, VAIKUTUKSET<br /><ul><li>Verkostoituminen (yhteispeli)‏
  58. 58. Yritys- jakansalaistoiminnan & hallinnontavatjaohjaavatideat
  59. 59. Teknologinenkehitys (the net, tietokoneet)‏
  60. 60. Tietokoneistuminen, bioteknologia, energiateknologiat, verkottuminen, teknologioidenkonvergenssi
  61. 61. Individualismijaprivatisoituminen (the self)‏
  62. 62. Identiteetinjatkuvatekeminen, räätälöidytjabrändätytpalvelut
  63. 63. Monitieteisyysjatieteidenvälisyys
  64. 64. Ongelmienratkaisuunjateorioidenkehittelyyntarvitaanuseidenasiantuntijuuksienjatiedonalojenyhdistelyä
  65. 65. Informaationlisääntyminen, nopeutuminen, reaaliaikais-tuminen, mediallistuminen
  66. 66. Jatkuvainformaationjauutistenvirta, ”pullistuva” nykyhetki, infoähky, elinikäinenoppiminen, näkemystiedonjavalintakriteerientarve
  67. 67. Työnmurros, globalisaatio
  68. 68. Siirtymäteollisestainformaatiovaiheeseen, pätkätyöt, kahdettyömarkkinat, osaamisenuudistumiskierre, glob. tuotantojaraha
  69. 69. Joustavuus, säätelynpurku
  70. 70. Suunnittelutalouksienhajoaminen, kaupanrajojenpoistuminen
  71. 71. Suureneminenjaintegraatio
  72. 72. Alueidenjakulttuurienintegroituminen (EU, tutkinnot)‏
  73. 73. Pieneneminen
  74. 74. Nanoteknologia, mobiili multimedia
  75. 75. Simuloituminen, abstraktisuus
  76. 76. Internet, simulaatiot, rooli- jaelämyspelit, chat
  77. 77. Läpinäkyvyys
  78. 78. Politiikanjatoiminnanavautuminen, subsidiariteettiperiaate
  79. 79. Turvattomuus
  80. 80. Ekologisetuhat, terrorismi, lähiturvattomuus
  81. 81. Globaalietiikka
  82. 82. Kulttuurisetjaideologisetarvokonfliktit
  83. 83. Kestäväkehitys
  84. 84. Ekologisen, sosiaalisenjataloudellisentoiminnanympäristökestävyys</li></ul>Tulevaisuustermitja -metodit<br />
  85. 85. 8.10.2009<br />36<br />Perususkomukset<br /><ul><li>Sellaisiapäätöksenteonjavalintojentaustallavaikuttaviaasioitajailmiöitä, joitaeikyseenalaistapäätöksiätehtäessä.
  86. 86. Toimivatpääosintiedostamattomallatasollavalintojentaustalla.
  87. 87. Ääneenlausumattomia, yhteisestihyväksyttyjä “itsestäänselvyyksiä”.
  88. 88. Eivätkuitenkaanvälttämättäjatkutulevaisuudessa.
  89. 89. Esim. ns. luonnonlait; ajanpalautu-mattomuus; kuolema</li></li></ul><li>8.10.2009<br />37<br />Muutoksen tunnistaminen<br />Nykyisentilanteenanalyysi:<br /><ul><li>Syklit, muutosvoimat, uskomukset
  90. 90. Trendit, megatrendit
  91. 91. Heikotsignaalit
  92. 92. Villitkortit</li></ul>Tarkasteleympäristöäsi<br />Havainnoimahdollisenmuutoksentarve<br />Paikallistamahdollisenmuutoksenlähde<br />Määritäjanimeämahdollinenmuutosilmiö<br />Arvioisentapahtumisentodennäköisyys<br />Monitoroisenkasvua<br />Ennakoisenleviämistä<br />
  93. 93. 8.10.2009<br />38<br />Heikon signaalin / villin kortin muuttuminen trendiksi<br />Esiintymienlukumäärä;<br />ilmiöstätietämisenmäärä<br />globaalistilevinnytilmiö, muuttunuttrendiksija/tai osaksimegatrendiä<br />hallinnon<br />instituutiot<br />useitahavaittujatapauksia, muuttumassatrendiksi<br />sanomalehdet, uutiset, aikakauslehdet<br />tieteenpopulaarilehdet, web-sivut, tv-dokumentit<br />vain paripaikallistatapausta;<br />VILLI KORTTI<br />asiantuntijat, tieteellisetjulkaisutja web-sivut<br />aika<br />tiedemiehet, taiteilijat, radikaalit,hullut<br />
  94. 94. Delfoi -metodi<br />The Delphi method is a systematic, interactive forecasting method which relies on a panel of independent experts. The carefully selected experts answer questionnaires in two or more rounds. <br />After each round, a facilitator provides an anonymous summary of the experts’ forecasts from the previous round as well as the reasons they provided for their judgments. <br />Thus, experts are encouraged to revise their earlier answers in light of the replies of other members of their panel.<br />Wikipedia http://fi.wikipedia.org/wiki/Delfoi-metodi<br />
  95. 95. Tunnusmerkit<br />Asiantuntijuus: oletetaanettäasiantuntijatpääsevätparempaantulokseenkuinsatunnainenjoukkovastaajia<br />Paneli: kommunikatiivinenasiantuntijoistakoostettutiedonmuodostusyhteisö<br />Anonyymisyys: panelistitvastaavatjaargumentoivatanonyymisti, vaikkatietävätketkäkuuluvatpaneliin<br />Iteraatio; delfoissatoteutetaankaksi tai useampiakysely- jaargumentointikierroksia<br />Managerialisuus: tutkimuksenmanagerin tai manageristonrooli on keskeinentutkimuksenkaikissavaiheissa<br />Palaute: panelisaapalautettavastauksistaankierrostenvälissäjamahdollisestimyösaikana<br />
  96. 96. Prosessi<br />Tutkimusongelman ja –tavoitteen määritys (kiistak.)<br />Tutkimusryhmän kokoaminen<br />Pohja- ja esitiedon hankinta (avaininformantit)<br />Asiantuntijoiden valinta ja sitouttaminen (paneli)<br />Kyselylomakkeen laatiminen ja testaus (t-väitteet)<br />Ensimmäinen kierros (lomake tai haastattelu)<br />Analyysi (argumenteista teesejä)<br />Toinen kierros (argumentointi)<br />Analyysi (perustelujen ”kuoriminen”)<br />Kolmas kierros (fokusointi)<br />Analyysi ja raportointi<br />Julkaisu<br />
  97. 97. Kiistakysymys<br /><ul><li>Riitakysymys, kiistakysymys (”a matter that is in dispute between two or more”1)
  98. 98. Julkinenjaratkaisematonkeskusteluaihe (”a vital or unsettled matter”)
  99. 99. Ratkaisuaanodottavaasia, ongelman tai ratkaisunlopputulema (outcome)
  100. 100. (Tulevaisuus)anti, emissio, painos (issue)
  101. 101. Teema (aihepiiri, osio, topic, ”the subject of a discourse or of a section of a discourse”)</li></ul>1 Merriam-Webster´s Collegiate Dictionary. Encyclopaedia Britannica 2005<br />
  102. 102. Väite, arviojaperustelu<br /><ul><li>Tulevaisuusväite, teesi (statement)
  103. 103. Asteikkokysymykset, vuosiarviot, trendiarviot, avoimetkysymykset
  104. 104. Argumentti, syy (argument, reason)
  105. 105. Vasta-argumentti, lisäperustelu</li></li></ul><li>Paneli<br /><ul><li>Asiantuntija (tiedontuottaja): ekspertti (tietää), spesialisti (osaa), generalisti (ymmärtää), maallikko (soveltaa) (vaihtuvat roolit)
  106. 106. Asianosainen (tiedonintressi): kiinnostus, toiminta, sitoutuminen
  107. 107. Argumentoivuusjadialogisuus, katalyyttisyys
  108. 108. Tulevaisuusorientaatio: tulevaisuudentekijä, mahdollisuuksiennäkijä, uhkientunnistaja, sivustaseuraaja (Amaranroolit)</li></li></ul><li>http://www.eDelphi.fi<br />
  109. 109. eDelfoi 3.0<br />
  110. 110.
  111. 111.
  112. 112. Definition of a Scenario:<br /> A scenario is a story with plausible cause and effect links that connects a future condition with the present, while illustrating key decisions, events, and consequences throughout the narrative.<br />
  113. 113. Classic Herman Kahn Scenarios<br />Surprise-free, business-as-usual, reference, base-case scenario is a simple extrapolation of current trends and their interplay<br />Worst case scenario based on mismanagement and bad luck<br />Best case scenario based on good management and good luck.<br />
  114. 114. “Scenario Space”Definedby Axes<br />
  115. 115. 52<br />The world as a systemicmodel<br />
  116. 116. Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  117. 117. Uskomukset</li></ul>Tulevaisuusmetodit<br /><ul><li>Työkalut
  118. 118. Tekniikat</li></ul>Caseja<br /><ul><li>MetsäjaSuomi
  119. 119. Laadullinenennakointi (barometrit)
  120. 120. Ammattikeittiöntulevaisuus
  121. 121. Asiantuntijuus
  122. 122. Pitkätulevaisuus: kolmenäkökulmaa</li></li></ul><li>Valtavirta ja vaihtoehdot – metsäsektorin strategiset valinnat Suomessa<br />Jakob Donner-Amnell<br /> Metsäalan tulevaisuusfoorumi/Joensuun yliopisto<br />
  123. 123. Sisältö<br />Minkälainen Suomen metsäsektorin tilanne/toimintaympäristö on ja millä eväillä metsäsektori voi pärjätä seuraavat 15-20 vuotta?<br />Minkälaiset erilaiset metsäsektoriin vaikuttavat kehityskulut, tekijät ja riskit ovat tällä ajanjaksolla mahdollisia?<br />Minkälaiset tekijät olisi joka tapauksessa syytä huomioida Suomen metsäsektoria koskevissa strategisissa linjauksissa?<br />Tausta<br />Esitys pohjautuu tekeillä olevaan selvitykseen ”Suomen metsäsektorin menestystekijät ennen, nyt ja tulevaisuudessa” ja foorumin muuhunkin työhön<br />Aineistona raportit, haastattelut ja 2-vaiheinen asiantuntijakysely (52 osallistujaa)<br />Johtopäätökset ovat vasta alustavia, tarkennuksia tulevissa julkaisuissa<br />
  124. 124. Haastattelut, <br />selvitykset ym.<br />(ennen ja nyt)<br />Delfoi-kysely<br />(tulevaisuus)<br />Globalisaatio-<br />skenaariot<br />S1..S4<br />Metsäsektorin<br />menestystekijät<br />ennen, nyt ja <br />tulevaisuudessa<br />M1 .. Mn<br />Globalisaatiokehityksen vaihtoehdot ja vaikutukset Suomen metsäsektoriin<br />Globaalikehityksen <br />ennakointi <br />Analyysi Suomen metsäsektorin <br />menestystekijöistä <br />Globalisaation suunta ja metsäalan vaihtoehdot –julkaisu 8/2007<br />
  125. 125. Laaja ja asiantunteva joukko ihmisiä metsäalan sisältä ja liepeiltä osallistui aktiivisesti delfoi-kyselyyn<br />Media - Juha Aaltoila (Maaseudun Tulevaisuus), Antti Blåfield (HS)<br />T&K-toiminta - Markku Auer (VTT), ChristineHagström-Näsi (Tekes), Jukka Kilpeläinen, KCL/ StoraEnso<br />Tutkimus - Kimmo Alajoutsijärvi (OY), Pertti Haaparanta (HKKK), Lauri Hetemäki, (Metla), Ari Jokinen (Pirkanmaan ympäristökeskus), Erno Järvinen (PTT), Markku Kanninen (CIFOR), Paula Kivimaa (SYKE), Kari Lilja (HKKK), Mirja Mikkilä (JoY), Juha Ojala (Oulun kaupunki), Pekka Ollonqvist (Metla), Risto Päivinen (EFI), Ulla Ritola (JoY/Matkailualan verkostoyliopisto), Risto Seppälä (Metla), Annukka Valkeapää (HY)<br />Eturyhmät - Anne Brunila (Metsäteollisuus ry), Simo Jaakkola (Koneyrittäjien liitto), Harri Karjalainen (WWF), Juhani Karvonen (Suomen Metsäyhdistys), Jyrki Ketola (Meto), Ilpo Kuronen (SLL), Markus Lassheikki (MTK), Esa Mäisti (Paperiliitto), Marcus Walsh (BirdLife), <br />Metsäteollisuus - Lars Gädda (M-Real), Pauli Hänninen (UPM), Antti Jääskeläinen (Stora Enso), Jukka-Pekka Ranta (Suomen Sahat)<br />Valtionhallinto - Ilkka Kajaste (VVM), Jouni Lind (MMM), Maarit Lindström (VNK), Liisa Saarenmaa (MMM), Hannes Toivanen (KTM), Pauli Wallenius (Metsähallitus)<br />Konsultointi - Olli Haltia (SavcorIndufor), Heikki Hassi (SciTech-Service Oy), Jyrki Kettunen, Sari Kuvaja, Silja Siitonen (Accenture), Lauri Palojärvi (LIP Consulting), Markku Simula (Ardot), Petri Vasara (Jaakko Pöyry Consulting)<br />Konepajat - Tapani Kiiski (Raute), Pekka Rahkila (Andritz), Markku Salo (Metso), Jouko Yli-Kauppila (Metso)<br />Rahoitus- ja sijoitustoiminta - Harri Taittonen (Nordea)<br />
  126. 126.
  127. 127. Rohkeat panostukset nostivat Suomen metsäsektorin johtavaan asemaan 1980-90-luvuillaMissä nyt mättää – purevatko omat koirat, netti, jenkit vai kiinalaiset?<br />FOKUSOINNILLA ETUMATKAA – JA RISKEJÄKIN<br />Metsäteollisuus Suomessa teki suuren loikan hieno- ja painopaperivetoiseen tuotantorakenteeseen 1970-luvun lopulta alkaen – muissa maissa ei tehty vastaavaa <br />”Painopaperistrategian” osia ovat olleet mm. suuret koneet, korkea tuottavuus, runsas energia, tehokas puunkäyttö, ns. rönsyjen myynti, kansainvälistyminen, kysynnän kasvu, markkinoiden hallinta ja yhteiskunnan tuki<br />Kritiikkiä ja vaikeuksia esiintyi, mutta Suomen metsäsektori pärjäsi silti hyvin 2000-luvulle asti ja metsäyhtiöt kasvoivat johtaviksi alallaan<br />Mistä nykyvaikeudet johtuvat– virhearvioista, USA:sta/dollarista, Suomen kustannustasosta vai maailman metsäsektorin murroksesta?<br />
  128. 128. Suomen metsäklusterin tutkimusstrategia tavoittelee metsäklusterin tuotteiden ja palvelujen arvon kaksinkertaistamista vuoteen 2030 mennessä. Puolet arvosta syntyisi uusista tuotteista.<br />
  129. 129. Kuinka todennäköisenä pidät sitä, että uusien tuotteiden avulla ylletään tuotannon kaksinkertaistamiseen vuoteen 2030 mennessä?(delfoikysely 12/2006, 43 vastaajaa)<br />
  130. 130. MIKSI OMAAN VISIOON EI METSÄSEKTORILLA USKOTA? - alan uusiutumisen esteitä Suomessa:Yrityksille riittävän suuret (=moninkertaiset) lisäpanokset eivät nykytilanteessa ole mahdollisia ja/tai pääoma/huomio on kiinni nykykoneistossa, josta vielä syntyy katettaJulkiselta vallalta ei helpolla liikene merkittävää lisärahoitusta metsäsektorille, ei varsinkaan jos sektorin näkymät eivät selvästi parane eivätkä yhteiskunnalle koituvat hyödyt pysy/kasvaMetsäsektorilla on vakava pula tuoteideoista, joista voisi pian syntyä suuren mittakaavan liiketoimintaa (nykyisiä päälohkoja vastaavaa) – pienempiä ituja toki onMetsäsektorin ja metsäpolitiikan nykyrakenteet ovat osin esteitä uusille mahdollisuuksille, yrityksille ja julkishyödyille metsien käytössä Välitilinpäätös uusiutumisesta:Nykylinja jatkuu Suomessa – osin uusin perusteluin ja mausteinSuurten yritysten päästrategia on kasvu nykytuotteissa muualla<br />
  131. 131. <ul><li>Monet erilaiset kehityskulut ovat mahdollisia
  132. 132. Monet ”metsäsektorin perustulkinnan” keskeiset taustaoletukset – vapaakaupan voittokulku, sääntelyn vähäisyys, energian halpuus, etelän kuidun saatavuus - ovat epävarmalla pohjalla
  133. 133. Maailmassa on näkyvillä monia merkkejä toisenlaisista kehitysurista – mm. nationalismin/regionalismin noususta (Venäjä, Aasia, Etelä-Amerikka), kansainvälisen sääntelyn kasvusta (ilmastopolitiikka), energian/biomassan ja ympäristöasioiden korostumisesta
  134. 134. Jos osa uusista tekijöistä voimistuu, metsäsektorin toimintaympäristö voi muuttua olennaisesti ja alan nykylinja osoittautua riskialttiiksi
  135. 135. Metsäsektorilla onvarauduttava muihinkin kuin ”vanhoihin tuttuihin” haasteisiin ja riskeihin!</li></ul>Maailman ja metsäalan tuleva kehitys: paljonepävarmuutta ja yllätystekijöitä ilmassa<br />
  136. 136. Kotipesä <br />(eristäytyminen)<br />Maailmanparlamentti <br />(globaali sopimuksellisuus)<br />McWorld<br />(taloudellinen avoimuus)<br />Zapatista<br />(tempoilevuus)<br />
  137. 137.
  138. 138. Tarve uudistaa metsäsektoria suuri<br />Markkinahenkiset uudistajat: metsäsektorin mahdollisuudet ovat uusilla markkinoilla ja uudessa liiketoiminnassa, johon on siirrettävä voimavaroja ja jonka tieltä on purettava esteitä. Takertuminen vanhaan on suurin riski.<br />Moniarvoiset:kestävä kehitys korostuu jatkossa, metsäsektori voi pärjätä jos muokkautuu tätä tukevaksi alaksi; metsien käyttöä pitää avartaa ja tuotteiden pitää olla pitkäikäisiä<br />Näkökulma metsäsektoriin<br />liiketaloudellinen<br />Näkökulma metsäsektoriin<br />yhteiskunnallinen<br />Maltilliset kehittäjät:maailma on kova, mutta ennakoitava paikka, Suomen metsäsektori pärjää lisäämällä tehokkuutta, yhteistyötä ja t&k-panoksia<br />Suomi-vetoiset säilyttäjät:toiminta maailmalla on epävarmalla pohjalla, vakaata Suomea on suosittava ja metsäsektorin ”strategiset resurssit” on pidettävä omissa käsissä<br />Tarve uudistaa metsäsektoria pieni<br />
  139. 139. <ul><li>Mihin on syytä jatkossa varautua?
  140. 140. Monilla metsälähtöisillä tuotteilla/hyödyillä on kasvavaa kysyntää maailmalla ja ne voivat olla tärkeitä myös metsäsektorin vetovoiman ja hyväksyttävyyden kannalta
  141. 141. Sekä perinteisiin että uusiin tuotteisiin liittyy myös epävarmuutta (mm. tuotannontekijöistä) ja riskejä
  142. 142. Energia- ja ilmastokysymykset korostuvat ja voivat vaikuttaa syvällisesti metsäsektorin toimintaan; metsä/biomassa voi muuttua ”strategiseksi resurssiksi”
  143. 143. Suomessa voi olla syytä kohdistaa kehityspanoksia ja politiikkaa uudelleen – jotta paremmin näkisimme ”metsän paperilta”
  144. 144. Metsien eri käyttömuotojen yhteensovittaminen on yhä tärkeämpää ja vaatii uusia välineitä – metsien monopolisointia on hillittävä
  145. 145. Metsäsektorin uusiutuminen edellyttää uudenlaista kumppanuutta eri tahojen välillä ja monialaista ennakointia kalliiden riskien/virheiden välttämiseksi</li></ul>Eri kehityskuluista löytyy samojakin tekijöitäOnko Suomella ja metsäsektorilla malttia varautua?<br />
  146. 146.
  147. 147. Suomenpolku 1997<br />
  148. 148. Suomenpolku 2007<br />
  149. 149. Tietoyhteiskunta<br />Tietoyhteiskunnantoteutuminenkärjistääeroamenestyjienjaputoajienvälillä.<br />Tietoyhteiskuntaarakennetaanteknologianmarkkinoijienehdoilla.<br />Tietoverkkojensisällötamerikanisoituvat.<br />Opettajienammatinmerkitystietoyhteiskunnassalisääntyy.<br />Teledemokratianmahdollisuudettoteutuvatensisijassapaikallisellatasolla<br />Tietoverkkojensisällötovatyhäenemmäneurooppalaisia.<br />Tietoyhteiskunnanteknologiaennenmuutaavustaaihmisettiedollista, henkistä, eettistäjaluovaatoimintaa.<br />Tietoyhteiskunnantietoverkkojenulkopuolellejääkokoajankasvavajoukkoihmisiä.<br />Tietotekniikankehitysmahdollistuusiirtymisenedustuksellisestademokratiastakohtisuoraa, osallistuvaa (tele)demokratiaa, jokaperustuutietoverkkojenavullatapahtuvaanjajatkuvastivireilläolevaankansanäänestykseen.<br />Teledemokratianmahdollisuudettoteutuvatensisijassavaltakunnallisellatasolla.<br />Tulevaatietoyhteiskuntaarakennetaanhumanisminjatekniikanyhdistävästänäkökulmastajayhteiskuntavetoisesti.<br />Tietoverkkojensisällötovatyhäenemmänkansallisia, suomalaisia.<br />Tietoyhteiskunnassakannetaanvastuutatietoverkkojenulkopuolellejäävienoikeuksista.<br />
  150. 150. Tietoyhteiskunta<br />
  151. 151. Elinikäinenoppiminen<br />Tulevaisuudessa &quot;poikkiopetussuunnitelmallistentaitojen&quot; kehittäminen (oppimaanoppiminen, sosiaalisettaidot, kommunikaatiotaidot, ongelmanratkaisutaidotjne.) korostuu. <br />Elinikäisenoppimisenperustaavahvistetaanparhaitensiten, ettäkouluttukevatyksilöllisiäoppimistyylejäja -tarpeita.<br />Elinikäisenoppimisentoteutumisenkannaltaolennaista on rohkaisevanjapositiivisenmielipideilmastonsyntyminen.<br />Elinikäisenoppimisentoteuttamiseksilöydetäänuusiayhteistyönmuotojaoppilaiden, heidänperheidensä, opettajien, muunyhteisönjavaltionvälillä.<br />Elinikäisenoppimisenrahoitustoteutuutulevaisuudessaaikaisempaaselvemminyksityisensektorinpanostuksin.<br />Elinikäisenoppimisenkeskeinentaustaideologia on henkilökohtaisenkehittymisenjademokraattistenarvojenvahvistumisenturvaaminen.<br />Pragmaattinen, käytännönläheinennäkökulmatietoonkorostuu: korostetaanaikaisempaaenemmänteoreettisentiedonkäytännöllisensoveltamisenmerkitystä.<br />Elinikäisenoppimisenkeskeinentaustaideologia on innovaatioiden, tuottavuudenjataloudellisenkasvunedistäminen.<br />Elinikäisenoppimisenydinkonteksti on työelämä, työssäoppiminen.<br />Ammatillistenkvalifikaatioidenmittaamisessajavertailussamennäänliiallisuuksiin.<br />Ammatillistenkvalifikaatioidenmittaamisessajavertailussaedistytään.<br />Elinikäinenoppiminenrajautuueliitinyksinoikeudeksi.<br />Elinikäinenoppiminenjäätyhjäksiiskusanaksi.<br />Elinikäisenoppimisenrahoitustoteutuutulevaisuudessaaikaisempaaselvemminjulkisensektorinpanostuksena.<br />
  152. 152. Elinikäinenoppiminen<br />
  153. 153. Avaintaidot<br />Kommunikaatiovalmiudet?<br />Muutoksensietokyky?<br />Oppimiskyky?<br />Ekologisuus?<br />Erilaisuudensietokyky (kulttuurinkompetenssi)?<br />Globaalivastuu- jatulevaisuusajattelu?<br />Ihmissuhdetaitojenosaaminen?<br />Tietointensiivinenammattiosaaminen?<br />Useankielenhallinta?<br />Ammatti- jaalaspesifitietotaito<br />Eettisyys (arvo-osaaminen, tietoinensuhdeideologioihin, uskontoihin)?<br />Tiedeosaaminen?<br />Fyysinenkuntoisuus?<br />&quot;Kädentaidot”<br />Esteettisyys?<br />
  154. 154. Avaintaidot<br />
  155. 155. Sivistys<br />
  156. 156. Viestintäympäristö<br />
  157. 157. Asiantuntijuus?<br /><ul><li>”Nykysuomensanakirjakuvaaasiantuntijantietäjäksi, ”jolla on asiantuntemusta, erikoisia, tavallistaperusteellisempia (ammatti)tietojajoltakinalalta”.
  158. 158. Delfoi-käyttöönsopiihyvinsanakirjantarkentavamääre: ”erikoistuntija, ekspertti, varsinkinkutsuttunaantamaanlausuntonsajostakinalaansakuuluvastaasiasta”. Sanakirjakuvaus on staattinen, mutta Wikipedia ennakoimuutosta.
  159. 159. Murtumastakertoojo se, että Wikipedia määritteleeasiantuntijuuden (expert) muttaEncyclopedia Britannica ei. Wikipediakinlähteeperinteisestisiitä, ettäasiantuntijantunnistaaluotettavantiedon, tekniikan tai taidonhallinnasta. Eksperttiasiantuntija (expert) eroaaspesialistiasiantuntijasta (specialist) siinä, ettäspesialistikykeneeratkaisemaanongelman, kun taaseksperttitietääratkaisun. Ekspertinvastakohta on maallikko (layman) jaspesialistinyleistietäjä (generalist). Wikipediantiedossa on myös, ettäyksilötovatuseinasiantuntijoitajoillakinaloillajamaallikkojatoisilla.
  160. 160. KiinnostavaaWikipedianmäärittelyssä on vihjesiitä, ettäasiantuntijuudenlaadutovatmurroksessa. Täydentävännäkökulmanmukaanasiantuntijuuseienää ole niinkäänyksilönkuinyhteisöjenjaverkostojenominaisuus. Tietoeiperimmiltään ole saavutettavissastaattisenavaan se kiinnittyyerottamattomastisosiokulttuuriseenkehitykseen. Tietäminen (tiedonmuodostus) on sosiaalinenilmiö, joka on sidottuyhteistoimintaan, käytäntöihinjakieleen. </li></ul>Bereiter 2002, 174–210, Tuomi 1999, 411–416)<br />
  161. 161. ”Tower of Test and Generate”<br />Daniel C. Dennettin evoluutiotorni<br />
  162. 162.
  163. 163. Kolme informaatiovirtaa<br />

×