Mamk Delfoi

593 views

Published on

Delfoi -koulutus Mikkelin ammattikorkeakoulun opettajille 15.9.2009

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
593
On SlideShare
0
From Embeds
0
Number of Embeds
5
Actions
Shares
0
Downloads
3
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

Mamk Delfoi

  1. 1. Delfoi, skenaariotjaennakointi<br />Mamk 15.9.2009<br />Hannu Linturi<br />
  2. 2. Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  3. 3. Uskomukset</li></ul>Delfoi– jamuuttulevaisuusmetodit<br /><ul><li>Tunnuspiirteet
  4. 4. Tekniikat</li></ul>Tutkimuksia<br /><ul><li>metsäklusteri (Donner-Amnell), liikenne (Tapio), ennakointi (RD Delfoi, Myllylä), sivistysbarometri (Kuusi, Linturi), työelämä (Kevätsalo), ammattikeittiö (Taskinen), lukio (Linturi, Rubin), heikotsignaalit (Hiltunen & Kuusi & Linturi), biotutkimus (Kuusi)
  5. 5. terveydenhoidonpriorisointi (Luukkainen), lääketurvallisuus (Teinilä), ammatillinenopettajuus (Paaso), viranomaisyhteistyö (Valtonen), meriturvallisuus (Munkki), huumeet (Lintonen), arvoverkot (Palo), valojaääni (Lepoluoto), taitoelää (Soini-Salomaa), mobiiliregulaatio (Laine), metsäyhteistyö (Pirhonen & Miina), metsätulevaisuus (Koskela), taideleikki (Musakka), kollektiivioppijat (Linturi), maailmanmahtavin (Linturi)</li></ul>Pohdittavaa (muuttuvaasiantuntijuus, …)<br />
  6. 6. Näkökulmia …<br /><ul><li> Olisikohan Delfoille käyttöä työyhteisön kehittämisessä?
  7. 7. Tai toimialan konsultaatioissa?
  8. 8. Entäs projekteissa?
  9. 9. Opetuksessa osana PBL:ää tai lopputyötä?
  10. 10. Opettajien jatkotutkinnoissa?
  11. 11. Muussa, missä?</li></li></ul><li>TULEVAISUDEN <br />TUTKIMUSKESKUS<br />
  12. 12. TULEVAISUDEN <br />VERKOSTOAKATEMIA<br />
  13. 13. TULEVAISUDEN <br />TUTKIMUKSEN SEURA<br />
  14. 14. Tofflerilaisetaikakaudet<br />
  15. 15. Wileniuksentulkinta<br />1970<br />2020<br />enemmänjaparempaavähemmästä<br />enemmäntoisenlaistajatoisellatavalla<br />enemmästäenemmän<br />TOIMINTAPERIAATE<br />myöhäisteollinenmurrosaika<br />industrialismi<br />informationalismi<br />TOIMINTALOGIIKKA<br />verkosto-yhteiskunta<br />informaatio-yhteiskunta<br />teollinenyhteiskunta<br />YHTEISKUNTAMALLI<br />- MarkkuWilenius, HannuLinturi 2000<br />
  16. 16. Soft Systems Methodology<br />Peter Checkland, Soft Systems Methodology<br />http://members.tripod.com/SSM_Delphi/ssm4.html <br />
  17. 17. Tulevassaolevanoppiminen<br />Valistuksen aikana tuumittiin, että oppiminen on tietojen haltuunottoa. Ajattelun takana on käsitys, että tieto on jossain olemassa ja joku voi siirtää sitä toisen päähän, jolla tietoa ei vielä ole.<br />”Tänään tämä ei riitä. Vaikka oppimisessa suurin osa on olemassa olevan omaksumista, merkittävä osa oppimisesta alkaa olla tulevan luomista eli tulemassa olevan oppimista. Ihmiselle on sama, oppiiko hän jotain, mitä ei vielä itse tiedä, vai jotain sellaista, mitä ei kukaan tiedä. Oppimisessa on kyse tulevan toiminnan tilan hahmottamisesta.” <br />Ilkka Tuomi 1999 <br />Kotisivu http://www.meaningprocessing.com/ 2009<br />
  18. 18. Paolo Freirejaajanteemat<br />Teematilmaisevatkussakinajassaratkaistaviatehtäviäjaongelmia. Ihmisenhumanisaatioriippuusiitä, kuinkahyvinhänkykeneeratkaisemaanaikakaudenteematjaintegroitumaanajanhenkeen. Aikakaudettäyttyvätsitämukaa, kun ihmisetkäsittävätsenteematjaratkaisevatsentehtävät. Aikojenmurroksessavaihtuvatpaitsiteematmyösajanjärki.<br />Paolo Freire 1970-luvulla<br />
  19. 19. Futurologia<br />Eleonara Masini (1998) jakaa futurologian kolmeen tutkimusalueeseen. Nämä ovat futuresstudyeli tulevaisuuden tutkimus (erikseen kirjoitettuna), futuresresearcheli tulevaisuudentutkimus (yhteen kirjoitettuna) ja erityisesti ranskankielisellä alueella käytetty prospectivestudyeli prospektiivinen tutkimus. Viimeisessä pyritään menneisyyden ymmärtämisen kautta tunnistamaan ja valitsemaan nykyisyydessä joukko todennäköisiä ja toivottavia tulevaisuuksia. <br />Tulevaisuudentutkimus (futuresresearch) tarkoittaa yksinkertaisesti suuntautumista tulevaisuuden tietämiseen ja ymmärtämiseen, ja tulevaisuuden tutkimus (futuresstudy) sellaista tietotoimintaa, joka kattaa kaikki tulevaisuuden intuitiivisen katsomisen, ennustamisen ja inventoinnin muodot utopioista profetioihin. <br />Masini, E. (1998) Futures Research and Sociological Analysis. A draft of discussion. <br />The XIV World Congress of Sociology. The International Sociological Association. RC07 Futures Research. <br />July 16-August 1, 1998. Montreal. Canada.<br />
  20. 20. Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  21. 21. Uskomukset</li></ul>Delfoi– jamuuttulevaisuusmetodit<br /><ul><li>Tunnuspiirteet
  22. 22. Tekniikat</li></ul>Tutkimuksia<br /><ul><li>metsäklusteri (Donner-Amnell), liikenne (Tapio), ennakointi (RD Delfoi, Myllylä), sivistysbarometri (Kuusi, Linturi), työelämä (Kevätsalo), ammattikeittiö (Taskinen), lukio (Linturi, Rubin), heikotsignaalit (Hiltunen & Kuusi & Linturi), biotutkimus (Kuusi)
  23. 23. terveydenhoidonpriorisointi (Luukkainen), lääketurvallisuus (Teinilä), ammatillinenopettajuus (Paaso), viranomaisyhteistyö (Valtonen), meriturvallisuus (Munkki), huumeet (Lintonen), arvoverkot (Palo), valojaääni (Lepoluoto), taitoelää (Soini-Salomaa), mobiiliregulaatio (Laine), metsäyhteistyö (Pirhonen & Miina), metsätulevaisuus (Koskela), taideleikki (Musakka), kollektiivioppijat (Linturi), maailmanmahtavin (Linturi)</li></ul>Pohdittavaa (muuttuvaasiantuntijuus, …)<br />
  24. 24. Tulevaisuusmetodit<br />Futu–menetelmät tähtäävät usein käytännön ratkaisuihin. Tässä suhteessa menetelmiä käytetään enimmäkseen normatiivisesti (normative) eli etsitään tietoa siitä, mikä tulevaisuudentila (futurible) on sekä haluttava että mahdollinen. Menetelmätekniikat sallivat myös puhtaan tutkimuskäytön (exploratory) , jolloin tutkitaan mitä tahansa mahdollisia tulevaisuuksia. <br />Normatiivisuus-tutkimuksellisuus -jaottelun lisäksi tulevaisuusmenetelmät ovat luonteeltaan laadullisia (qualitative) tai määrällisiä (quantitative). Jälkimmäisiä ovat useimmat ekonometriset, systeemiset ja tilastolliset mallinnukset, indeksoinnit ja trendivaikutusanalyysit. Delfoi -tekniikka on laadullinen, mutta mahdollistaa myös ennustetyyppiset kyselytutkimukset, joita usein käytetään varsinkin teknologian diffuusioarvioinneissa (technologyforecasting). <br />Glenn, Jerome G. (2008) Introduction to the Futures Research Methods Series. <br />Futures Research Methodology – V2.0. AC/UNU Millennium Project.<br />
  25. 25. Futures Research Methodology V2.0<br /> 1. Introduction & Overview 15. Simulation and Games<br /> 2. Environmental Scanning 16. Genius Forecasting, Vision, and Int.<br /> 3. Delphi 17. Normative Forecasting<br /> 4. Futures Wheel 18. S&T Road Mapping<br /> 5. Trend Impact Analysis 19. Field Anomaly Relaxation (FAR)<br /> 6. Cross-Impact Analysis 20. Text Mining for Technology Foresight<br /> 7. Structural Analysis 21. Agent Modeling<br /> 8. Systems Perspectives 22. SOFI<br /> 9. Decision Modeling 23. SOFI Software<br />10. Statistical Modeling 24. The Multiple Perspective Concept<br />11. Technological Sequence Analysis 25. Tool Box for Scenario Planning<br />12. Relevance Trees and Morph. Analysis 26. Causal Layered Analysis <br />13. Scenarios 13.5 Interactive Scenarios 27. Integration, Comparisons, and <br />14. Participatory Methods Frontiers of Futures Research Methods<br />
  26. 26. Delfoi -metodi<br />The Delphi method is a systematic, interactive forecasting method which relies on a panel of independent experts. The carefully selected experts answer questionnaires in two or more rounds. <br />After each round, a facilitator provides an anonymous summary of the experts’ forecasts from the previous round as well as the reasons they provided for their judgments. <br />Thus, experts are encouraged to revise their earlier answers in light of the replies of other members of their panel.<br />Wikipedia http://fi.wikipedia.org/wiki/Delfoi-metodi<br />
  27. 27. Tunnusmerkit<br />Asiantuntijuus: oletetaanettäasiantuntijatpääsevätparempaantulokseenkuinsatunnainenjoukkovastaajia<br />Paneeli: kommunikatiivinentiedonmuodostusyhteisö<br />Anonyymisyys: panelistitvastaavatjaargumentoivatanonyymisti<br />Iteraatio; delfoissatoteutetaankaksi tai useampiakysely- jaargumentointikierroksia<br />Managerialisuus: tutkimuksenmanagerin tai manageristoosa on keskeinentutkimuksenkaikissavaiheissa<br />Palaute: paneelisaavatpalautettakierrostenvälissä<br />
  28. 28. Prosessi<br />Tutkimusongelman ja –tavoitteen määritys (kiistak.)<br />Tutkimusryhmän kokoaminen<br />Pohja- ja esitiedon hankinta (avaininformantit)<br />Paneelin valinta ja sitouttaminen (paneli)<br />Kyselylomakkeen laatiminen ja testaus<br />Ensimmäinen kierros (lomake tai haastattelu)<br />Analyysi (argumenteista teesejä)<br />Toinen kierros (argumentointi)<br />Analyysi (perustelujen ”kuoriminen”)<br />Kolmas kierros (fokusointi)<br />Analyysi ja raportointi<br />Julkaisu<br />
  29. 29. Variaatioita<br /><ul><li>ConsensusDelphi(Olaf Helmer)
  30. 30. Technology(quantitative) Delphi
  31. 31. Policy Delphi(Murray Turoff)
  32. 32. Argumentative Delphi(OsmoKuusi): http://www.edelfoi.fi/
  33. 33. DisaggregativeDelphi(Petri Tapio)
  34. 34. Feedback Delphi(YrjöMyllylä)
  35. 35. TechCastDelphihttp://www.techcast.org/
  36. 36. Real Time Delphi(Millennium Project): http://www.edelphi.fi/
  37. 37. Communicative, Dialogical, Structured, Social, …</li></li></ul><li>Disaggregative Delphi<br />P. Tapio: TUTU 2, 17.2.2005<br />
  38. 38. Kiistakysymys<br /><ul><li>Riitakysymys, kiistakysymys (”a matter that is in dispute between two or more”1)
  39. 39. Julkinenjaratkaisematonkeskusteluaihe (”a vital or unsettled matter”)
  40. 40. Ratkaisuaanodottavaasia, ongelman tai ratkaisunlopputulema (outcome)
  41. 41. (Tulevaisuus)anti, emissio, painos (issue)
  42. 42. Teema (aihepiiri, osio, topic, ”the subject of a discourse or of a section of a discourse”)</li></ul>1 Merriam-Webster´s Collegiate Dictionary. Encyclopaedia Britannica 2005<br />
  43. 43. Väite, arviojaperustelu<br /><ul><li>Tulevaisuusväite, teesi (statement)
  44. 44. Asteikkokysymykset, vuosiarviot, trendiarviot, avoimetkysymykset
  45. 45. Argumentti, syy (argument, reason)
  46. 46. Vasta-argumentti, lisäperustelu</li></ul>1<br />1<br />
  47. 47. Delphi approaches<br />P. Tapio: TUTU 2, 17.2.2005<br />
  48. 48. Paneli<br /><ul><li>Asiantuntija (tiedontuottaja): ekspertti (tietää), spesialisti (osaa), generalisti (ymmärtää), maallikko (soveltaa) (vaihtuvat roolit)
  49. 49. Asianosainen (tiedonintressi): kiinnostus, toiminta, sitoutuminen
  50. 50. Argumentoivuusjadialogisuus, katalyyttisyys
  51. 51. Tulevaisuusorientaatio: tulevaisuudentekijä, mahdollisuuksiennäkijä, uhkientunnistaja, sivustaseuraaja (Amaranroolit)</li></li></ul><li>Whatwillyoudowiththe gathered data?<br />? ? ? ? ?<br />Thinkaboutitbeforeyougatherit!<br />Concentrate on statementsorarguments?<br />Gathering of authenticstatements/argumentsorcontentanalysis?<br />Quantitative data? Thinkaboutscales!<br />donotuse 5-Likert (orotherordinalscale) scaleifyoudonothave to<br />useratherintervalscaleorrelativescale<br />useonlyoneortwoscaletypes<br />Feedback from the firstroundmayinclude<br />Answers from the previous round + same questions again<br />Separate report and better questions<br />Each participant’s own answers related to others<br />P. Tapio: TUTU 2, 17.2.2005<br />
  52. 52. WhateverDelphi approachyouchoose …<br />The main problem is to get the panelinvolved, committed and to makethemargue<br />P. Tapio: TUTU 2, 17.2.2005<br />
  53. 53. Delfoi –kehittäjäyhteisö<br />
  54. 54. eDelfoi 3.0<br />
  55. 55. eDelfoi 3.0<br />
  56. 56.
  57. 57.
  58. 58. monologi<br />The Wisdom of Crowds<br /><ul><li>Diversity of opinion: kullakin panelistilla on oma tieto tai tulkinta
  59. 59. Independence: argumentti ei määräydy ensisijaisesti muiden mielipiteistä
  60. 60. Decentralization: ihmiset ovat erikoistuneita ja monen paikkaisia
  61. 61. Aggregation: ryhmittelyn prosessi, joka yhdistää paikallisen ja hajautuneen tiedon (vrt. Tapio)</li></li></ul><li>dialogi ja dialektiikka<br />Kaksinpuhelu, vuoropuhelu, keskustelumuotoinen kirjallinen tuotos (Uusi sivistyssanakirja 1998)<br />Vuorovaikutus muuttaa väistämättömästi ihmisten persoonaa. Tuloksena ei ole kaksi yksilöä vaan eräänlainen dyadi, jossa ihmiset muodostavat yhteisen persoonan: Minä–Sinän (Ich–Du) (Buber)<br />Totuus saavutetaan, kunhan asioista keskustellaan järkiperäisesti ja tarpeeksi kauan. (Habermas)<br />Osapuolet ovat joka hetki valmiita luopumaan omista premisseistään. (Olavi Kivalo)<br />Avoin keskusteleminen kohottaa argumentaation tasoa ja dialektista logiikkaa seuraten nostaa ymmärryksen pelkkiä puheakteja syvemmäksi synteesiksi.<br />Kun dialogi määritellään vuoropuheluksi voidaan todeta dialogin tähtäävän yhteiseen toimintaan löydettyjen päämäärien realisoimiseksi ja esteiden raivaamiseksi muodostaen parhaimmillaan tasa-arvoisen suhteen ihmisten välille (Aarnio 1999). <br />
  62. 62. trialogi<br /><ul><li>The FifthDiscipline: PersonalMastery, MentalModels, Shared Vision, TeamLearning, Systems Thinking
  63. 63. Toimintatutkimus & SSM: The Soft Systems Methodology
  64. 64. Barometrit: tietoyhteiskunta, sivistys</li></ul>World Café<br />
  65. 65. Real Time Delphi (or RT Delphi)<br />It is “round-less” but cumulative and based on feedback <br />a participant can determine how many rounds or times they revise or add responses<br />Every time they come back to the on-line matrix, they can see new comments and ratings entered since they last signed on, and they can see their previous answers in relation to the others. They then have the ability to change their responses<br />Futurists and Planners can use an RT Delphi to:<br />Systemically collect, store, feedback, and rate the best thinking from a range of the best minds that are not easily assembled in a meeting <br />Define and weight criteria for important & controversial decisions<br />Add and rate alternative decision options<br />Provide logic and traceability to decision making<br />RT Delphi makes the approach asynchronous, and efficient<br />
  66. 66. Possible Development <br />Likelihood by 2030 (%) <br />National programs for improving collective intelligence<br /><ul><li>Some richer as well as lower income countries have (by this year of 2030) made improving collective intelligence a national goal; this includes improving individual as well as intelligence for their nations-as-whole.</li></ul>Likelihood by 2030 <br />The average group answer: 63.6 <br />Respondents: 189 <br />Just in time knowledge and learning <br /><ul><li>Rote learning has diminished in importance. With ubiquitous computing and education for life-long learning, 'just in time knowledge' has become the norm. Reasoning, problem solving, and learning strategies form the core focus of public educational systems.</li></ul>Likelihood by 2030 <br />The average group answer: 72.7 <br />Respondents: 181 <br />Individualized education <br /><ul><li>Through tests of various sorts, including simulations, the needs of individual students are being assessed and curricula and instructional methods are tailored to individual students. Twenty years ago this used to be called 'special needs' but now it is recognized that all students have special needs and those needs are being largely met in many places in the world.</li></ul>Likelihood by 2030 <br />The average group answer: 65.0 <br />Respondents: 179 <br />Education and Learning: Possibilities by 2030<br />
  67. 67. The Matrix<br />CODE<br />Criteria in this row<br />Average judgments <br />of the group<br />Number of responses<br /> so far<br />Drop down menu<br />Your response; <br />Red cells mean <br />big difference<br />Place for you to enter <br />reasons and see others<br />Alternate solutions all<br />remaining rows<br />
  68. 68. Definition of a Scenario:<br /> A scenario is a story with plausible cause and effect links that connects a future condition with the present, while illustrating key decisions, events, and consequences throughout the narrative.<br />
  69. 69. Classic Herman Kahn Scenarios<br />Surprise-free, business-as-usual, reference, base-case scenario is a simple extrapolation of current trends and their interplay<br />Worst case scenario based on mismanagement and bad luck<br />Best case scenario based on good management and good luck.<br />
  70. 70. “Scenario Space”Definedby Axes<br />
  71. 71. Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  72. 72. Uskomukset</li></ul>Delfoi– jamuuttulevaisuusmetodit<br /><ul><li>Tunnuspiirteet
  73. 73. Tekniikat</li></ul>Tutkimuksia<br /><ul><li>metsäklusteri (Donner-Amnell), liikenne (Tapio), ennakointi (RD Delfoi, Myllylä), sivistysbarometri (Kuusi, Linturi), työelämä (Kevätsalo), ammattikeittiö (Taskinen), lukio (Linturi, Rubin), heikotsignaalit (Hiltunen & Kuusi & Linturi), biotutkimus (Kuusi)
  74. 74. terveydenhoidonpriorisointi (Luukkainen), lääketurvallisuus (Teinilä), ammatillinenopettajuus (Paaso), viranomaisyhteistyö (Valtonen), meriturvallisuus (Munkki), huumeet (Lintonen), arvoverkot (Palo), valojaääni (Lepoluoto), taitoelää (Soini-Salomaa), mobiiliregulaatio (Laine), metsäyhteistyö (Pirhonen & Miina), metsätulevaisuus (Koskela), taideleikki (Musakka), kollektiivioppijat (Linturi), maailmanmahtavin (Linturi)</li></ul>Pohdittavaa (muuttuvaasiantuntijuus, …)<br />
  75. 75. Valtavirta ja vaihtoehdot – metsäsektorin strategiset valinnat Suomessa<br />Jakob Donner-Amnell<br /> Metsäalan tulevaisuusfoorumi/Joensuun yliopisto<br />
  76. 76. Sisältö<br />Minkälainen Suomen metsäsektorin tilanne/toimintaympäristö on ja millä eväillä metsäsektori voi pärjätä seuraavat 15-20 vuotta?<br />Minkälaiset erilaiset metsäsektoriin vaikuttavat kehityskulut, tekijät ja riskit ovat tällä ajanjaksolla mahdollisia?<br />Minkälaiset tekijät olisi joka tapauksessa syytä huomioida Suomen metsäsektoria koskevissa strategisissa linjauksissa?<br />Tausta<br />Esitys pohjautuu tekeillä olevaan selvitykseen ”Suomen metsäsektorin menestystekijät ennen, nyt ja tulevaisuudessa” ja foorumin muuhunkin työhön<br />Aineistona raportit, haastattelut ja 2-vaiheinen asiantuntijakysely (52 osallistujaa)<br />Johtopäätökset ovat vasta alustavia, tarkennuksia tulevissa julkaisuissa<br />
  77. 77. Haastattelut, <br />selvitykset ym.<br />(ennen ja nyt)<br />Delfoi-kysely<br />(tulevaisuus)<br />Globalisaatio-<br />skenaariot<br />S1..S4<br />Metsäsektorin<br />menestystekijät<br />ennen, nyt ja <br />tulevaisuudessa<br />M1 .. Mn<br />Globalisaatiokehityksen vaihtoehdot ja vaikutukset Suomen metsäsektoriin<br />Globaalikehityksen <br />ennakointi <br />Analyysi Suomen metsäsektorin <br />menestystekijöistä <br />Globalisaation suunta ja metsäalan vaihtoehdot –julkaisu 8/2007<br />
  78. 78. Laaja ja asiantunteva joukko ihmisiä metsäalan sisältä ja liepeiltä osallistui aktiivisesti delfoi-kyselyyn<br />Media - Juha Aaltoila (Maaseudun Tulevaisuus), Antti Blåfield (HS)<br />T&K-toiminta - Markku Auer (VTT), ChristineHagström-Näsi (Tekes), Jukka Kilpeläinen, KCL/ StoraEnso<br />Tutkimus - Kimmo Alajoutsijärvi (OY), Pertti Haaparanta (HKKK), Lauri Hetemäki, (Metla), Ari Jokinen (Pirkanmaan ympäristökeskus), Erno Järvinen (PTT), Markku Kanninen (CIFOR), Paula Kivimaa (SYKE), Kari Lilja (HKKK), Mirja Mikkilä (JoY), Juha Ojala (Oulun kaupunki), Pekka Ollonqvist (Metla), Risto Päivinen (EFI), Ulla Ritola (JoY/Matkailualan verkostoyliopisto), Risto Seppälä (Metla), Annukka Valkeapää (HY)<br />Eturyhmät - Anne Brunila (Metsäteollisuus ry), Simo Jaakkola (Koneyrittäjien liitto), Harri Karjalainen (WWF), Juhani Karvonen (Suomen Metsäyhdistys), Jyrki Ketola (Meto), Ilpo Kuronen (SLL), Markus Lassheikki (MTK), Esa Mäisti (Paperiliitto), Marcus Walsh (BirdLife), <br />Metsäteollisuus - Lars Gädda (M-Real), Pauli Hänninen (UPM), Antti Jääskeläinen (Stora Enso), Jukka-Pekka Ranta (Suomen Sahat)<br />Valtionhallinto - Ilkka Kajaste (VVM), Jouni Lind (MMM), Maarit Lindström (VNK), Liisa Saarenmaa (MMM), Hannes Toivanen (KTM), Pauli Wallenius (Metsähallitus)<br />Konsultointi - Olli Haltia (SavcorIndufor), Heikki Hassi (SciTech-Service Oy), Jyrki Kettunen, Sari Kuvaja, Silja Siitonen (Accenture), Lauri Palojärvi (LIP Consulting), Markku Simula (Ardot), Petri Vasara (Jaakko Pöyry Consulting)<br />Konepajat - Tapani Kiiski (Raute), Pekka Rahkila (Andritz), Markku Salo (Metso), Jouko Yli-Kauppila (Metso)<br />Rahoitus- ja sijoitustoiminta - Harri Taittonen (Nordea)<br />
  79. 79.
  80. 80. Rohkeat panostukset nostivat Suomen metsäsektorin johtavaan asemaan 1980-90-luvuillaMissä nyt mättää – purevatko omat koirat, netti, jenkit vai kiinalaiset?<br />FOKUSOINNILLA ETUMATKAA – JA RISKEJÄKIN<br />Metsäteollisuus Suomessa teki suuren loikan hieno- ja painopaperivetoiseen tuotantorakenteeseen 1970-luvun lopulta alkaen – muissa maissa ei tehty vastaavaa <br />”Painopaperistrategian” osia ovat olleet mm. suuret koneet, korkea tuottavuus, runsas energia, tehokas puunkäyttö, ns. rönsyjen myynti, kansainvälistyminen, kysynnän kasvu, markkinoiden hallinta ja yhteiskunnan tuki<br />Kritiikkiä ja vaikeuksia esiintyi, mutta Suomen metsäsektori pärjäsi silti hyvin 2000-luvulle asti ja metsäyhtiöt kasvoivat johtaviksi alallaan<br />Mistä nykyvaikeudet johtuvat– virhearvioista, USA:sta/dollarista, Suomen kustannustasosta vai maailman metsäsektorin murroksesta?<br />
  81. 81. Mistä murroksessa on kyse?<br /><ul><li>Globaali kustannuskilpailu, korkea tuottovaatimus ja markkinoiden uusjako määräävät pitkälle eteenpäin suunnan metsäsektorilla
  82. 82. Tämän myötä nykyisen tuotannon painopiste siirtyy edullisemman kustannustason ja kasvavien markkinoiden maihin
  83. 83. Tälle kehitykselle ei ole näköpiirissä suurempia esteitä eikä siihen liity merkittäviä riskejä tai epävarmuustekijöitä</li></ul>Mitä on tehtävä?<br /><ul><li>Suomessa/länsimaissa on jatkettava tehostamista/sopeuttamista
  84. 84. Suomessa/länsimaissa uudet tuotteet ja toiminnot ovat ratkaisuna alan menestykseen, vetovoimaan ja hyväksyttävyyteen
  85. 85. Tutkimukseen ja tuotekehitykseen on saatava merkittävästi lisää voimavaroja ja uusia toimintatapoja</li></ul>MUTTA:<br />Uskotaanko tähän tulkintaan ja onko eri tahojen toiminta sen mukaista?<br />Onko maailma nyt ja jatkossa taustaoletusten mukainen? <br />Mitä asioita ja riskejä tulkinta jättää huomiotta ja mitä tästä voi seurata?<br />”Maailman parasta metsäosaamista” – mutta onko sisältö oikea?<br />Metsäsektorin toimijoilla on yhteinen perustulkintatilanteesta ja tarvittavista toimenpiteistä(monista näkemyseroista huolimatta):<br />
  86. 86. Suomen metsäklusterin tutkimusstrategia tavoittelee metsäklusterin tuotteiden ja palvelujen arvon kaksinkertaistamista vuoteen 2030 mennessä. Puolet arvosta syntyisi uusista tuotteista.<br />
  87. 87. Kuinka todennäköisenä pidät sitä, että uusien tuotteiden avulla ylletään tuotannon kaksinkertaistamiseen vuoteen 2030 mennessä?(delfoikysely 12/2006, 43 vastaajaa)<br />
  88. 88. MIKSI OMAAN VISIOON EI METSÄSEKTORILLA USKOTA? - alan uusiutumisen esteitä Suomessa:Yrityksille riittävän suuret (=moninkertaiset) lisäpanokset eivät nykytilanteessa ole mahdollisia ja/tai pääoma/huomio on kiinni nykykoneistossa, josta vielä syntyy katettaJulkiselta vallalta ei helpolla liikene merkittävää lisärahoitusta metsäsektorille, ei varsinkaan jos sektorin näkymät eivät selvästi parane eivätkä yhteiskunnalle koituvat hyödyt pysy/kasvaMetsäsektorilla on vakava pula tuoteideoista, joista voisi pian syntyä suuren mittakaavan liiketoimintaa (nykyisiä päälohkoja vastaavaa) – pienempiä ituja toki onMetsäsektorin ja metsäpolitiikan nykyrakenteet ovat osin esteitä uusille mahdollisuuksille, yrityksille ja julkishyödyille metsien käytössä Välitilinpäätös uusiutumisesta:Nykylinja jatkuu Suomessa – osin uusin perusteluin ja mausteinSuurten yritysten päästrategia on kasvu nykytuotteissa muualla<br />
  89. 89. <ul><li>Monet erilaiset kehityskulut ovat mahdollisia
  90. 90. Monet ”metsäsektorin perustulkinnan” keskeiset taustaoletukset – vapaakaupan voittokulku, sääntelyn vähäisyys, energian halpuus, etelän kuidun saatavuus - ovat epävarmalla pohjalla
  91. 91. Maailmassa on näkyvillä monia merkkejä toisenlaisista kehitysurista – mm. nationalismin/regionalismin noususta (Venäjä, Aasia, Etelä-Amerikka), kansainvälisen sääntelyn kasvusta (ilmastopolitiikka), energian/biomassan ja ympäristöasioiden korostumisesta
  92. 92. Jos osa uusista tekijöistä voimistuu, metsäsektorin toimintaympäristö voi muuttua olennaisesti ja alan nykylinja osoittautua riskialttiiksi
  93. 93. Metsäsektorilla onvarauduttava muihinkin kuin ”vanhoihin tuttuihin” haasteisiin ja riskeihin!</li></ul>Maailman ja metsäalan tuleva kehitys: paljonepävarmuutta ja yllätystekijöitä ilmassa<br />
  94. 94. Kotipesä <br />(eristäytyminen)<br />Maailmanparlamentti <br />(globaali sopimuksellisuus)<br />McWorld<br />(taloudellinen avoimuus)<br />Zapatista<br />(tempoilevuus)<br />
  95. 95.
  96. 96. Tarve uudistaa metsäsektoria suuri<br />Markkinahenkiset uudistajat: metsäsektorin mahdollisuudet ovat uusilla markkinoilla ja uudessa liiketoiminnassa, johon on siirrettävä voimavaroja ja jonka tieltä on purettava esteitä. Takertuminen vanhaan on suurin riski.<br />Moniarvoiset:kestävä kehitys korostuu jatkossa, metsäsektori voi pärjätä jos muokkautuu tätä tukevaksi alaksi; metsien käyttöä pitää avartaa ja tuotteiden pitää olla pitkäikäisiä<br />Näkökulma metsäsektoriin<br />liiketaloudellinen<br />Näkökulma metsäsektoriin<br />yhteiskunnallinen<br />Maltilliset kehittäjät:maailma on kova, mutta ennakoitava paikka, Suomen metsäsektori pärjää lisäämällä tehokkuutta, yhteistyötä ja t&k-panoksia<br />Suomi-vetoiset säilyttäjät:toiminta maailmalla on epävarmalla pohjalla, vakaata Suomea on suosittava ja metsäsektorin ”strategiset resurssit” on pidettävä omissa käsissä<br />Tarve uudistaa metsäsektoria pieni<br />
  97. 97. <ul><li>Mihin on syytä jatkossa varautua?
  98. 98. Monilla metsälähtöisillä tuotteilla/hyödyillä on kasvavaa kysyntää maailmalla ja ne voivat olla tärkeitä myös metsäsektorin vetovoiman ja hyväksyttävyyden kannalta
  99. 99. Sekä perinteisiin että uusiin tuotteisiin liittyy myös epävarmuutta (mm. tuotannontekijöistä) ja riskejä
  100. 100. Energia- ja ilmastokysymykset korostuvat ja voivat vaikuttaa syvällisesti metsäsektorin toimintaan; metsä/biomassa voi muuttua ”strategiseksi resurssiksi”
  101. 101. Suomessa voi olla syytä kohdistaa kehityspanoksia ja politiikkaa uudelleen – jotta paremmin näkisimme ”metsän paperilta”
  102. 102. Metsien eri käyttömuotojen yhteensovittaminen on yhä tärkeämpää ja vaatii uusia välineitä – metsien monopolisointia on hillittävä
  103. 103. Metsäsektorin uusiutuminen edellyttää uudenlaista kumppanuutta eri tahojen välillä ja monialaista ennakointia kalliiden riskien/virheiden välttämiseksi</li></ul>Eri kehityskuluista löytyy samojakin tekijöitäOnko Suomella ja metsäsektorilla malttia varautua?<br />
  104. 104. HSE: Cemat<br />
  105. 105. “Tärkeintäei ole päämäärävaanliike(nne)”<br />
  106. 106. GDP, Road traffic and CO2fromroadtraffic in Finland in 1970-1996. Howabout the future?<br />P. Tapio: TUTU 2, 17.2.2005<br />
  107. 107. Fourteeninterestgroups<br />AKTTransport Workers’ Federation<br />AL Automobile and Touring Club of Finland<br />DODO Dodo-The Living Nature of the Future<br />ENE Traffic Policy Association Majority<br />LILI Traffic League<br />LM Ministry of Transport and Communications<br />LAL Bus Transport Federation<br />RHK Finnish Rail Administration<br />STY Finnish Road Association<br />TT The Confederation of Finnish Industry and Employers<br />TL Finnish Road Administration<br />YM Ministry of the Environment<br />YTV* Helsinki Metropolitan Area Council /Transport. Dept.<br />ÖKKL* Finnish Oil and Gas Federation<br />P. Tapio: TUTU 2, 17.2.2005<br />
  108. 108. Delphi withtworounds<br />Round I: Questionnaire<br />drawing the lines for probable and preferablefutures of GDP, roadtrafficvolume and CO2 emissions<br />writingdownopenarguments for ’why’ and ’how’<br />Round II: Interview<br />aspects of a thematic as well as a structuredinterview<br />quantitativeestimates of the keyfactors, and qualitativearguments for ’why’ and ’how’<br />openquestions, counter-arguments<br />P. Tapio: TUTU 2, 17.2.2005<br />
  109. 109. Feedback in the case<br />P.Tapio TUTU 2, 18.2.2005<br />
  110. 110. Arguments…<br />Arguments for the upper curves<br />public transport should be supported without restricting passenger car traffic<br />the freedom for private car use should not be restricted <br />the growth of CO2 emissions can be stopped with technical development<br />P.Tapio TUTU 2, 18.2.2005<br />
  111. 111. … arguments …<br />Arguments for the middle curves<br />the growth potential of passenger car traffic should be guided towards soft modes, public transport and telecommunications<br />urban infill is preferable to reduce the need for traffic<br />traffic is a mean, not an end itself, economy and communication should be handled with low need for traffic<br />economic growth should be achieved by electronic industry and services, which would reduce the growth rate of freight transport in relation to GDP<br />P.Tapio TUTU 2, 18.2.2005<br />
  112. 112. …arguments<br />Arguments for the lower curves<br />telecommunications will and should substitute physical traffic<br />local more non-material economy is preferable<br />railroads should be emphasised in both passenger traffic and freight transport<br />CO2 emissions should be reduced 60-80% from today’s level to stop climate change, which is not possible without also reducing road traffic volume<br />P.Tapio TUTU 2, 18.2.2005<br />
  113. 113. Clusteranalysis<br />Groupingthe responses to clusters<br />Preferableas well as probablefutures of the threekeyvariables<br />GDP, roadtrafficvolume, CO2emissionsfromroadtraffic<br />Qualitativecontentanalysis<br />are the arguments for the responseswithin a clustersimilar?<br />P.Tapio TUTU 2, 18.2.2005<br />
  114. 114. Lisätääntalouskasvu …<br />P.Tapio: Tärkeintäei ole päämäärävaanliike(nne)<br />67<br />13.9.2009<br />
  115. 115. Lisätäänlin. ekstrapolointi …<br />P.Tapio: Tärkeintä ei ole päämäärä vaan liike(nne)<br />68<br />13.9.2009<br />
  116. 116. Lisätääneksp. ekstrapolointi …<br />P.Tapio: Tärkeintä ei ole päämäärä vaan liike(nne)<br />69<br />13.9.2009<br />
  117. 117. Lisätäänilm.muutoksenrajoitustavoite (IPCC 2007) <br />P.Tapio: Tärkeintä ei ole päämäärä vaan liike(nne)<br />P.Tapio: Tärkeintä ei ole päämäärä vaan liike(nne)<br />13.9.2009<br />
  118. 118. Lisätäänpidempiaikasarja1860-2050 …<br />öljy<br />Source: CDIAC & IEA & IPCC<br />71<br />13.9.2009<br />
  119. 119. Tarttistehräjotainmuttamitä?<br />Dematerialisaatio: Pienennetäänpäästöjä per materiaalinentuotanto, esim.<br />CO2 / sähköntuotanto<br />CO2 / henkilöliikenteenmäärä<br />Immaterialisaatio: Pienennetäänmateriaalistatuotantoa per BKT, esim.<br />Sähköntuotanto / BKT<br />Henkilöliikenteenmäärä / BKT<br />PienennetäänBKT:ta<br />13.9.2009<br />P.Tapio: Tärkeintä ei ole päämäärä vaan liike(nne)<br />72<br />P.Tapio: Tärkeintä ei ole päämäärä vaan liike(nne)<br />
  120. 120. 73<br />
  121. 121. SWOT ja painotukset<br />DELFOI INNOVAATIOMENETELMÄNÄ - ESIMERKKINÄ SWOT-SOVELTAMINEN<br />74<br />
  122. 122. SWOT-innovaatio<br />Varsinais-Suomen TKTT-prosessin ja<br />Delfoi-sovelluksen vaiheet:<br />1. krs: 32 yritystä haastateltu v. 2006<br />2. krs: asiantuntijaraati 27.2.2007, n. 20 osanottajaa: SWOT -aiheiden tuottaminen<br />3. krs: eDelfoi, SWOT-arvottaminen ja kehittäminen maaliskuu 2007(= 2. SWOT-kierros)<br />DELFOI INNOVAATIOMENETELMÄNÄ - ESIMERKKINÄ SWOT-SOVELTAMINEN<br />75<br />
  123. 123. VAHVUUDET: 2. SWOT-kierros<br />DELFOI INNOVAATIOMENETELMÄNÄ - ESIMERKKINÄ SWOT-SOVELTAMINEN<br />76<br />
  124. 124.
  125. 125. Suomenpolku 1997<br />
  126. 126. Suomenpolku 2007<br />
  127. 127. Tietoyhteiskunta<br />Tietoyhteiskunnantoteutuminenkärjistääeroamenestyjienjaputoajienvälillä.<br />Tietoyhteiskuntaarakennetaanteknologianmarkkinoijienehdoilla.<br />Tietoverkkojensisällötamerikanisoituvat.<br />Opettajienammatinmerkitystietoyhteiskunnassalisääntyy.<br />Teledemokratianmahdollisuudettoteutuvatensisijassapaikallisellatasolla<br />Tietoverkkojensisällötovatyhäenemmäneurooppalaisia.<br />Tietoyhteiskunnanteknologiaennenmuutaavustaaihmisettiedollista, henkistä, eettistäjaluovaatoimintaa.<br />Tietoyhteiskunnantietoverkkojenulkopuolellejääkokoajankasvavajoukkoihmisiä.<br />Tietotekniikankehitysmahdollistuusiirtymisenedustuksellisestademokratiastakohtisuoraa, osallistuvaa (tele)demokratiaa, jokaperustuutietoverkkojenavullatapahtuvaanjajatkuvastivireilläolevaankansanäänestykseen.<br />Teledemokratianmahdollisuudettoteutuvatensisijassavaltakunnallisellatasolla.<br />Tulevaatietoyhteiskuntaarakennetaanhumanisminjatekniikanyhdistävästänäkökulmastajayhteiskuntavetoisesti.<br />Tietoverkkojensisällötovatyhäenemmänkansallisia, suomalaisia.<br />Tietoyhteiskunnassakannetaanvastuutatietoverkkojenulkopuolellejäävienoikeuksista.<br />
  128. 128. Tietoyhteiskunta<br />
  129. 129. Elinikäinenoppiminen<br />Tulevaisuudessa &quot;poikkiopetussuunnitelmallistentaitojen&quot; kehittäminen (oppimaanoppiminen, sosiaalisettaidot, kommunikaatiotaidot, ongelmanratkaisutaidotjne.) korostuu. <br />Elinikäisenoppimisenperustaavahvistetaanparhaitensiten, ettäkouluttukevatyksilöllisiäoppimistyylejäja -tarpeita.<br />Elinikäisenoppimisentoteutumisenkannaltaolennaista on rohkaisevanjapositiivisenmielipideilmastonsyntyminen.<br />Elinikäisenoppimisentoteuttamiseksilöydetäänuusiayhteistyönmuotojaoppilaiden, heidänperheidensä, opettajien, muunyhteisönjavaltionvälillä.<br />Elinikäisenoppimisenrahoitustoteutuutulevaisuudessaaikaisempaaselvemminyksityisensektorinpanostuksin.<br />Elinikäisenoppimisenkeskeinentaustaideologia on henkilökohtaisenkehittymisenjademokraattistenarvojenvahvistumisenturvaaminen.<br />Pragmaattinen, käytännönläheinennäkökulmatietoonkorostuu: korostetaanaikaisempaaenemmänteoreettisentiedonkäytännöllisensoveltamisenmerkitystä.<br />Elinikäisenoppimisenkeskeinentaustaideologia on innovaatioiden, tuottavuudenjataloudellisenkasvunedistäminen.<br />Elinikäisenoppimisenydinkonteksti on työelämä, työssäoppiminen.<br />Ammatillistenkvalifikaatioidenmittaamisessajavertailussamennäänliiallisuuksiin.<br />Ammatillistenkvalifikaatioidenmittaamisessajavertailussaedistytään.<br />Elinikäinenoppiminenrajautuueliitinyksinoikeudeksi.<br />Elinikäinenoppiminenjäätyhjäksiiskusanaksi.<br />Elinikäisenoppimisenrahoitustoteutuutulevaisuudessaaikaisempaaselvemminjulkisensektorinpanostuksena.<br />
  130. 130. Elinikäinenoppiminen<br />
  131. 131. Avaintaidot<br />Kommunikaatiovalmiudet?<br />Muutoksensietokyky?<br />Oppimiskyky?<br />Ekologisuus?<br />Erilaisuudensietokyky (kulttuurinkompetenssi)?<br />Globaalivastuu- jatulevaisuusajattelu?<br />Ihmissuhdetaitojenosaaminen?<br />Tietointensiivinenammattiosaaminen?<br />Useankielenhallinta?<br />Ammatti- jaalaspesifitietotaito<br />Eettisyys (arvo-osaaminen, tietoinensuhdeideologioihin, uskontoihin)?<br />Tiedeosaaminen?<br />Fyysinenkuntoisuus?<br />&quot;Kädentaidot”<br />Esteettisyys?<br />
  132. 132. Avaintaidot<br />
  133. 133. Sivistys<br />
  134. 134. Viestintäympäristö<br />
  135. 135. Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  136. 136. Uskomukset</li></ul>Delfoi– jamuuttulevaisuusmetodit<br /><ul><li>Tunnuspiirteet
  137. 137. Tekniikat</li></ul>Tutkimuksia<br /><ul><li>metsäklusteri (Donner-Amnell), liikenne (Tapio), ennakointi (RD Delfoi, Myllylä), sivistysbarometri (Kuusi, Linturi), työelämä (Kevätsalo), ammattikeittiö (Taskinen), lukio (Linturi, Rubin), heikotsignaalit (Hiltunen & Kuusi & Linturi), biotutkimus (Kuusi)
  138. 138. terveydenhoidonpriorisointi (Luukkainen), lääketurvallisuus (Teinilä), ammatillinenopettajuus (Paaso), viranomaisyhteistyö (Valtonen), meriturvallisuus (Munkki), huumeet (Lintonen), arvoverkot (Palo), valojaääni (Lepoluoto), taitoelää (Soini-Salomaa), mobiiliregulaatio (Laine), metsäyhteistyö (Pirhonen & Miina), metsätulevaisuus (Koskela), taideleikki (Musakka), kollektiivioppijat (Linturi), maailmanmahtavin (Linturi)</li></ul>Pohdittavaa (muuttuvaasiantuntijuus, …)<br />
  139. 139.
  140. 140.
  141. 141.
  142. 142.
  143. 143.
  144. 144.
  145. 145.
  146. 146. Teemat<br />Tulevaisuusorientaatio<br /><ul><li>Yhteisöt
  147. 147. Uskomukset</li></ul>Delfoi– jamuuttulevaisuusmetodit<br /><ul><li>Tunnuspiirteet
  148. 148. Tekniikat</li></ul>Tutkimuksia<br /><ul><li>metsäklusteri (Donner-Amnell), liikenne (Tapio), ennakointi (RD Delfoi, Myllylä), sivistysbarometri (Kuusi, Linturi), työelämä (Kevätsalo), ammattikeittiö (Taskinen), lukio (Linturi, Rubin), heikotsignaalit (Hiltunen & Kuusi & Linturi), biotutkimus (Kuusi)
  149. 149. terveydenhoidonpriorisointi (Luukkainen), lääketurvallisuus (Teinilä), ammatillinenopettajuus (Paaso), viranomaisyhteistyö (Valtonen), meriturvallisuus (Munkki), huumeet (Lintonen), arvoverkot (Palo), valojaääni (Lepoluoto), taitoelää (Soini-Salomaa), mobiiliregulaatio (Laine), metsäyhteistyö (Pirhonen & Miina), metsätulevaisuus (Koskela), taideleikki (Musakka), kollektiivioppijat (Linturi), maailmanmahtavin (Linturi)</li></ul>Pohdittavaa (muuttuvaasiantuntijuus, …)<br />
  150. 150. Asiantuntijuus?<br /><ul><li>”Nykysuomensanakirjakuvaaasiantuntijantietäjäksi, ”jolla on asiantuntemusta, erikoisia, tavallistaperusteellisempia (ammatti)tietojajoltakinalalta”.
  151. 151. Delfoi-käyttöönsopiihyvinsanakirjantarkentavamääre: ”erikoistuntija, ekspertti, varsinkinkutsuttunaantamaanlausuntonsajostakinalaansakuuluvastaasiasta”. Sanakirjakuvaus on staattinen, mutta Wikipedia ennakoimuutosta.
  152. 152. Murtumastakertoojo se, että Wikipedia määritteleeasiantuntijuuden (expert) muttaEncyclopedia Britannica ei. Wikipediakinlähteeperinteisestisiitä, ettäasiantuntijantunnistaaluotettavantiedon, tekniikan tai taidonhallinnasta. Eksperttiasiantuntija (expert) eroaaspesialistiasiantuntijasta (specialist) siinä, ettäspesialistikykeneeratkaisemaanongelman, kun taaseksperttitietääratkaisun. Ekspertinvastakohta on maallikko (layman) jaspesialistinyleistietäjä (generalist). Wikipediantiedossa on myös, ettäyksilötovatuseinasiantuntijoitajoillakinaloillajamaallikkojatoisilla.
  153. 153. KiinnostavaaWikipedianmäärittelyssä on vihjesiitä, ettäasiantuntijuudenlaadutovatmurroksessa. Täydentävännäkökulmanmukaanasiantuntijuuseienää ole niinkäänyksilönkuinyhteisöjenjaverkostojenominaisuus. Tietoeiperimmiltään ole saavutettavissastaattisenavaan se kiinnittyyerottamattomastisosiokulttuuriseenkehitykseen. Tietäminen (tiedonmuodostus) on sosiaalinenilmiö, joka on sidottuyhteistoimintaan, käytäntöihinjakieleen. (Bereiter 2002, 174–210, Tuomi 1999, 411–416) </li></li></ul><li>MEGATRENDIT<br />ILMENEMISMUODOT, VAIKUTUKSET<br /><ul><li>Verkostoituminen (yhteispeli)‏
  154. 154. Yritys- jakansalaistoiminnan & hallinnontavatjaohjaavatideat
  155. 155. Teknologinenkehitys (the net, tietokoneet)‏
  156. 156. Tietokoneistuminen, bioteknologia, energiateknologiat, verkottuminen, teknologioidenkonvergenssi
  157. 157. Individualismijaprivatisoituminen (the self)‏
  158. 158. Identiteetinjatkuvatekeminen, räätälöidytjabrändätytpalvelut
  159. 159. Monitieteisyysjatieteidenvälisyys
  160. 160. Ongelmienratkaisuunjateorioidenkehittelyyntarvitaanuseidenasiantuntijuuksienjatiedonalojenyhdistelyä
  161. 161. Informaationlisääntyminen, nopeutuminen, reaaliaikais-tuminen, mediallistuminen
  162. 162. Jatkuvainformaationjauutistenvirta, ”pullistuva” nykyhetki, infoähky, elinikäinenoppiminen, näkemystiedonjavalintakriteerientarve
  163. 163. Työnmurros, globalisaatio
  164. 164. Siirtymäteollisestainformaatiovaiheeseen, pätkätyöt, kahdettyömarkkinat, osaamisenuudistumiskierre, glob. tuotantojaraha
  165. 165. Joustavuus, säätelynpurku
  166. 166. Suunnittelutalouksienhajoaminen, kaupanrajojenpoistuminen
  167. 167. Suureneminenjaintegraatio
  168. 168. Alueidenjakulttuurienintegroituminen (EU, tutkinnot)‏
  169. 169. Pieneneminen
  170. 170. Nanoteknologia, mobiili multimedia
  171. 171. Simuloituminen, abstraktisuus
  172. 172. Internet, simulaatiot, rooli- jaelämyspelit, chat
  173. 173. Läpinäkyvyys
  174. 174. Politiikanjatoiminnanavautuminen, subsidiariteettiperiaate
  175. 175. Turvattomuus
  176. 176. Ekologisetuhat, terrorismi, lähiturvattomuus
  177. 177. Globaalietiikka
  178. 178. Kulttuurisetjaideologisetarvokonfliktit
  179. 179. Kestäväkehitys
  180. 180. Ekologisen, sosiaalisenjataloudellisentoiminnanympäristökestävyys</li></ul>Tulevaisuustermitja -metodit<br />
  181. 181. Arvauksia oppimisen lähitulevaisuuteen …<br /><ul><li>sisällötovatautenttistadataa, omaakonstruktiota ja interaktiota
  182. 182. sisällötpooliutuvat, standardisoituvat ja avautuvat(tietokannat)
  183. 183. oppimisenmuistivaraisiatoimintoja ”ulkoistetaan” (apu- ja tekoäly)
  184. 184. vuorovaikutustaharjoitellaan ja dokumentoidaan (yhteisömuisti)
  185. 185. kehitetäänvälineitäinformaationjalostukseen (datametodit), ja
  186. 186. merkitystenluomiseen (identiteettimetodit)
  187. 187. subjektinevoluutiojatkuu (yksilö –ryhmä – yhteisö – kulttuuri)
  188. 188. jatkuvatrajanylityksetpurkavatmoderninmatriisinjäykkyydet</li></li></ul><li>
  189. 189. ”Tower of Test and Generate”<br />Daniel C. Dennettin evoluutiotorni<br />
  190. 190. Herakleitos (535-474 eaa)<br />Ajasta: ”Ei ole mahdollista astua kahta kertaa samaan virtaan, sillä kaikki koko ajan hajoaa ja yhdistyy ja lähenee ja loittonee.”<br />Ristiriidasta: ’Vastaanhangoitteleva yhteensopiva’ syntyy niistä voimista, jotka pyrkivät eri suuntiin, mutta jotka kuitenkin liittyvät yhteen. Tästä liitosta kehittyy kaunein harmonia.<br />Harmoniasta: Herakleitos sätti ihmisiä, jotka eivät ymmärrä, miten siinä missä vedetään eri suuntiin, ollaankin sopusoinnussa. Arvokas harmonia on ’vastahakoista’ ja jännitteistä kuin jousi tai lyyra. <br />Paradoksista: Maailman kehityksen melodiana on vastakkaisuuksien ryskyminen ja sulautuminen. Kaiken muuttumisen taustalla on kuitenkin pyrkimys homeostasikseen eli tasapainoon. <br />

×