UNIVERSIDAD EL BOSQUE<br />DIVISION DE POSTGRADOS DE ODONTOLOGIA<br />BIOLOGIA MOLECULAR.<br />SECUENCIA GENETICA DE LA EP...
Pagina de resultados de busqueda con palabra clave monoamine oxidase, donde se eligio el resultado  4 .<br />
Cuarto  resultado secuencia  completa.<br />
Secuencia de RNAm y la traduccón a proteína.<br />
SECUENCIA DE AMINOACIDOS.<br />
Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein.<br />
1 gggcgctcccggagtatcagcaaaagggttcgccccgcccacagtgcccggctccccccg<br />       61 ggtatcaaaagaaggatcggctccgcccccgggctccccggggg...
481 tgtcaaggggaaaacatatccatttcggggcgcctttccaccagtatggaatcccattgc<br />      541 atatttggattacaataatctgtggaggacaatagataacat...
961 ccatgaacattatgagtgcaaatacgtaattaatgcgatccctccgaccttgactgccaa<br />     1021 gattcacttcagaccagagcttccagcagagagaaaccagtt...
    1441 aagggtgattcgtcaacccgtgggcaggattttctttgcgggcacagagactgccacaaa<br />     1501 gtggagcggctacatggaaggggcagttgaggctgga...
1921 aaagaatcacctaattaatttcagtaagatcaagctccatcttatttgtcagtgtagatc<br />     1981 aactcatgttaattgatagaataaagccttgtgatcacttt...
2401 tagtctcagtgctagcttatttgtatttttcctctttcacttcttatggaggagagtgtt<br />     2461 taactgagttagaatgttgaaactgacttgctgtgacttat...
    2881 gcaagctcacttgctttagttgttaagttttataaaagacatgaaattgagtcattttat<br />     2941 atatgaaaactaagttctctatcttaggagtaatgtc...
3361 tccctagtctattgcagttgtttctattagcttactgattaactcagtcctgacacacct<br />     3421 tttgggaaatgctgatttaaacttcttaactggcaacagtt...
3841 gtcccagttaactgttaaataaggcctcatcctccactgaagagtatggattgaaggatt<br />     3901 gtgaactatgtttagtgtgattgtgaacttggtgcctaatg...
NOMBRES Y ABREVIATURAS DE LOS AMINOACIDOS ESTANDAR.<br />
SECUENCIA DE AMINOACIDOS DE LA EPINFEFRINA.<br />monoamine oxidase A<br /> [Homo sapiens]<br />
1 menqekasiaghmfdvvvigggisglsaakllteygvsvlvleardrvggrtytirnehv<br />       61 dyvdvggayvgptqnrilrlskelgietykvnvserlvqyvkgk...
menqekasiaghmfdvvvigggisglsaakllteygvsvlvleardrvggrtytirnehv<br />Aug-gaa-gac-ggg-gaa-gcc-agc-auc-ggc. <br />gga-cac-aug-u...
531 AMINOACIDOS  X   3   ---------------   1593  CODONES<br />531 AMINOACIDOS ------------------------- RNAm (LECTURA)<br />
BIBLIOGRAFIA<br />http://www.ncbi.nlm.nih.gov/nuccore/212549708/?report=graph&content=5&from=469&to=100192<br />http://www...
UNIVERSIDAD EL BOSQUE<br />DIVISION DE POSTGRADOS DE ODONTOLOGIA<br />BIOLOGIA MOLECULAR.<br />IMPORTANCIA CLINICA DE LA E...
<ul><li>La adrenalina, también llamada epinefrina en su sustitutivo sintético.
Hormonavasoactiva secretada en situaciones de alerta por las glándulas suprarrenales.
 Es una mono amina catecolamina, simpaticomimética derivada de los aminoácidosfenilalanina y tirosina.</li></li></ul><li>
<ul><li>Pertenece al grupo de las catecolaminas, sustancias que tienen un grupo catecol y un radical amino.
Son sintetizadas a partir del aminoácidotirosina.
Las catecolaminas actúan, en general, sobre el sistema nervioso simpático.</li></li></ul><li>SECRECION.<br /><ul><li>Las f...
La formación de la adrenalina se realiza a partir de la noradrenalina, utilizando la ruta común que usan todas las catecol...
Aumentar el ritmo cardíaco.
Dilata la pupila para tener una mejor visión.
Aumenta la respiración, por lo que se ha usado como medicamento contra el asma.</li></li></ul><li>Síntesis de las Catecola...
EPINEFRINA.<br /><ul><li>Composición</li></ul>Epinefrina cada ampolla de 1 ml contiene 1 mg de clorhidrato de epinefrina. ...
 Indicaciones<br /><ul><li>Colapso circulatorio agudo
Resucitación cardiopulmonar
Broncoespasmo
Reacciones anafilácticas
Shock, hipotensión
Hemorragias abundantes.
Reducción de la presión intraocular en el     glaucoma simple e hipoglicemia por shock insulínico</li></li></ul><li><ul><l...
La mayor parte de los efectos adversos afectan al sistema cardiovascular: vasoconstricción periférica, hipertensión, hemor...
Upcoming SlideShare
Loading in …5
×

Epinefrina, señalizacion, odontología

3,775 views

Published on

Vias de señalizacion epinefrina

  • Be the first to comment

  • Be the first to like this

Epinefrina, señalizacion, odontología

  1. 1. UNIVERSIDAD EL BOSQUE<br />DIVISION DE POSTGRADOS DE ODONTOLOGIA<br />BIOLOGIA MOLECULAR.<br />SECUENCIA GENETICA DE LA EPINEFRINA.<br />Integrantes:<br />Arboleda Nicolás<br />Durán Gabriel<br />Fernández Rodrigo<br />Palmet Sara<br />Rey David<br />
  2. 2. Pagina de resultados de busqueda con palabra clave monoamine oxidase, donde se eligio el resultado 4 .<br />
  3. 3. Cuarto resultado secuencia completa.<br />
  4. 4. Secuencia de RNAm y la traduccón a proteína.<br />
  5. 5.
  6. 6. SECUENCIA DE AMINOACIDOS.<br />
  7. 7.
  8. 8. Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein.<br />
  9. 9. 1 gggcgctcccggagtatcagcaaaagggttcgccccgcccacagtgcccggctccccccg<br /> 61 ggtatcaaaagaaggatcggctccgcccccgggctccccgggggagttgatagaagggtc<br /> 121 cttcccaccctttgccgtccccactcctgtgcctacgacccaggagcgtgtcagccaaag<br /> 181 catggagaatcaagagaaggcgagtatcgcgggccacatgttcgacgtagtcgtgatcgg<br /> 241 aggtggcatttcaggactatctgctgccaaactcttgactgaatatggcgttagtgtttt<br /> 301 ggttttagaagctcgggacagggttggaggaagaacatatactataaggaatgagcatgt<br /> 361 tgattacgtagatgttggtggagcttatgtgggaccaacccaaaacagaatcttacgctt<br /> 421 gtctaaggagctgggcatagagacttacaaagtgaatgtcagtgagcgtctcgttcaata<br />
  10. 10. 481 tgtcaaggggaaaacatatccatttcggggcgcctttccaccagtatggaatcccattgc<br /> 541 atatttggattacaataatctgtggaggacaatagataacatggggaaggagattccaac<br /> 601 tgatgcaccctgggaggctcaacatgctgacaaatgggacaaaatgaccatgaaagagct<br /> 661 cattgacaaaatctgctggacaaagactgctaggcggtttgcttatctttttgtgaatat<br /> 721 caatgtgacctctgagcctcacgaagtgtctgccctgtggttcttgtggtatgtgaagca<br /> 781 gtgcgggggcaccactcggatattctctgtcaccaatggtggccaggaacggaagtttgt<br /> 841 aggtggatctggtcaagtgagcgaacggataatggacctcctcggagaccaagtgaagct<br /> 901 gaaccatcctgtcactcacgttgaccagtcaagtgacaacatcatcatagagacgctgaa<br />
  11. 11. 961 ccatgaacattatgagtgcaaatacgtaattaatgcgatccctccgaccttgactgccaa<br /> 1021 gattcacttcagaccagagcttccagcagagagaaaccagttaattcagcggcttccaat<br /> 1081 gggagctgtcattaagtgcatgatgtattacaaggaggccttctggaagaagaaggatta<br /> 1141 ctgtggctgcatgatcattgaagatgaagatgctccaatttcaataaccttggatgacac<br /> 1201 caagccagatgggtcactgcctgccatcatgggcttcattcttgcccggaaagctgatcg<br /> 1261 acttgctaagctacataaggaaataaggaagaagaaaatctgtgagctctatgccaaagt<br /> 1321 gctgggatcccaagaagctttacatccagtgcattatgaagagaagaactggtgtgagga<br /> 1381 gcagtactctgggggctgctacacggcctacttccctcctgggatcatgactcaatatgg<br />
  12. 12. 1441 aagggtgattcgtcaacccgtgggcaggattttctttgcgggcacagagactgccacaaa<br /> 1501 gtggagcggctacatggaaggggcagttgaggctggagaacgagcagctagggaggtctt<br /> 1561 aaatggtctcgggaaggtgaccgagaaagatatctgggtacaagaacctgaatcaaagga<br /> 1621 cgttccagcggtagaaatcacccacaccttctgggaaaggaacctgccctctgtttctgg<br /> 1681 cctgctgaagatcattggattttccacatcagtaactgccctggggtttgtgctgtacaa<br /> 1741 atacaagctcctgccacggtcttgaagttctgttcttatgctctctgctcactggttttc<br /> 1801 aataccaccaagaggaaaatattgacaagtttaaaggctgtgtcattgggccatgtttaa<br /> 1861 gtgtactggatttaactacctttggcttaattccaatcattgttaaagtaaaaacaattc<br />
  13. 13. 1921 aaagaatcacctaattaatttcagtaagatcaagctccatcttatttgtcagtgtagatc<br /> 1981 aactcatgttaattgatagaataaagccttgtgatcactttctgaaattcacaaagttaa<br /> 2041 acgtgatgtgctcatcagaaacaatttctgtgtcctgtttttattcccttcaatgcaaaa<br /> 2101 tacatgatgatttcagaaacaaagcatttgactttctgtctgtggaggtggagtaggtga<br /> 2161 aggcccagcctgtaactgtcctttttcttcccttaggcaatggtgaactgtcattacaga<br /> 2221 gcctagaggctcacagcctcctggaggaagcagcctccactttggatcaggaaatagtaa<br /> 2281 aggaaagcagtgttgggggtagcggcatgcagaccctcagaccagaatggggacatcttg<br /> 2341 tggtctgctgcctcaggaatctcctgaccacttgtagtccctccgacttctctagacatc<br />
  14. 14. 2401 tagtctcagtgctagcttatttgtatttttcctctttcacttcttatggaggagagtgtt<br /> 2461 taactgagttagaatgttgaaactgacttgctgtgacttatgtgcagctttccagttgag<br /> 2521 cagaggaaaatagtggcaggactgtcccccaggaggactccctgcttagctctgtgggag<br /> 2581 accaactacgactggcatcttctcttccccctggaaggcagctagacaccaatggatcct<br /> 2641 tgtcagttgtaacattctatttcaacttcaggaaagcagcagttttcttttaatttttcc<br /> 2701 tatgaccataaaattagacatacctctcaacttacatatgtcttcaacatggttacctct<br /> 2761 gcataaatattagcaaagcatgccaatttctcttaagtactgaaatacatatgataaatt<br /> 2821 tgactgttatttgttgagactatcaaacagaaaagaaattagggctctaatttccttaaa<br />
  15. 15. 2881 gcaagctcacttgctttagttgttaagttttataaaagacatgaaattgagtcattttat<br /> 2941 atatgaaaactaagttctctatcttaggagtaatgtcggcccacaagggtgcccacctct<br /> 3001 tgttttccccttttaaaaactcagatttttaaaagccctttccaaaggtttcaactgtaa<br /> 3061 aatacttctttttacaatgtatcaacatatttttatttaaggggaattaacaattgccag<br /> 3121 ggaaaccagccaacccaagtttattatatcattaaccttatcataaattcaaacctaagt<br /> 3181 tgctggaccctggtgtgaggacataaatcttccaaagttttgcctatcctaagagctgca<br /> 3241 tttttctactgctctttaccttgcattttagctaatttaggagttttgagaatgtattgg<br /> 3301 atacgctccagtacataaggagttgccgcatattatatcagactgctttgagaaatctca<br />
  16. 16. 3361 tccctagtctattgcagttgtttctattagcttactgattaactcagtcctgacacacct<br /> 3421 tttgggaaatgctgatttaaacttcttaactggcaacagttggaacagtaatcagtttgc<br /> 3481 taacatatttaaagtcttgaatgttgaagaactcatgtgatttacccttttcaacttttt<br /> 3541 ggaaaacgatttaatttattctaattagattaaccctattaatctatggattgggtatca<br /> 3601 aaatgaatgccagtccagatgtgcctagacacgaaattggagctgaggactctcacgata<br /> 3661 tgcaagttcatccaacgtgaagataccataagctttttctctgaaccagagaaatgaaag<br /> 3721 tcagtttaagaggctgatagatcttggccctgttaaggcatccacttcacagttctgaag<br /> 3781 gctgagtcagccccactccacagttaggccaagaattagattttaaaacttcatctgtct<br />
  17. 17. 3841 gtcccagttaactgttaaataaggcctcatcctccactgaagagtatggattgaaggatt<br /> 3901 gtgaactatgtttagtgtgattgtgaacttggtgcctaatgttccatgtctgaagtttgc<br /> 3961 cccagtgctacacgttggagtatacctatgtgtgtgctttgccactgaagtaagattttg<br /> 4021 cctgtatggtactgttttgtttgttaataaagtgcactgccacccccaatgcaaaaaaaa<br /> 4081 aaaaaaaaaa<br />
  18. 18. NOMBRES Y ABREVIATURAS DE LOS AMINOACIDOS ESTANDAR.<br />
  19. 19.
  20. 20.
  21. 21. SECUENCIA DE AMINOACIDOS DE LA EPINFEFRINA.<br />monoamine oxidase A<br /> [Homo sapiens]<br />
  22. 22. 1 menqekasiaghmfdvvvigggisglsaakllteygvsvlvleardrvggrtytirnehv<br /> 61 dyvdvggayvgptqnrilrlskelgietykvnvserlvqyvkgktypfrgafppvwnpia<br /> 121 yldynnlwrtidnmgkeiptdapweaqhadkwdkmtmkelidkicwtktarrfaylfvni<br /> 181 nvtsephevsalwflwyvkqcggttrifsvtnggqerkfvggsgqvserimdllgdqvkl<br /> 241 nhpvthvdqssdniiietlnhehyeckyvinaipptltakihfrpelpaernqliqrlpm<br /> 301 gavikcmmyykeafwkkkdycgcmiiededapisitlddtkpdgslpaimgfilarkadr<br /> 361 laklhkeirkkkicelyakvlgsqealhpvhyeeknwceeqysggcytayfppgimtqyg<br /> 421 rvirqpvgriffagtetatkwsgymegaveageraarevlnglgkvtekdiwvqepeskd<br /> 481 vpaveithtfwernlpsvsgllkiigfstsvtalgfvlykykllprs<br />
  23. 23. menqekasiaghmfdvvvigggisglsaakllteygvsvlvleardrvggrtytirnehv<br />Aug-gaa-gac-ggg-gaa-gcc-agc-auc-ggc. <br />gga-cac-aug-uuu-gac-guu-guu-guu-auc-gga.<br />Gga-gga-auc-agc-gga-uua-cua-ggc-gga-agc-ggc-ggc<br />gga-gga-aca-gaa-uau-gga-gug-agc-gug-gga<br />gug-gga-gaa-ggc-cgc-gac-cgc-gug-gga-gga. <br />Cgc-aca-uac-aca-auc-cgc-gac-gaa-cac-guu.<br />RNAm.<br />
  24. 24. 531 AMINOACIDOS X 3 --------------- 1593 CODONES<br />531 AMINOACIDOS ------------------------- RNAm (LECTURA)<br />
  25. 25.
  26. 26. BIBLIOGRAFIA<br />http://www.ncbi.nlm.nih.gov/nuccore/212549708/?report=graph&content=5&from=469&to=100192<br />http://www.ncbi.nlm.nih.gov/nucleotide/33469954<br />
  27. 27. UNIVERSIDAD EL BOSQUE<br />DIVISION DE POSTGRADOS DE ODONTOLOGIA<br />BIOLOGIA MOLECULAR.<br />IMPORTANCIA CLINICA DE LA EPINEFRINA.<br />Integrantes:<br />Arboleda Nicolás<br />Durán Gabriel<br />Fernández Rodrigo<br />Palmet Sara<br />Rey David<br />
  28. 28. <ul><li>La adrenalina, también llamada epinefrina en su sustitutivo sintético.
  29. 29. Hormonavasoactiva secretada en situaciones de alerta por las glándulas suprarrenales.
  30. 30. Es una mono amina catecolamina, simpaticomimética derivada de los aminoácidosfenilalanina y tirosina.</li></li></ul><li>
  31. 31. <ul><li>Pertenece al grupo de las catecolaminas, sustancias que tienen un grupo catecol y un radical amino.
  32. 32. Son sintetizadas a partir del aminoácidotirosina.
  33. 33. Las catecolaminas actúan, en general, sobre el sistema nervioso simpático.</li></li></ul><li>SECRECION.<br /><ul><li>Las fibras preganglionares llegan hasta el ganglio celíaco sin hacer sinapsis en él, desde donde siguen hasta la médula suprarrenal. Sus axones llegan a las células, que contienen vesículas que almacenan adrenalina. La adrenalina se segrega a la sangre y se distribuye a través del torrente circulatorio.
  34. 34. La formación de la adrenalina se realiza a partir de la noradrenalina, utilizando la ruta común que usan todas las catecolaminas, como dopamina, L-dopa, noradrenalina y adrenalina. </li></li></ul><li>EFECTOS.<br /><ul><li>Aumentar la tensión arterial.
  35. 35. Aumentar el ritmo cardíaco.
  36. 36. Dilata la pupila para tener una mejor visión.
  37. 37. Aumenta la respiración, por lo que se ha usado como medicamento contra el asma.</li></li></ul><li>Síntesis de las Catecolaminas a partir de la Tirosina.<br />
  38. 38.
  39. 39. EPINEFRINA.<br /><ul><li>Composición</li></ul>Epinefrina cada ampolla de 1 ml contiene 1 mg de clorhidrato de epinefrina. <br />
  40. 40. Indicaciones<br /><ul><li>Colapso circulatorio agudo
  41. 41. Resucitación cardiopulmonar
  42. 42. Broncoespasmo
  43. 43. Reacciones anafilácticas
  44. 44. Shock, hipotensión
  45. 45. Hemorragias abundantes.
  46. 46. Reducción de la presión intraocular en el glaucoma simple e hipoglicemia por shock insulínico</li></li></ul><li><ul><li>Efectos adversos.
  47. 47. La mayor parte de los efectos adversos afectan al sistema cardiovascular: vasoconstricción periférica, hipertensión, hemorragia cerebral, edema pulmonar, taquicardia, bradicardia refleja, arritmia cardíaca, angina y palpitaciones. En raras ocasiones se presenta mareo, anorexia, náusea y vómito.
  48. 48. Dosis.</li></ul> La vía intravenosa se emplea solo para resucitación cardiorespiratoria, paro cardíaco y colapso. La vía subcutánea o intramuscular se emplea en reacciones anafilácticas agudas y broncoespasmo.<br />
  49. 49. EFFECTS OF DENTAL LOCAL ANAESTHETICS IN CARDIAC TRANSPLANT RECIPIENTS<br />Meechan JG, Parry G<br />Dent. J. 2002 feb 9; 192(3):161-3<br />
  50. 50. <ul><li>Objective </li></ul> To investigate the cardiovascular responses of cardiac<br /> transplant recipients to dental local anaesthetic solutions with and withoutepinephrine (adrenaline).<br /><ul><li>Materials and methods</li></ul> A clinical study employing 30 patients (20 cardiac transplant recipients and ten healthy) awaiting gingival or minor oral surgery under local anaesthesia receiving either 4.4 ml lidocaine(lignocaine) with 1:80,000 epinephrine or 4.4 ml 3% prilocaine with 0.03IU/ml felypressin.<br />
  51. 51. Results<br />Cardiactransplantpatientsexperienced a significanttachycardia 10 minutes after injection of the epinephrine-containing solution. No significant change in heart rate was detected after the injection of an epinephrine-free solution. Blood pressure was not affected. Periodontal surgery did not affect the responses to the local anaesthetics in the transplant recipients.<br />Conclusions <br /> The cardiovascular response to dental local anaesthesia in cardiac transplant recipients is governed by the solution injected.<br />
  52. 52. UNIVERSIDAD EL BOSQUE<br />DIVISION DE POSTGRADOS DE ODONTOLOGIA<br />BIOLOGIA MOLECULAR.<br />SEÑALIZACION TRANSMEMBRANAL DE LA ADRENALINA.<br />Integrantes:<br />Arboleda Nicolás<br />Durán Gabriel<br />Fernández Rodrigo<br />Palmet Sara<br />Rey David<br />
  53. 53. RECEPTORES ADRENERGICOS (ADRENORECEPTORES)<br />
  54. 54. RECEPTORES ADRENERGICOS (ADRENORECEPTORES)<br />
  55. 55.
  56. 56.
  57. 57.
  58. 58. BIBLIOGRAFIA.<br />Mechanisms of disease: beta-adrenergicreceptors--alterations in signaltransduction and pharmacogenomics in heartfailure<br />Alterations in adrenergic receptor signaling in heartfailure<br />Pharmacology and physiology of humanadrenergic receptor polymorphisms<br />Linkage of beta1-adrenergic stimulationtoapoptoticheartcelldeaththroughproteinkinase A-independentactivation of Ca2+/calmodulinkinase II<br />Induction of beta3-adrenergic receptor functionalexpressionfollowingchronicstimulationwithnoradrenaline in neonatal ratcardiomyocytes<br />Gainingrespectability: membrane-delimited, caveolar-restrictedactivation of ion channels<br />Pharmacology and physiology of humanadrenergic receptor polymorphisms<br />Recentprogress in alpha1-adrenergic receptor research<br />Thealpha(2a)-adrenergic receptor plays a protective role in mouse behavioralmodels of depression and anxiety<br />In vivo gene modificationelucidatessubtype-specificfunctions of alpha(2)-adrenergicreceptors<br />Alpha1-adrenergic receptors and theirsignificancetochemical-inducednephrotoxicity--a briefreview<br />Alpha1-adrenergic receptors: new insights and directions<br />Adrenoceptors and signal transduction in neurons, Received: 22 May 2006 / Accepted: 13 June 2006 / Published online: 1 August 2006<br />

×