RoXaN, une nouvelle protéine cellulaire
interagissant avec la protéine
non-structurale NSP3 du Rotavirus
Pierre Lindenbaum...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Impact du Rotavirus dans le monde
40% des enfants diarrhéïques de moins
de 5 ans.
300 000 000 $ en frais d'hospitalisation...
1
2
3
4
5
6
9
10
11
7
8
VP4
VP7
VP2
VP6
CORE
Protéine
VP1
VP2
VP3
VP4
NSP1
VP6
NSP3
NSP2
VP7
NSP4
NSP5, NSP6
Segmentd'ARNd...
c
c
c
c
c
c
c
c
c
Noyau
VP1
VP2
VP3
VP4
VP6
NSP1
VP7
NSP2
NSP3
NSP4
NSP5
c
c
VIROPLASME
Traduction des
protéines Virales.
...
Comparaison des ARNm viraux / cellulaires
AUGUGACC 3'Coiffe ORF
ARNm viraux
NSP3
AAAAAAAAAA 3'Coiffe ORF
ARNm cellulaires
...
La protéine Non-Structurale NSP3
Liaison à l'ARN Liaison à l'eIF4G
Région "coiled-coil"
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Rappels sur le Double Hybride
Milieu Leu-Trp-His-
Milieu Leu-Trp-His-
• Les Protéines X et Y interagissent:
• Les Protéine...
Double Hybride et transactivation
Liaison
à l'ADN
GAL4
X
UAS HIS
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
P
|
P
|
eIF4G
4E
PABP
AAAAAAAAAAA
4A
40 SeIF3
m7G
AUG
MnKI
Erk1, Erk2, p38
AAU
MAPK +
FRAP/mTOR
4E
4E-BP4E-BP
eIF4GI est l...
NSP3 interagit avec eIF4G
GAL4
Domaine
activateur
eIF4GI
m88-
NSP3Liaison
à l'ADN
GAL4
Déplacement de la PABP par NSP3
4G
4A 4E
Cellules infectées
NSP3 déplace la PABP de EIF4G et permet la
traduction des ARN ...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Découverte de RoXaN-1
GAL4
Domaine
activateur
eIF4GI
m88-
NSP3Liaison
à l'ADN
GAL4
GAL4
Domaine
activateur
RoXaN-I
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Northern Blot de RoXaN-1
6kb
28S
18S
Northern Blot RoXaN-1
sur ARNm
de cellules MA104
Reconstitution de l'ADNc de RoXaN
RoXaN1 1274 pb
RoXaN2 2370 pb
RoXaN 5742pb
KIAA1031
Chromosome 22 (AL035659)
ESTAI28132
...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
RoXaN
5742pb
977 Acides Aminés (110 kd)
Palindrome 20
bases
LDALD
359
LDALD
336
"coiled-coil"
900-977
TPR
82-115
Doigt
de ...
RoXaN est ubiquitaire dans les tissus.
RT-PCR Elisa réalisée sur différents tissus en utilisant KIAA1031comme amorce
(proj...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Recherche d'un sérum dirigé contre RoXaN
Expression de RoXaN-1 par le système Bac-to-Bac
Expression de RoXaN-1 par le syst...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
NSP3-HisTag
NSP3-
9011NHisTag
PABPHisTag
- + - + - +plasmide seul: traduction in vitro
RoXaN1 traduite in vitro + - + - + ...
NSP3
50 kD
(Chaines lourdes
des Ig)
25kD
(chaines légères
des Ig)
Western Blot anti-NSP3
monoclonal
Transfection FLAG-RoXa...
50 kD
25kD
Western Blot anti-FLAG(RoXaN1)
Infection: Rotavirus
Transfection FLAG-RoXaN1
Immunoprécipitation
RoXaN1
RoXaN1
...
EcoRI
|
PvuII
|
CloneIt: Obtention de deletions en phase
RoXaN1Coiled
coils
(156-241)
Interaction
avec RoXaN1
en double-
hybride
NSP3A
3154
A2881
1784
A3294
163
A9005
4 150
A9011N...
Délimitation de la zone d'interaction
NSP3-RoXaN (2/2)
TPR NSP3
977
|
1
|
Interaction avec NSP3
en double-hybrideRoXaN
m88...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
pGBT9 / pYX212 / pGAD424
pGBT9-NSP3 / pYX212 / pGAD424-NSP3
pGBT9-EIF4G/ pYX-NSP3 / pGAD424-RoXaN1
pGBT9-EIF4G/ pYX-NSP3 /...
EIF4G
Transfection FLAG-RoXaN1
Infection Rotavirus
Immunoprécipitation
Lysat
de
cellules
infectées
Lysat
de
cellules
non
i...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Crible de RoXaN en double-hybride
RoXaN1
Liaison
à l'ADN
GAL4
GAL4
Domaine
activateur
p170/
eIF3
TPRde
RoXaN
Liaison
à l'A...
1
2
3
4
5
6
7
8
Appât:pGBT9 Proie:GAD424
1 m88NSP3 RoXaN1
2 pGBT9 GAD424
3 TPR GAD-424
4 TPR NSP2
5 TPR p170
6 p170 GAD-42...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Les motifs TPR (Tetratricopeptide)
Organismes
Fonctions diverses
Compartiments
Bactéries, champignons, plantes, animaux
Cy...
Les 3 motifs TPR de la PP5
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Un homologue de RoXaN chez la drosophile
Score = 62.8 bits (150), Expect = 9e-10
Identities = 43/146 (29%), Positives = 69...
Un homologue de RoXaN
dans le chromosome 16
humain
Query: 69 QVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSXXXXXXXXXXXXXYINR ...
eIF4G
4E
PABP
AAAAAAAAAAA
4A
40 SeIF3
m7G
AUG
AAU
Rôle de l'eIF3
4G
4E
5'Cap
PABP
AAAAAAAAAAAA 3'
4G
4E
4G
4E
5'Cap
PABP
AUG
PABP
AAAAAAAAAAAA 3'
En présence de poly(A) et
de coiffe, la P...
Introduction
Rotavirus
L'initiation de la traduction
Résultats
RoXaN
Reconstitution
Analyse de la séquence de RoXaN
Intera...
Perspectives
Purification de RoXaN
Rôle de RoXaN
Obtention d'un sérum dirigé contre RoXaN
Animaux "Knock-out"
Effets sur l...
Remerciements
Didier Poncet, Maria Gajardo, Nathalie Castagne, Patrice Vende,
Annie Charpilienne, Jean Cohen.
et beaucoup ...
Upcoming SlideShare
Loading in …5
×

RoXaN, une nouvelle protéine cellulaire interagissant avec la protéine non-structurale NSP3 du Rotavirus

2,353 views

Published on

My Thesis Presentation (2000°

Published in: Technology
0 Comments
1 Like
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
2,353
On SlideShare
0
From Embeds
0
Number of Embeds
108
Actions
Shares
0
Downloads
19
Comments
0
Likes
1
Embeds 0
No embeds

No notes for slide

RoXaN, une nouvelle protéine cellulaire interagissant avec la protéine non-structurale NSP3 du Rotavirus

  1. 1. RoXaN, une nouvelle protéine cellulaire interagissant avec la protéine non-structurale NSP3 du Rotavirus Pierre Lindenbaum 9 Juin 2000 Directeur de thèse: Dr. Didier PONCET. INRA/VIM/Laboratoire de Biologie Moléculaire des Rotavirus 78352 Jouy-en-Josas CEDEX
  2. 2. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  3. 3. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  4. 4. Impact du Rotavirus dans le monde 40% des enfants diarrhéïques de moins de 5 ans. 300 000 000 $ en frais d'hospitalisation aux U.S.A. Impact agronomique 1 000 000 décès/an Principale cause des gastro-entherites d'origine virale touchant les jeunes mammifères.
  5. 5. 1 2 3 4 5 6 9 10 11 7 8 VP4 VP7 VP2 VP6 CORE Protéine VP1 VP2 VP3 VP4 NSP1 VP6 NSP3 NSP2 VP7 NSP4 NSP5, NSP6 Segmentd'ARNdb Structure du Rotavirus
  6. 6. c c c c c c c c c Noyau VP1 VP2 VP3 VP4 VP6 NSP1 VP7 NSP2 NSP3 NSP4 NSP5 c c VIROPLASME Traduction des protéines Virales. Réplication. c RETICULUM Le cycle du Rotavirus
  7. 7. Comparaison des ARNm viraux / cellulaires AUGUGACC 3'Coiffe ORF ARNm viraux NSP3 AAAAAAAAAA 3'Coiffe ORF ARNm cellulaires PABP
  8. 8. La protéine Non-Structurale NSP3 Liaison à l'ARN Liaison à l'eIF4G Région "coiled-coil"
  9. 9. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  10. 10. Rappels sur le Double Hybride Milieu Leu-Trp-His- Milieu Leu-Trp-His- • Les Protéines X et Y interagissent: • Les Protéines X et Y n'interagissent pas: Liaison à l'ADN GAL4 X GAL4 Domaine activateur Y UAS HIS Levure Leu- Trp- His- APPÂT PROIE
  11. 11. Double Hybride et transactivation Liaison à l'ADN GAL4 X UAS HIS
  12. 12. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  13. 13. P | P | eIF4G 4E PABP AAAAAAAAAAA 4A 40 SeIF3 m7G AUG MnKI Erk1, Erk2, p38 AAU MAPK + FRAP/mTOR 4E 4E-BP4E-BP eIF4GI est le support de l'initiation de la traduction
  14. 14. NSP3 interagit avec eIF4G GAL4 Domaine activateur eIF4GI m88- NSP3Liaison à l'ADN GAL4
  15. 15. Déplacement de la PABP par NSP3 4G 4A 4E Cellules infectées NSP3 déplace la PABP de EIF4G et permet la traduction des ARN m viraux 5'Cap NSP3 AUGUGACC 3' ARN viral 4G 4A 4E Cellules non infectées Traduction des ARNm polyadénylés. 5'Cap PABPARN cellulaire eIF4F AAAAAAAAAAAA 3' PABP NSP3
  16. 16. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  17. 17. Découverte de RoXaN-1 GAL4 Domaine activateur eIF4GI m88- NSP3Liaison à l'ADN GAL4 GAL4 Domaine activateur RoXaN-I
  18. 18. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  19. 19. Northern Blot de RoXaN-1 6kb 28S 18S Northern Blot RoXaN-1 sur ARNm de cellules MA104
  20. 20. Reconstitution de l'ADNc de RoXaN RoXaN1 1274 pb RoXaN2 2370 pb RoXaN 5742pb KIAA1031 Chromosome 22 (AL035659) ESTAI28132 AI927120 (Humaine)
  21. 21. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  22. 22. RoXaN 5742pb 977 Acides Aminés (110 kd) Palindrome 20 bases LDALD 359 LDALD 336 "coiled-coil" 900-977 TPR 82-115 Doigt de Zinc 886-915Région Hydrophobe 271-325
  23. 23. RoXaN est ubiquitaire dans les tissus. RT-PCR Elisa réalisée sur différents tissus en utilisant KIAA1031comme amorce (projet HUGE) unité: fg d'ADN/ng d'ARN poly(A).
  24. 24. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  25. 25. Recherche d'un sérum dirigé contre RoXaN Expression de RoXaN-1 par le système Bac-to-Bac Expression de RoXaN-1 par le système pET Expression de RoXaN-1 par le système GEX Immunisation par un peptide Immunisation par RoXaN-1 purifiée
  26. 26. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  27. 27. NSP3-HisTag NSP3- 9011NHisTag PABPHisTag - + - + - +plasmide seul: traduction in vitro RoXaN1 traduite in vitro + - + - + - RoXaN1traduiteinvitro Protéine fixée aux billes RoXaN1 69Kd - 46Kd - 30Kd - RoXaN interagit avec NSP3 in vitro NSP3HisHisHisHis RoXaN S35
  28. 28. NSP3 50 kD (Chaines lourdes des Ig) 25kD (chaines légères des Ig) Western Blot anti-NSP3 monoclonal Transfection FLAG-RoXaN1 Infection:rotavirus Immuno Précipitation Anti-FLAG Anti-NSP1 Lysat de cellules infectées Lysat de cellules non- infectées Western Blot anti-NSP3 FLAG RoXaN-1 NSP3 NSP3 co-immunoprécipite avec RoXaN-1 in vivo
  29. 29. 50 kD 25kD Western Blot anti-FLAG(RoXaN1) Infection: Rotavirus Transfection FLAG-RoXaN1 Immunoprécipitation RoXaN1 RoXaN1 Stu Lysat trans- fecté RoXaN 1 -FLAG infecté Lysat infecté RoXaN1 Stu NSP3NSP1NSP3 NSP3 NSP3 NSP1 FLAG RoXaN-1 NSP3 NSP3 co-immunoprécipite avec RoXaN-1 in vivo
  30. 30. EcoRI | PvuII | CloneIt: Obtention de deletions en phase
  31. 31. RoXaN1Coiled coils (156-241) Interaction avec RoXaN1 en double- hybride NSP3A 3154 A2881 1784 A3294 163 A9005 4 150 A9011N 4 204 206 A9011C A9012N 4 240 A9020 163 293 A9012C 241 NSP3 Domaine de Liaison à l'ARN (4-149) Domaine de Liaison à eIF4GI/II 206-313) Interaction avec RoXaN1 in vitro n.d. n.d. n.d. n.d. n.d. n.d. n.d. RoXaN1 en GAD (proie) RoXaN1 en pGBT9 (appât) Met88 88 n.d. n.d. n.d. n.d. n.d. (1) interagit aussi avec GAD-RoXaN2 (1) Délimitation de la zone d'interaction NSP3-RoXaN (1/2)
  32. 32. Délimitation de la zone d'interaction NSP3-RoXaN (2/2) TPR NSP3 977 | 1 | Interaction avec NSP3 en double-hybrideRoXaN m88.NSP3 clonée en pGBT9 (Appât) NSP3 clonée en GAD (Proie) n.d. n.d. n.d. n.d. n.d. n.d. n.d. n.d. n.d. RoXaN2 763 | n.d. 30 | 135 | RoXaN1 StuI 163 | 343 |RoXaN1 Eco109 82 | 398 | 149 | 135 | pGBT9 RoXaN1 SacIIStuI pGBT9 RoXaN1 SacIIStuI Sma 103070/103071174 | 144 | 103060/103063 265 | 144 | 174 | 103060/103071 244 | 103080/103061 341 | 341 | -35 | 246 | 341 | -10 | 135 | 342 | 103060/103061 144 | -10 | RoXaN1ATG | UTR
  33. 33. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  34. 34. pGBT9 / pYX212 / pGAD424 pGBT9-NSP3 / pYX212 / pGAD424-NSP3 pGBT9-EIF4G/ pYX-NSP3 / pGAD424-RoXaN1 pGBT9-EIF4G/ pYX-NSP3 / pGAD424 pGBT9-EIF4G / pYX212 / pGAD424-RoXaN1 pGBT9-EIF4G Eco/ pYX -NSP3/ pGAD424- RoXaN1 Contrôle (-) Contrôle (+) Domaine activateur RoXaN 1 EIF4G 37-176 UAS HIS m88- NSP3 Le système triple-hybride. Liaison RoXaN appartient au complexe eIF4G/NSP3 dans le systéme triple hybride
  35. 35. EIF4G Transfection FLAG-RoXaN1 Infection Rotavirus Immunoprécipitation Lysat de cellules infectées Lysat de cellules non infectéesFLAG FLAG FLAG NSP3 NSP3, eIF4G et RoXaN1 co-immunoprécipitent in vivo Western Blot anti-EIF4GI EIF4G NSP3 RoXaN1FLAG EIF4G NSP3 RoXaN1FLAG
  36. 36. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  37. 37. Crible de RoXaN en double-hybride RoXaN1 Liaison à l'ADN GAL4 GAL4 Domaine activateur p170/ eIF3 TPRde RoXaN Liaison à l'ADN GAL4
  38. 38. 1 2 3 4 5 6 7 8 Appât:pGBT9 Proie:GAD424 1 m88NSP3 RoXaN1 2 pGBT9 GAD424 3 TPR GAD-424 4 TPR NSP2 5 TPR p170 6 p170 GAD-424 7 p170 NSP2 8 p170 RoXaN1 le TPR de RoXaN-1 interagit avec la sous/unité p170 de eIF3
  39. 39. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  40. 40. Les motifs TPR (Tetratricopeptide) Organismes Fonctions diverses Compartiments Bactéries, champignons, plantes, animaux Cytosol, noyau, mitochondries, peroxysomes… Nombre de motifs variables 34 acides aminés Co-chaperons, APC, repression de la transcription transport peroxisomal, mitochondrial… SGT/Protéine NS1 du parvovirus PP5 FKBP52 CDC23
  41. 41. Les 3 motifs TPR de la PP5
  42. 42. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  43. 43. Un homologue de RoXaN chez la drosophile Score = 62.8 bits (150), Expect = 9e-10 Identities = 43/146 (29%), Positives = 69/146 (46%), Gaps = 20/146 (13%) Query: 793 NKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSN 852 +K D+ + KH PG G+G+ S +G++ T C C Sbjct: 243 HKTNDLLAAMKLTAGKHQPGS-GDGS--GSDQGDQAAPSTT----------CSYCTITFQ 289 Query: 853 SKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFP-----MGEFRLCDRLQKGKACPDGDKC 907 ++ + +QH Q+E H +KV SD + W +R P + + LC+ + C G +C Sbjct: 290 TRNELRQHCQTEAH-QKVIMSD-EGRDWKWRPPPRGYTLDTYSLCETFSEAHICHYGAQC 347 Query: 908 RCAHGQEELNEWLDRREVLKQKLAKA 933 AHGQ+ELNEW +R E + ++ KA Sbjct: 348 VEAHGQDELNEWKERFEYRRMRMQKA 373 RoXaN/CG9425
  44. 44. Un homologue de RoXaN dans le chromosome 16 humain Query: 69 QVYLRALVRNLFNEGNDVYREHDWNNSISQYTEALNIADYAKSXXXXXXXXXXXXXYINR 128 + +L LV+NLF EGND++RE D+ ++ QY E LN+ADYA S ++N+ Sbjct: 29 EAFLLKLVQNLFAEGNDLFREKDYKQALVQYMEGLNVADYAASDQVALPRELLCKLHVNK 88 Query: 129 IACYSNMGFHDKVLEDCNIVLSLNASNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQ 188 ACY MG ++K LED L L++ + +AL+RK++AL++LGR+K+AY+ ++CSLA+P Sbjct: 89 AACYFTMGLYEKALEDSEKALGLDSESIRALFRKARALNELGRHKEAYECSSRCSLALPH 148 Query: 189 DEHVIKLTQELAQKLGFKIRKAYVRAEALNH----------------------SVEDIEP 226 DE V +L QELAQKLG ++RKAY R + L S++DIE Sbjct: 149 DESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSNGTAAGVADQGTSNGLGSIDDIET 208 Query: 227 DL-LTPRQEAVPVVSLPA-PSFSH--EVGSELASVPVMPLTSILP--------------- 267 D + PR + S P P F H ++ + L S +P T L Sbjct: 209 DCYVDPRGSPALLPSTPTMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDGDVFGPELDTL 268 Query: 268 -----------------------LQVEESALPSAVLANGGKMPFTMP------EAFLDDG 298 + V P GG +P + P +D Sbjct: 269 LDSLSLVQGGLSGSGVPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPS 328 Query: 299 DMVLGDELD---------DLLDSAP--ETNETVMPS-ALVRGPLQ--------------- 331 + LD D LD P ET + S RG L Sbjct: 329 KKLAASVLDALDPPGPTLDPLDLLPYSETRLDALDSFGSTRGSLDKPDSFMEETNSQDHR 388 Query: 332 --------TASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPL---------TSSLED 374 S P MP +A L+ P+ A + + YP LE Sbjct: 389 PPSGAQKPAPSPEPCMPNTALLIKN-PLAATHEFKQACQLCYPKTGPRAGDYTYREGLEH 447 Query: 375 FCSS---LNSFSMSESK---------------------RDVAAEEECRYSGHCTFAYCQE 410 C L SE + +D+ +++C+Y +CTFAY QE Sbjct: 448 KCKRDILLGRLRSSEDQTWKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQE 507 Query: 411 EIDVWTLERKGAFSREAFF---GGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISK 467 EIDVWT ERKG +R+ F GG + +LT+ KLL+EH G F FLCE CFD KPR+ISK Sbjct: 508 EIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISK 567 Query: 468 RNKDNSTACSHPVTKHEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLR 527 KD+ + CS+ KH F +NKCLVHI+R T++KYSKIR F Q D+CRHEVRYGCLR Sbjct: 568 GTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLR 627 Query: 552 DMEQFYELWLKSQKNEKSEDIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQ 611 DM+Q Y++WLK K + S++E KQI MPTDYA++ + +HCW+CGKN NS+KQ Sbjct: 797 DMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQ 856 Query: 612 WQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICD 648 WQ HI SEKHKEKVF ++ D W RFP G F +CD Sbjct: 857 WQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCD 893 RoXaN / AF161540
  45. 45. eIF4G 4E PABP AAAAAAAAAAA 4A 40 SeIF3 m7G AUG AAU Rôle de l'eIF3
  46. 46. 4G 4E 5'Cap PABP AAAAAAAAAAAA 3' 4G 4E 4G 4E 5'Cap PABP AUG PABP AAAAAAAAAAAA 3' En présence de poly(A) et de coiffe, la PABP et eIF4G stimulent l'initiation de la traduction. La PABP liant le complexe d'initiation en plusieurs endroits. En absence de poly(A), la PABP peut transactiver la traduction coiffe dépendante en interagissant peut-être avec des facteurs de stimulation non identifiés à ce jour. Facteur de stimulation RoXaN ? En absence de coiffe mais en présence de poly(A) eIF4G est capable de lier à la PABP. AUG AUG Facteur de stimulation RoXaN ? Facteur de stimulation RoXaN ? Le Modèle d'Otero & Sachs (1999)
  47. 47. Introduction Rotavirus L'initiation de la traduction Résultats RoXaN Reconstitution Analyse de la séquence de RoXaN Interaction avec NSP3 Interaction avec eIF4G/NSP3 Interaction avec d'autres protéines Discussion Perspectives Propriétés des TPR Fonction de RoXaN Obtention d'un sérum dirigé contre RoXaN Double-Hybride
  48. 48. Perspectives Purification de RoXaN Rôle de RoXaN Obtention d'un sérum dirigé contre RoXaN Animaux "Knock-out" Effets sur la traduction in vitro Double hybride reverse Homologues de RoXaN / NSP3 LUCUTR UTR
  49. 49. Remerciements Didier Poncet, Maria Gajardo, Nathalie Castagne, Patrice Vende, Annie Charpilienne, Jean Cohen. et beaucoup d'autres…

×