Kewirausahaan (11)

827 views

Published on

unj fmipa-fisika

Published in: Education
0 Comments
1 Like
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
827
On SlideShare
0
From Embeds
0
Number of Embeds
5
Actions
Shares
0
Downloads
0
Comments
0
Likes
1
Embeds 0
No embeds

No notes for slide

Kewirausahaan (11)

  1. 1. Sesion #11<br />Kewirausahaan<br />Dr. Sunaryo<br />JurusanFisika<br />FakultasMatematikadanIlmuPengetahuanAlam<br />
  2. 2. Outline<br />PERSEROAN TERBATAS (P.T.)<br />PENDIRIAN PERSEROAN TERBATAS (P.T.)<br />ANGGARAN DASARPERSEROAN TERBATAS(P.T.)<br />NAMA PERSEROAN TERBATAS (P.T.)<br />ORGANPERSEROAN TERBATAS (P.T.)<br />RUPS<br />DIREKSI<br />DEWAN KOMISARIS<br />PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br />KELEBIHAN PERSEROAN TERBATAS (P.T.)<br />KEKURANGAN PERSEROAN TERBATAS (P.T.)<br />1/13/2011<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />2<br />
  3. 3. KajianTentangBadanUsaha(bagian 1)<br />1/13/2011<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />3<br />
  4. 4. Dasarhukum<br />UU No. 40 Tahun 2007 tentang Perseroan Terbatas<br /><ul><li>Berlakusejakdiundangkan, yaitutanggal 16 Agustus 2007</li></ul>Menggantikan UU No. 1 Tahun 1995 tentang Perseroan Terbatas<br />1/13/2011<br />4<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  5. 5. PERSEROAN TERBATAS(P.T.)<br />Definisi:<br />Badanhukum yang merupakanpersekutuanmodal, didirikanberdasarkanperjanjian, melakukankegiatanusahadenganmodal dasaryang seluruhnyaterbagidalamsaham, danmemenuhipersyaratan yang ditetapkandalamundang-undanginisertaperaturanpelaksanaannya.<br />1/13/2011<br />5<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  6. 6. PERSEROAN TERBATAS (P.T.) SEBAGAI BADAN HUKUM<br />P.T. mempunyaihartakekayaansendiri.<br />P.T. mempunyaitanggungjawabsendiri.<br />P.T. tidakdapatbertindaksendiri:<br />P.T. terdiridari organ-organ yang akanbertindaknmewakiliP.T. tersebut<br />Organ-organ tersebutterdiridariorang peroranganyang cakapuntukbertindakdalamhukum<br />1/13/2011<br />6<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  7. 7. PENDIRIAN PERSEROAN TERBATAS (P.T.)<br /><ul><li>P.T. mempunyainamadantempatkedudukandalamwilayahnegara R.I. yang ditentukandalamAnggaranDasar
  8. 8. P.T. mempunyaialamatlengkapsesuaidengantempatkedudukannya
  9. 9. P.T. didirikanoleh 2 orang ataulebihdenganAktaNotaris yang dibuatdalamBahasa Indonesia
  10. 10. Setiappendiri P.T. wajibmengambilbagiansahampadasaat P.T. didirikan
  11. 11. AktaPendirianharusdisahkanolehMenteriHukumdanHakAsasiManusia R.I
  12. 12. AktaPendirian yang telahdisahkantersebutdidaftarkandalamDaftar Perseroan yang diselenggarakanolehMenteriHukumdanHakAsasiManusia R.I
  13. 13. AktaPendirian yang telahdisahkandandidaftarkantersebutselanjutnyadiumumkandalamTambahanBerita Negara R.I</li></ul>1/13/2011<br />7<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  14. 14. PENDIRIAN PERSEROAN TERBATAS (P.T.)<br />Perbuatanhukum yang berkaitandengankepemilikansahamdanpenyetorannya yang dilakukanolehcalonpendirisebelum P.T. didirikan, harusdicantumkandalamAktaPendirian P.T<br />Apabilaperbuatanhukumtersebutdinyatakandalambentukaktayang bukanaktaotentik, makaaktatersebutdilekatkanpadaAkta<br />Pendirian P.T<br />Apabilaperbuatanhukumtersebutdinyatakandalambentukaktaotentikmakanomor, tanggaldannamasertatempatkedudukannotarisyang membuataktaotentiktersebutdisebutkandalamAkta<br />PendirianP.T<br /><ul><li>Dalamhalketentuantersebut di atastidakdipenuhimakaperbuatanhukumtersebuttidakmenimbulkanhakdankewajibansertatidakmengikat P.T</li></ul>1/13/2011<br />8<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  15. 15. PENDIRIAN PERSEROAN TERBATAS (P.T.)<br /><ul><li>Perbuatanhukum yang dilakukanolehcalonpendiriuntukkepentingan P.T. yang belumdidirikan, mengikat P.T. setelah P.T. menjadibadanhukum, jika RUPS pertama P.T. secarategasmenyatakanmenerimaataumengambilalihsemuahakdankewajiban yang timbuldariperbuatanhukumtersebut
  16. 16. RUPS pertamaharusdiselenggarakandalamjangkawaktu paling lambat 60 harisetelah P.T. memperoleh status badanhukum</li></ul>1/13/2011<br />9<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  17. 17. <ul><li>Keputusan RUPS hanyasahjikadihadiriolehsemuapemegangsahamdenganhaksuaradankeputusandisetujuidengansuarabulat
  18. 18. Apabila RUPS tidakdiselenggarakandalamjangkawaktu paling lambat 60 harisetelah P.T. memperoleh status badanhukumatau RUPS tidakberhasilmengambilkeputusan, setiapcalonpendiri yang melakukanperbuatanhukumtersebutbertanggungjawabsecarapribadiatassegalaakibat yang timbul
  19. 19. Persetujuan RUPS tersebuttidakdiperlukanapabilaperbuatanhukumtersebutdilakukanataudisetujuisecaratertulisolehsemuacalonpendirisebelumpendirian P.T</li></ul>1/13/2011<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />10<br />
  20. 20. PENDIRIAN PERSEROAN TERBATAS (P.T.)<br /><ul><li>Selamapengesahanbelumdiperoleh, P.T. dalampendirianmasihbelummerupakansuatubadanhukum, parapendiridiwajibkanuntukmengajukanpermohonanpengesahankepadaMenteriHukumdanHakAsasiManusia R.I
  21. 21. Perbuatanhukumatasnama P.T. yang belummemperoleh status badanhukum, hanyabolehdilakukanolehsemuaanggotaDireksibersama-samasemuapendirisertasemuaanggotaDewanKomisaris P.T. danmerekasemuabertanggungjawabsecaratanggungrentengatasperbuatanhukumtersebut. Perbuatanhukumtersebutkarenahukummenjaditanggungjawab P.T. setelah P.T. menjadibadanhukum</li></ul>1/13/2011<br />11<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  22. 22. Perbuatanhukum yang dilakukanolehpendiriatasnama P.T. yang belummemperoleh status badanhukummenjaditanggungjawabpendiri yang bersangkutandantidakmengikat P.T. Perbuatanhukumtersebuthanyamengikatdanmenjaditanggungjawab P.T. setelahperbuatanhukumtersebutdisetujuiolehsemuapemegangsahamdalam RUPS (pertama) yang dihadiriolehsemuapemegangsaham P.T. yang diselenggarakan paling lambat 60 harisetelah P.T. memperoleh status badanhukum<br />1/13/2011<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />12<br />
  23. 23. PERSEROAN TERBATAS (P.T.) SETELAH PENGESAHAN<br /><ul><li>P.T. telahberbadanhukumsetelahmemperolehpengesahandariMenteriHukumdanHakAsasiManusia R.I
  24. 24. Status badanhukum P.T. diperolehpadatanggalditerbitkannyakeputusanMenteriHukumdanHakAsasiManusia R.I. mengenaipengesahanbadanhukum P.T.
  25. 25. Pendirisebagaipemegangsahamhanyabertanggungjawabsebatas modal yang dimasukkankedalam P.T.
  26. 26. RUPS pertamadiselenggarakanuntuk:</li></ul> * Menerimasemuaperjanjian yang dibuatolehpendiriatau orang lain yang ditugaskanpendiridenganpihakketiga<br /> * Mengambilalihsemuahakdankewajiban yang timbuldariperjanjian yang dibuatpendiriatau orang lain yang ditugaskanpendirimeskipunperjanjiantidakdilakukanatasnama P.T.<br /> * Mengukuhkansecaratertulissemuaperbuatanhukum yang dilakukanatasnama P.T. <br />1/13/2011<br />13<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  27. 27. PENGUMUMAN PERSEROAN TERBATAS (P.T.) <br />MenteriHukumdanHakAsasiManusia R.I. mengumumkanAktaPendirian P.T. besertaKeputusanMenteriHukumdanHakAsasiManusia R.I. mengenaipengesahanbadanhukum P.T. dalamTambahanBeritaNegara R.I.<br />PengumumantersebutdilakukanolehMenteriHukumdanHakAsasiManusia R.I. dalamwaktu paling lambat 14 hariterhitungsejaktanggalditerbitkannyaKeputusanMenteriHukumdanHakAsasiManusia R.I. mengenaipengesahanbadanhukum P.T. atausejakditerimanyapemberitahuanolehMenteriHukumdanHakAsasiManusia R.I.<br />1/13/2011<br />14<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  28. 28. AKTA PENDIRIANPERSEROAN TERBATAS (P.T.)<br />Akta pendirian P.T. harus memuat Anggaran Dasar dan keterangan lain yang <br />berkaitan dengan pendirian P.T. Keterangan lain tersebut memuat sekurang-<br />nya:<br /><ul><li>Nama lengkap, tempat dan tanggal lahir, pekerjaan, tempat tinggal dan kewarganegaraan pendiri perseorangan; atau nama, tempat kedudukan </li></ul> dan alamat lengkap serta nomor dan tanggal Keputusan Menteri mengenai pengesahan badan hukum dari pendiri P.T.<br /><ul><li>Nama lengkap, tempat dan tanggal lahir, pekerjaan, tempat tinggal dan kewarganegaraan anggota Direksi yang pertama kali diangkat.
  29. 29. Nama lengkap, tempat dan tanggal lahir, pekerjaan, tempat tinggal dan kewarganegaraan anggota Dewan Komisaris yang pertama kali diangkat.
  30. 30. Nama pemegang saham yang telah mengambil bagian saham, rincian</li></ul> jumlah saham dan nilai nominal saham yang telah ditempatkan dan disetor.<br />Apabila dalam jangka waktu 120 hari sejak penandatanganan Akta Pendirian<br />tidak diajukan permohonan pengesahan, P.T. demi hukum bubar dan <br />pemberesan dilakukan oleh pendiri.<br />1/13/2011<br />15<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  31. 31. ANGGARAN DASARPERSEROAN TERBATAS (P.T.)<br />Anggaran Dasar memuat sekurangnya:<br /><ul><li>Nama P.T.
  32. 32. Tempat kedudukan P.T.
  33. 33. Maksud dan tujuan P.T.
  34. 34. Kegiatan usaha P.T.
  35. 35. Jangka waktu berdirinya P.T.
  36. 36. Modal dasar, modal ditempatkan dan modal disetor P.T.
  37. 37. Jumlah saham, klasifikasi saham, hak-hak yang melekat pada tiap-tiap klasifikasi dan jumlah nominal masing-masing.</li></ul>1/13/2011<br />16<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  38. 38. ANGGARAN DASARPERSEROAN TERBATAS(P.T.)<br />AnggaranDasarmemuatsekurangnya:<br /><ul><li>NamajabatandanjumlahanggotaDireksi.
  39. 39. NamajabatandanjumlahanggotaDewanKomisaris.
  40. 40. Penetapantempatdantatacarapenyelenggaraan RUPS.
  41. 41. Tata carapemilihan, pengangkatan, penggantiandanpemberhentiananggotaDireksi.
  42. 42. Tata carapemilihan, pengangkatan, penggantiandanpemberhentiananggotaDewanKomisaris.
  43. 43. Tata carapenggunaanlabadanpembagiandividen.</li></ul>1/13/2011<br />17<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  44. 44. ANGGARAN DASARPERSEROAN TERBATAS (P.T.)<br />Anggaran Dasar P.T. tidak boleh memuat:<br /><ul><li>Ketentuan mengenai penerimaan bunga tetap atas saham.
  45. 45. Ketentuan mengenai pemberian manfaat pribadi kepada pendiri atau pihak lain.</li></ul>1/13/2011<br />18<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  46. 46. PERUBAHANANGGARAN DASAR P.T. <br />Perubahan Anggaran Dasar P.T. ditetapkan oleh RUPS dan harus <br />dinyatakan dalam Akta Notaris yang dibuat dalam Bahasa Indonesia.<br />Perubahan Anggaran Dasar tertentu yang harus mendapat persetujuan <br />dari Menteri Hukum dan Hak Asasi Manusia R.I. meliputi:<br /><ul><li>Nama P.T. dan/atau tempat kedudukan P.T.
  47. 47. Maksud dan tujuan serta kegiatan usaha P.T.
  48. 48. Jangka waktu berdirinya P.T.
  49. 49. Besarnya modal dasar.
  50. 50. Pengurangan modal ditempatkan dan disetor.
  51. 51. Status P.T. Tertutup menjadi P.T. Terbuka atau sebaliknya.</li></ul>Perubahan Anggaran Dasar selain sebagaimana tersebut di atas, <br />cukup diberitahukan kepada Menteri Hukum dan Hak Asasi Manusia <br />R.I.<br />1/13/2011<br />19<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  52. 52. NAMA PERSEROAN TERBATAS (P.T.)<br />P.T. tidakbolehmemakainama yang:<br /><ul><li>Telahdipakaisecarasaholeh P.T. lain atausamapadapokoknyadengannama P.T. lain.
  53. 53. Bertentangandenganketertibanumumdan/ataukesusilaan.
  54. 54. Samaataumiripdengannamalembaganegara, lembagapemerintahataulembagainternasionalkecualimendapatizindari yang bersangkutan.
  55. 55. Tidaksesuaidenganmaksuddantujuansertakegiatanusahaataumenunjukkanmaksuddantujuan P.T. sajatanpanamadiri.
  56. 56. Terdiriatasangkaataurangkaianangka, hurufataurangkaianhuruf yang tidakmembentukkata.
  57. 57. Mempunyaiartisebagai Perseroan, badanhukumataupersekutuanperdata.</li></ul>Nama P.T. harusdidahuluidenganfrase ”Perseroan Terbatas” ataudisingkat P.T.; dan<br />jikamerupakan P.T. Terbuka, padaakhirnama P.T. harusditambahkatasingkatan<br />“Tbk”. P.T. Terbuka adalah P.T. Publikatau P.T. yang melakukanpenawaranumum<br />sahamsesuaidenganketentuanperaturanperundang-undangandibidangPasar Modal.<br />P.T. Publikadalah P.T. yang memenuhikriteriajumlahpemegangsahamdan modal <br />disetorsesuaidenganketentuanperaturanperundang-undangandibidangpasar modal.<br />1/13/2011<br />20<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  58. 58. MODAL PERSEROAN TERBATAS (P.T.)<br /><ul><li>Modal dasar P.T. terdiriatasseluruhnilai nominal saham.
  59. 59. Modal dasarP.T.palingsedikitRp. 50.000.000,-.
  60. 60. Paling sedikit 25 % dari modal dasarharusditempatkandandisetorpenuh.
  61. 61. Modal ditempatkandandisetorpenuhdibuktikandenganbuktipenyetoran yang sah.
  62. 62. Setiapsahamwajibmemilikinilai nominal.
  63. 63. Setiapsahammewakili 1 suaradalam RUPS.
  64. 64. Setiapsahamharusditerbitkanatasnama.
  65. 65. Pengeluaransahamlebihlanjut yang dilakukansetiap kali untukmenambah modal yang ditempatkanharusdisetorpenuh.
  66. 66. Penyetoranatas modal sahamdapatdilakukandalambentukuangdan/ataudalambentuklainnya.</li></ul>1/13/2011<br />21<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  67. 67. SAHAM PERSEROAN TERBATAS (P.T.)<br /><ul><li>Saham P.T. dikeluarkanatasnamapemiliknya.
  68. 68. Nilaisahamharusdicantumkandalammatauang rupiah.
  69. 69. Sahamtanpanilai nominal tidakdapatdikeluarkan.
  70. 70. Direksi P.T. wajibmengadakandanmenyimpandaftarpemegangsaham.
  71. 71. Pemegangsahamdiberibuktipemilikansahamuntuksaham yang dimilikinya.
  72. 72. Pemegangsaham P.T. tidakbertanggungjawabsecarapribadiatasperikatan</li></ul> yang dibuatatasnama P.T. dantidakbertanggungjawabataskerugian P.T. melebihisaham yang dimiliki.<br /><ul><li>Sahammemberikanhakkepadapemiliknyauntuk:</li></ul> * Menghadiridanmengeluarkansuaradalam RUPS.<br /> * Menerimapembayarandividendansisakekayaanhasillikuidasi.<br /> * Menjalankanhaklainnyaberdasarkan UU No. 40 Tahun 2007 tentang<br /> Perseroan Terbatas.<br /><ul><li>Pengalihanhakatassaham:</li></ul> * Memerlukan RUPS.<br /> * Diperlukanakta yang bertujuanuntukmengalihkanhakatassaham.<br /> * DilaporkankepadaMenteriHukumdanHakAsasiManusia R.I.<br />1/13/2011<br />22<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  73. 73. ORGANPERSEROAN TERBATAS (P.T.)<br /><ul><li>RUPS (Rapat Umum Pemegang Saham).</li></ul>- Direksi.<br />- Dewan Komisaris.<br />1/13/2011<br />23<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  74. 74. RUPS<br />RUPS adalah organ P.T. yang mempunyai wewenang yang tidak <br />diberikan kepada Direksi atau Dewan Komisaris dalam batas yang <br />ditentukan dalam UU No. 40 Tahun 2007 tentang Perseroan Terbatas<br />dan/atau Anggaran Dasar. <br />RUPS terdiri atas:<br />- RUPS tahunan.<br /> RUPS tahunan wajib diadakan dalam jangka waktu paling lambat 6 <br /> bulan setelah tahun buku berakhir.<br />- RUPS lainnya.<br /> RUPS lainnya dapat diadakan setiap waktu berdasarkan kebutuhan<br /> untuk kepentingan P.T.<br />1/13/2011<br />24<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  75. 75. DIREKSI<br />Direksi adalah organ P.T. yang berwenang dan <br />bertanggung jawab atas pengurusan P.T. untuk <br />kepentingan P.T. sesuai dengan maksud dan<br />tujuan P.T. serta mewakili P.T., baik di dalam maupun<br />di luar Pengadilan sesuai dengan ketentuan Anggaran <br />Dasar.<br />Untuk pertama kali pengangkatan anggota Direksi <br />dilakukan oleh pendiri dalam Akta Pendirian. Untuk<br />selanjutnya anggota Direksi diangkat oleh RUPS.<br />Direksi P.T. terdiri atas 1 orang anggota Direksi atau <br />lebih.<br />1/13/2011<br />25<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  76. 76. PERAN DIREKSI<br /><ul><li>Direksimenjalankanpengurusan P.T. untukkepentingan P.T. dansesuaidenganmaksuddantujuan P.T.
  77. 77. Direksimewakili P.T., baikdidalammaupundiluarpengadilan.
  78. 78. Direksimenyusunrencanakerjatahunansebelumdimulainyatahunbuku yang akandatang.
  79. 79. Direksimenyampaikanlaporantahunankepada RUPS setelahditelaaholehDewanKomisarisdalamjangkawaktu paling lambat 6 bulansetelahtahunbuku P.T. berakhir.</li></ul>1/13/2011<br />26<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  80. 80. KEWAJIBAN DIREKSI<br /><ul><li>Membuatdaftarpemegangsaham, daftarkhusus, risalah RUPS danrisalahrapatDireksi.
  81. 81. Melaporkankepada P.T. mengenaisaham yang dimilikianggotaDireksi</li></ul> yang bersangkutandan/ataukeluarganyadalam P.T. danP.T.lainuntukselanjutnyadicatatdalamdaftarkhusus.<br /><ul><li>Membuatlaporantahunandandokumenkeuangan P.T.
  82. 82. Memeliharaseluruhdaftar, risalahdandokumenkeuangan P.T.
  83. 83. Memintapersetujuan RUPS untuk:</li></ul> * Mengalihkankekayaan P.T.<br /> * Menjadikanjaminanutangkekayaan P.T.:<br /> yang merupakanlebihdari 50 % jumlahkekayaanbersih P.T. dalam 1 transaksiataulebih, baik yang berkaitansatusama lain maupuntidak.<br />Transaksitersebutadalahtransaksipengalihankekayaanbersih P.T. yang terjadidalamjangkawaktu 1 tahunbukuataujangkawaktu yang lebih lama sebagaimanadiaturdalamAnggaranDasar P.T.<br />1/13/2011<br />27<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  84. 84. PERWAKILAN DIREKSI DALAM P.T.<br /><ul><li>Direksi mewakili P.T., baik di dalam maupun di luar pengadilan.
  85. 85. Dalam hal anggota Direksi terdiri lebih dari 1 orang, yang berwenang mewakili P.T. adalah setiap anggota Direksi, kecuali ditentukan lain dalam Anggaran Dasar.
  86. 86. Kewenangan Direksi untuk mewakili P.T. adalah tidak terbatas dan tidak bersyarat, kecuali ditentukan lain dalam UU No. 40 Tahun 2007 tentang Perseroan Terbatas, Anggaran Dasar atau keputusan RUPS.
  87. 87. Direksi dapat memberi kuasa tertulis kepada1 orang karyawan P.T. atau lebih atau kepada orang lain untuk dan atas nama P.T. melakukan perbuatan hukum tertentu.
  88. 88. Anggota Direksi tidak berwenang mewakili P.T. jika:</li></ul> * Terjadi perkara di pengadilan antara P.T. dengan anggota Direksi yang <br /> bersangkutan.<br /> * Anggota Direksi yang bersangkutan mempunyai benturan kepentingan dengan <br /> P.T.<br /> Dalam hal tersebut di atas, yang berhak mewakili P.T. adalah:<br /> * Anggota Direksi lainnya yang tidak mempunyai benturan kepentingan dengan P.T.<br /> * Dewan Komisaris dalam hal seluruh anggota Direksi mempunyai benturan<br /> kepentingan dengan P.T.<br /> * Pihak lain yang ditunjuk oleh RUPS dalam hal seluruh anggota Direksi atau <br /> Dewan Komisaris mempunyai benturan kepentingan dengan P.T.<br />1/13/2011<br />28<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  89. 89. DIREKSIDALAM UU P.T.<br /><ul><li>AnggotaDireksidibebaskandaritanggungjawabsebagaiakibatLaporanKeuangan yang disediakanternyatatidakbenardan/ataumenyesatkanapabilaterbuktibahwakeadaantersebutbukankarenakesalahannya.
  90. 90. AnggotaDireksitidakdapatdipertanggungjawabkanataskerugian P.T. jikadapatmembuktikan:</li></ul> * Kerugiantersebutbukankarenakesalahanataukelalaiannya.<br /> * Telahmelakukanpengurusandenganitikadbaikdankehati-hatian<br />untukkepentingandansesuaidenganmaksuddantujuan P.T.<br /> * Tidakmempunyaibenturankepentingan, baiklangsungmaupun<br />tidaklangsungatastindakanpengurusan yang mengakibatkankerugian.<br /> * Telahmengambiltindakanuntukmencegahtimbulatauberlanjut-<br />nyakerugiantersebut.<br />1/13/2011<br />29<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  91. 91. DIREKSIDALAM UU P.T.<br /><ul><li>AnggotaDireksitidakbertanggungjawabataskepailitan P.T. apabiladapatmembuktikan:</li></ul> * Kepailitantersebutterjadibukankarenakesalahanataukelalaian-<br />nya.<br /> * Telahmelakukanpengurusandenganitikadbaik, kehati-hatiandanpenuhtanggungjawabuntukkepentingan P.T. dansesuaidenganmaksuddantujuan P.T.<br /> * Tidakmempunyaibenturankepentingan, baiklangsungmaupun<br />tidaklangsungatastindakanpengurusan yang dilakukan.<br /> * Telahmengambiltindakanuntukmencegahterjadinyakepailitan.<br />1/13/2011<br />30<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  92. 92. TANGGUNG JAWAB DIREKSI <br /><ul><li>Dalam hal Laporan Keuangan yang disediakan ternyata tidak benar dan/atau menyesatkan, anggota Direksi secara tanggung renteng bertanggung jawab terhadap pihak yang dirugikan.
  93. 93. Setiap anggota Direksi bertanggung jawab penuh secara pribadi atas kerugian P.T. apabila yang bersangkutan bersalah atau lalai men- jalankan tugasnya.
  94. 94. Dalam hal Direksi terdiri atas 2 anggota Direksi atau lebih, tanggung jawab tersebut berlaku secara tanggung renteng.</li></ul>1/13/2011<br />31<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  95. 95. <ul><li>AnggotaDireksi yang tidakmelaksanakankewajibannyamelaporkankepada P.T., saham yang dimilikianggotaDireksi yang bersangkutandan/ataukeluarganyadalam P.T. dan P.T. lain untukselanjutnyadicatatdalamdaftarkhususdanakibatnyamenimbulkankerugianbagi P.T., bertanggungjawabsecarapribadiataskerugian P.T. tersebut.
  96. 96. AnggotaDireksidapatdiberhentikanuntuksementaraolehDewanKomisarisdenganmenyebutkanalasannyadandapatdiberhentikansewaktu-waktuberdasarkankeputusan RUPS denganmenyebutkanalasannya.</li></ul>TANGGUNG JAWAB DIREKSI <br />1/13/2011<br />32<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  97. 97. <ul><li>Dalam hal kepailitan, baik karena permohonan P.T. maupun permohonan pihak ketiga, terjadi karena kesalahan atau kelalaian Direksi dan harta pailit tidak cukup untuk membayar seluruh kewajiban P.T. dalam kepailitan tersebut, setiap anggota Direksi secara tanggung renteng bertanggung jawab atas seluruh kewajiban yang tidak terlunasi dari harta pailit tersebut.
  98. 98. Tanggung jawab tersebut berlaku juga bagi anggota Direksi yang salah atau lalai yang pernah menjabat sebagai anggota Direksi dalam jangka waktu 5 tahun sebelum putusan pernyataan pailit diucapkan.</li></ul>TANGGUNG JAWAB DIREKSI <br />1/13/2011<br />33<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  99. 99. DEWAN KOMISARIS<br />DewanKomisarisadalah organ P.T. yang <br />bertugasmelakukanpengawasansecaraumum<br />dan/ataukhusussesuaidenganAnggaranDasar<br />sertamemberinasihatkepadaDireksi. <br />Untukpertama kali pengangkatananggotaDewan<br />KomisarisdilakukanolehpendiridalamAkta<br />Pendirian. UntukselanjutnyaanggotaDewan<br />Komisarisdiangkatoleh RUPS.<br />DewanKomisaristerdiriatas 1 oranganggota<br />ataulebih.<br />1/13/2011<br />34<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  100. 100. DEWAN KOMISARISDALAM P.T.<br /><ul><li>AnggaranDasar P.T. dapatmengaturadanya 1 orangataulebihKomisarisIndependendan 1 orangKomisarisUtusan.</li></ul>- KomisarisIndependendiangkatberdasarkankeputusan RUPS daripihak yang tidakterafiliasidenganpemegangsahamutama, anggotaDireksidan/atauanggotaDewanKomisarislainnya.<br />- KomisarisUtusanmerupakananggotaDewanKomisaris yang ditunjukberdasarkankeputusanrapatDewanKomisaris.<br />- TugasdanwewenangKomisarisUtusanditetapkandalamAnggaranDasar P.T. denganketentuantidakbertentangandengantugasdanwewenangDewanKomisarisdantidakmengurangitugaspengurusan yang dilakukanDireksi.<br />1/13/2011<br />35<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  101. 101. <ul><li>Dalam menjalankan tugas pengawasan, Dewan Komisaris dapat</li></ul> membentuk komite, yang anggotanya seorang atau lebih adalah<br /> anggota Dewan Komisaris yang bertanggung jawab kepada Dewan<br /> Komisaris.<br /><ul><li>Dewan Komisaris yang terdiri atas lebih dari 1 orang anggota </li></ul> merupakan majelis dan setiap anggota Dewan Komisaris tidak<br /> dapat bertindak sendiri-sendiri melainkan berdasarkan keputusan <br /> Dewan Komisaris.<br /><ul><li>P.T. yang menjalankan kegiatan usaha berdasarkan prinsip syariah,</li></ul> selain mempunyai Dewan Komisaris wajib mempunyai Dewan <br /> Pengawas Syariah.<br /><ul><li>Dewan Pengawas Syariah tersebut terdiri atas seorang ahli syariah </li></ul> atau lebih yang diangkat oleh RUPS atas rekomendasi Majelis <br /> Ulama Indonesia.<br /><ul><li>Dewan Pengawas Syariah tersebut bertugas memberikan nasihat </li></ul> dan saran kepada Direksi serta mengawasi kegiatan P.T. agar<br /> sesuai dengan prinsip syariah.<br />DEWAN KOMISARISDALAM P.T.<br />1/13/2011<br />36<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  102. 102. PERANDEWAN KOMISARIS<br />- Dewan Komisaris melakukan pengawasan atas kebijakan pengurusan, jalannya pengurusan pada umumnya, baik mengenai P.T. maupun usaha P.T. dan memberi nasihat kepada Direksi.<br />- Setiap anggota Dewan Komisaris wajib dengan itikad baik, kehati-hatian dan bertanggung jawab dalam menjalankan tugas pengawasan dan pemberian nasihat kepada Direksi untuk kepentingan P.T. dan sesuai dengan maksud dan tujuan P.T. <br />1/13/2011<br />37<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  103. 103. KEWAJIBANDEWAN KOMISARIS<br /><ul><li>DewanKomisariswajib:</li></ul> * MembuatrisalahrapatDewanKomisarisdanmenyimpansalinannya.<br /> * Melaporkankepada P.T. mengenaikepemilikansahamnyadan/ataukeluarganyakepada P.T. tersebutdan P.T. lain.<br /> * Memberikanlaporantentangtugaspengawasan yang telahdilakukanselamatahunbuku yang barulampaukepada RUPS.<br />- ApabiladalamAnggaranDasarditetapkanpemberianwewenangkepadaDewanKomisarisuntukmemberikanpersetujuanataubantuankepadaDireksidalammelakukanperbuatanhukumtertentumakaDewanKomisarisberkewajibanuntukmemberikanpersetujuanataubantuankepadaDireksidalammelakukanperbuatanhukumtertentutersebut. <br />1/13/2011<br />38<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  104. 104. TANGGUNG JAWABDEWAN KOMISARIS<br /><ul><li>DalamhalLaporanKeuangan yang disediakanternyatatidakbenar</li></ul>dan/ataumenyesatkan, anggotaDewanKomisarissecaratanggung<br />rentengbertanggungjawabterhadappihak yang dirugikan.<br /><ul><li>DewanKomisarisbertanggungjawabataspengawasan P.T.
  105. 105. SetiapanggotaDewanKomisarisikutbertanggungjawabsecarapribadiataskerugian P.T. apabila yang bersangkutanbersalahataulalaidalammenjalankantugasnya.
  106. 106. DalamhalDewanKomisaristerdiriatas 2 anggotaDewanKomisarisataulebih, tanggungjawabtersebutdiatasberlakusecaratanggungrentengbagisetiapanggotaDewanKomisaris.</li></ul>- Atasnama P.T., pemegangsaham yang mewakili paling sedikit 1/10 bagiandarijumlahseluruhsahamdenganhaksuaradapatmenggugatanggotaDewanKomisaris yang karenakesalahanataukelalaiannyamenimbulkankerugianpada P.T. kePengadilanNegeri.<br />1/13/2011<br />39<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  107. 107. <ul><li>Dalam hal terjadi kepailitan karena kesalahan atau kelalaian Dewan Komisaris dalam melakukan pengawasan terhadap pengurusan yang dilaksanakan oleh Direksi dan kekayaan P.T. tidak cukup untuk membayar seluruh kewajiban P.T. akibat kepailitan tersebut maka setiap anggota Dewan Komisaris secara tanggung renteng ikut bertanggung jawab dengan anggota Direksi atas kewajiban yang belum dilunasi.
  108. 108. Tanggung jawab tersebut berlaku juga bagi anggota Dewan Komisaris yang sudah tidak menjabat 5 tahun sebelum putusan pernyataan pailit diucapkan.</li></ul>TANGGUNG JAWABDEWAN KOMISARIS<br />1/13/2011<br />40<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  109. 109. DEWAN KOMISARIS DALAM UU P.T.<br /><ul><li>AnggotaDewanKomisarisdibebaskandaritanggungjawabsebagaiakibatLaporanKeuangan yang disediakanternyatatidakbenardan/ataumenyesatkanapabilaterbuktibahwakeadaantersebutbukankarenakesalahannya.
  110. 110. AnggotaDewanKomisaristidakdapatdipertanggungjawabkanataskerugian P.T. apabiladapatmembuktikan:</li></ul> * Telahmelakukanpengawasandenganitikadbaikdankehati-hatian<br />untukkepentingan P.T. dansesuaidenganmaksuddantujuan P.T.<br /> * Tidakmempunyaikepentinganpribadi, baiklangsungmaupuntidak<br />langsungatastindakanpengurusanDireksi yang mengakibatkan<br />kerugian.<br /> * TelahmemberikannasihatkepadaDireksiuntukmencegahtimbul<br />atauberlanjutnyakerugiantersebut.<br />1/13/2011<br />41<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  111. 111. DEWAN KOMISARIS DALAM UUPT<br /><ul><li>AnggotaDewanKomisaristidakdapatdimintaipertanggungjawabanataskepailitan P.T. apabiladapatmembuktikan:</li></ul>Kepailitantersebutbukankarenakesalahanataukelalaiannya.<br />Telahmelakukantugaspengawasandenganitikadbaikdankehati-hatianuntukkepentingan P.T. dansesuaidenganmaksuddantujuan P.T.<br />Tidakmempunyaikepentinganpribadi, baiklangsungmaupuntidaklangsungatastindakanpengurusanolehDireksi yang mengakibatkankepailitan.<br />TelahmemberikannasihatkepadaDireksiuntukmencegahterjadinyakepailitan.<br />1/13/2011<br />42<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  112. 112. CORPORATE SOCIAL RESPONSIBILITY (CSR) TANGGUNG JAWAB SOSIAL DAN LINGKUNGAN<br /><ul><li>Dasar hukum: pasal 74 UU No. 40 Tahun 2007 tentang Perseroan Terbatas.
  113. 113. Tanggung Jawab Sosial dan Lingkungan adalah komitmen P.T. untuk berperan serta dalam pembangunan ekonomi berkelanjutan guna meningkatkan kualitas kehidupan dan lingkungan yang bermanfaat, baik bagi P.T. sendiri, komunitas setempat maupun masyarakat pada umumnya.
  114. 114. P.T. yang menjalankan kegiatan usahanya di bidang dan/atau berkaitan dengan sumber daya alam wajib melaksanakan Tanggung Jawab Sosial dan Lingkungan. Ketentuan ini bertujuan untuk tetap menciptakan hubungan P.T. yang serasi, seimbang dan sesuai dengan lingkungan, nilai, norma dan budaya masyarakat setempat.
  115. 115. Yang dimaksud dengan “P.T. yang menjalankan kegiatan usahanya di </li></ul> bidang sumber daya alam” adalah P.T. yang kegiatan usahanya mengelola dan memanfaatkan sumber daya alam.<br /><ul><li>Yang dimaksud dengan “P.T. yang menjalankan kegiatan usahanya yang berkaitan dengan sumber daya alam” adalah P.T. yang tidak mengelola dan tidak memanfaatkan sumber daya alam tetapi kegiatan usahanya berdampak pada fungsi kemampuan sumber daya alam.</li></ul>1/13/2011<br />43<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  116. 116. CORPORATE SOCIAL RESPONSIBILITY (CSR) TANGGUNG JAWAB SOSIAL DAN LINGKUNGAN<br /><ul><li>Tanggung Jawab Sosial dan Lingkungan merupakan kewajiban P.T. yang dianggarkan dan diperhitungkan sebagai biaya P.T. yang pelaksanaannya dilakukan dengan memperhati- kan kepatutan dan kewajaran.</li></ul>- P.T. yang tidak melaksanakan kewajiban sebagaimana tersebut di atas, dikenai sanksi sesuai dengan ketentuan peraturan perundang-undangan. <br />1/13/2011<br />44<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  117. 117. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br />Pembubaran P.T. terjadi:<br /><ul><li>Berdasarkan keputusan RUPS.
  118. 118. Karena jangka waktu berdirinya yang ditetapkan dalam Anggaran Dasar telah berakhir.
  119. 119. Berdasarkan penetapan pengadilan.
  120. 120. Dengan dicabutnya kepailitan berdasarkan putusan pengadilan niaga yang telah mempunyai kekuatan hukum tetap, harta pailit P.T. tidak cukup untuk membayar biaya kepailitan.
  121. 121. Karena harta pailit P.T. yang telah dinyatakan pailit berada dalam keadaan insolvensi sebagaimana diatur dalam Undang-undang tentang Kepailitan dan Penundaan Kewajiban Pembayaran Utang.
  122. 122. Karena dicabutnya izin usaha P.T. sehingga mewajibkan P.T. melakukan likuidasi sesuai dengan ketentuan peraturan perundang-undangan.</li></ul>1/13/2011<br />45<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  123. 123. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>Dalam hal terjadi pembubaran P.T.:</li></ul> * Wajib diikuti dengan likuidasi yang <br /> dilakukan oleh likuidator.<br /> * P.T. tidak dapat melakukan perbuatan <br /> hukum, kecuali diperlukan untuk mem- <br /> bereskan semua urusan P.T. dalam <br /> rangka likuidasi.<br />1/13/2011<br />46<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  124. 124. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>Pembubaran P.T. terjadi karena hukum apabila jangka waktu berdirinya P.T. yang ditetapkan dalam Anggaran Dasar berakhir.
  125. 125. Dalam jangka waktu paling lambat 30 hari setelah jangka waktu berdirinya P.T. berakhir, RUPS menetapkan penunjukan likuidator.</li></ul>- Direksi tidak boleh melakukan perbuatan hukum baru atas nama P.T. setelah jangka waktu berdirinya P.T. yang ditetapkan dalam Anggaran Dasar berakhir.<br />1/13/2011<br />47<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  126. 126. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>PengadilanNegeridapatmembubarkan P.T. atas:</li></ul> * Permohonankejaksaanberdasarkanalasan P.T. <br />melanggarkepentinganumumatau P.T. melakukan<br />perbuatan yang melanggarperaturanperundang-<br />undangan.<br /> * Permohonanpihak yang berkepentinganberdasarkan<br />alasanadanyacacathukumdalamAktaPendirian.<br /> * Permohonanpemegangsaham, DireksiatauDewan<br />Komisarisberdasarkanalasan P.T. tidakmungkin<br />untukdilanjutkan.<br /><ul><li>Dalampenetapanpengadilanditetapkanjugape-</li></ul>nunjukanlikuidator.<br />1/13/2011<br />48<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  127. 127. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>Pembubaran P.T. tidak mengakibatkan P.T. kehilangan status badan hukum sampai dengan selesainya likuidasi dan pertanggungjawaban likuidator diterima oleh RUPS atau pengadilan.
  128. 128. Sejak saat pembubaran, pada setiap surat keluar P.T. dicantumkan kata “dalam likuidasi” di belakang nama P.T.</li></ul>1/13/2011<br />49<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  129. 129. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>Dalamjangkawaktu paling lambat 30 hariterhitungsejaktanggalpembubaran P.T., likuidatorwajibmemberitahukan:</li></ul> * Kepadasemuakreditormengenaipembubaran P.T. dengancaramengumumkanpembubaran P.T. dalamsuratkabardanBerita Negara R.I.<br /> * Pembubaran P.T. kepadaMenteriHukumdanHakAsasiManusia R.I. untukdicatatdalamDaftar Perseroan bahwa P.T. dalamlikuidasi.<br /> * PemberitahuandalamsuratkabardanBerita Negara R.I. memuat:<br /> - Pembubaran P.T. dandasarhukumnya.<br /> - Namadanalamatlikuidator.<br /> - Tata carapengajuantagihan.<br /> - Jangkawaktupengajuantagihan.<br />Jangkawaktupengajuantagihanadalah 60 hariterhitungsejak<br />tanggalpengumuman<br />1/13/2011<br />50<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  130. 130. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>Dalam hal pemberitahuan kepada Kreditor dan Menteri Hukum dan Hak Asasi Manusia R.I. belum dilakukan, pembubaran P.T. tidak berlaku bagi pihak ketiga.
  131. 131. Dalam hal likuidator lalai melakukan pem- beritahuan kepada Kreditor dan Menteri Hukum dan Hak Asasi Manusia R.I., likuidator secara tanggung renteng dengan P.T. bertanggung jawab atas kerugian yang diderita oleh pihak ketiga. </li></ul>1/13/2011<br />51<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  132. 132. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br />Kewajiban likuidator dalam melakukan pemberesan harta <br />kekayaan P.T. dalam proses likuidasi meliputi pe-<br />laksanaan:<br /><ul><li>Pencatatan dan pengumpulan kekayaan dan utang P.T.
  133. 133. Pengumuman dalam surat kabar dan Berita Negara R.I. mengenai rencana pembagian kekayaan hasil likuidasi.
  134. 134. Pembayaran kepada para kreditor.
  135. 135. Pembayaran sisa kekayaan hasil likuidasi kepada pemegang saham.
  136. 136. Tindakan lain yang perlu dilakukan dalam pelaksanaan pemberesan kekayaan.</li></ul>1/13/2011<br />52<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  137. 137. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>Likuidator bertanggung jawab kepada RUPS atau pengadilan yang mengangkatnya atas likuidasi P.T. yang dilakukan.</li></ul>- Likuidator wajib memberitahukan kepada Menteri Hukum dan Hak Asasi Manusia R.I. dan mengumumkan hasil akhir proses likuidasi dalam surat kabar setelah RUPS memberikan pelunasan dan pembebasan kepada likuidator atau setelah pengadilan menerima pertanggungjawaban likuidator yang ditunjuknya.<br />1/13/2011<br />53<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  138. 138. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br />MenteriHukumdanHakAsasiManusia R.I. mencatatberakhirnya status badanhukum P.T. danmenghapusnama P.T. dariDaftar Perseroan, termasukkarenapenggabungan, peleburanataupemisahan.<br />Penggabunganadalahperbuatanhukum yang dilakukanolehsatu Perseroan ataulebihuntukmenggabungkandiridengan Perseroan lain yang telahada yang mengakibatkanaktivadanpasivadari Perseroan yang menggabungkandiriberalihkarenahukumkepada Perseroan yang menerimapenggabungandanselanjutnya status badanhukum Perseroan yang menggabungkandiriberakhirkarenahukum.<br />Peleburanadalahperbuatanhukum yang dilakukanoleh 2 Perseroan ataulebihuntukmeleburkandiridengancaramendirikansatu Perseroan baru yang karenahukummemperolehaktivadanpasivadari Perseroan yang meleburkandiridan status badanhukum Perseroan yang meleburkandiriberakhirkarenahukum.<br />Pemisahanadalahperbuatanhukum yang dilakukanoleh Perseroan untukmemisahkanusaha yang mengakibatkanseluruhaktivadanpasiva Perseroan beralihkarenahukumkepada 2 Perseroan ataulebihatausebagianaktivadanpasiva Perseroan beralihkarenahukumkepada 1 Perseroan ataulebih.<br />1/13/2011<br />54<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  139. 139. PEMBUBARAN, LIKUIDASI DAN BERAKHIRNYA STATUS BADAN HUKUM P.T.<br /><ul><li>Pemberitahuan dan pengumuman pengakhiran status badan hukum P.T. tersebut dilakukan dalam jangka waktu paling lambat 30 hari terhitung sejak tanggal pertanggungjawaban likuidator diterima oleh RUPS atau pengadilan.
  140. 140. Menteri Hukum dan Hak Asasi Manusia R.I. mengumumkan berakhirnya status badan hukum P.T. dalam Berita Negara R.I.</li></ul>1/13/2011<br />55<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  141. 141. MACAM-MACAM P.T.<br />P.T. yang ada di Indonesia dapat dibedakan ke dalam 2 bentuk, yaitu:<br /><ul><li>P.T. Tertutup.</li></ul> Yang dimaksud dengan P.T. Tertutup adalah suatu P.T. yang saham-sahamnya masih dipegang oleh beberapa orang/<br /> perusahaan saja, sehingga jual beli sahamnya dilakukan dengan cara-cara yang ditentukan oleh Anggaran Dasar P.T., yang pada umumnya diserahkan kepada kebijaksanaan pemegang saham yang bersangkutan.<br />- P.T. Terbuka.<br /> Yang dimaksud dengan P.T. Terbuka adalah suatu P.T. yang <br /> modal dan sahamnya telah memenuhi syarat-syarat tertentu, dimana saham-sahamnya dipegang oleh banyak orang/ banyak perusahaan, yang penawaran sahamnya dilakukan kepada publik/ masyarakat sehingga jual beli sahamnya dilakukan melalui pasar modal.<br />1/13/2011<br />56<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  142. 142. KELEBIHAN P.T.<br /><ul><li>Pemilik P.T. memiliki tanggung jawab terbatas.
  143. 143. Ada pemisahan antara pemilik P.T. dengan pengurus P.T. sehingga RUPS dapat memilih pengurus yang mampu menjalankan P.T. sehingga dapat dicapai efisiensi.
  144. 144. Dengan dilakukannya pemilihan pengurus P.T. atas dasar kemampuan, maka kontinuitas P.T. lebih terjamin.
  145. 145. Modal dapat diperoleh dengan menjual saham, me- nerbitkan obligasi atau memperoleh pinjaman dari lembaga keuangan.
  146. 146. Pemilik P.T. dapat diganti tanpa membubarkan P.T.</li></ul>1/13/2011<br />57<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  147. 147. KELEMAHAN P.T.<br /><ul><li>Biaya organisasi besar dan pengorganisasiannya rumit.
  148. 148. Pajak Penghasilan dikenakan terhadap P.T. dan dividen para pemegang saham.
  149. 149. Pendirian P.T. relatif lebih rumit dibandingkan dengan bentuk usaha lainnya.
  150. 150. Bidang usaha P.T. sulit diubah karena selain sulit untuk mengubah Akta Pendirian, juga sulit untuk mengubah investasi yang telah ditanamkan.
  151. 151. Semakin besar suatu P.T., ada kecenderungan hubungan antar personal menjadi terlalu formal, selain itu ada perbedaan motif antara pemilik P.T. dengan pengurus P.T.</li></ul>1/13/2011<br />58<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />
  152. 152. TerimaKasih<br />1/13/2011<br />© 2010 Universitas Negeri Jakarta | www.unj.ac.id |<br />59<br />

×