Successfully reported this slideshow.
We use your LinkedIn profile and activity data to personalize ads and to show you more relevant ads. You can change your ad preferences anytime.

edukasyon sa pagpapakatao 10 Teaching Guide

284,988 views

Published on

esp 10 tg

Published in: Education
  • D0WNL0AD FULL ▶ ▶ ▶ ▶ http://1lite.top/FwPxy ◀ ◀ ◀ ◀
       Reply 
    Are you sure you want to  Yes  No
    Your message goes here
  • D0WNL0AD FULL ▶ ▶ ▶ ▶ http://1lite.top/FwPxy ◀ ◀ ◀ ◀
       Reply 
    Are you sure you want to  Yes  No
    Your message goes here
  • ⇒ www.WritePaper.info ⇐ is a good website if you’re looking to get your essay written for you. You can also request things like research papers or dissertations. It’s really convenient and helpful.
       Reply 
    Are you sure you want to  Yes  No
    Your message goes here
  • I'd advise you to use this service: ⇒ www.HelpWriting.net ⇐ The price of your order will depend on the deadline and type of paper (e.g. bachelor, undergraduate etc). The more time you have before the deadline - the less price of the order you will have. Thus, this service offers high-quality essays at the optimal price.
       Reply 
    Are you sure you want to  Yes  No
    Your message goes here
  • Great projects with clear instructions. I've gotten an enormous feeling of accomplishment pride from making my own bookshelves and side tables. Thanks Ted! ●●● https://url.cn/xFeBN0O4
       Reply 
    Are you sure you want to  Yes  No
    Your message goes here

edukasyon sa pagpapakatao 10 Teaching Guide

  1. 1. D EPED C O PY i Edukasyon sa Pagpapakatao Ang aklat na ito ay magkatuwang na inihanda at sinuri ng mga edukador mula sa mga publiko at pribadong paaralan at pamantasan. Hinihikayat namin ang mga guro at ibang nasa larangan ng edukasyon na mag-email ng kanilang puna at mungkahi sa Kagawaran ng Edukasyon sa action@deped.gov.ph. Mahalaga sa amin ang inyong mga puna at mungkahi. 10 Kagawaran ng Edukasyon Republika ng Pilipinas Gabay sa Pagtuturo Yunit 1 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015. VISIT DEPED TAMBAYAN http://richardrrr.blogspot.com/ 1. Center of top breaking headlines and current events related to Department of Education. 2. Offers free K-12 Materials you can use and share
  2. 2. D EPED C O PY ii Edukasyon sa Pagpapakatao – Ikasampung Baitang Gabay sa Pagtuturo Unang Edisyon 2015 ISBN: Paunawa hinggil sa karapatang-sipi. Isinasaad ng Seksiyon 176 ng Batas Pambansa Bilang 8293: Hindi maaaring magkaroon ng karapatang sipi sa ano mang akda ng Pamahalaan ng Pilipinas. Gayon pa man, kailangan muna ang pahintulot ng pamahalaan o tanggapan kung saan ginawa ang isang akda upang magamit sa pagkakakitaan ang nasabing akda. Kabilang sa mga maaaring gawin ng nasabing ahensiya o tanggapan ay ang patawan ng bayad na royalty bilang kondisyon. Ang mga akda / materyales (mga kuwento, seleksiyon, tula, awit, larawan, ngalan ng produkto o brand names, tatak o trademarks, palabas sa telebisyon, pelikula, atbp.) na ginamit sa aklat na ito ay sa nagtataglay ng karapatang-ari ng mga iyon. Pinagtibay sa isang kasunduan ng Kagawaran ng Edukasyon at Filipinas Copyright Licensing Society (FILCOLS), Inc. na ang FILCOLS ang kumakatawan sa paghiling ng pahintulot sa nagmamay-ari ng mga akdang hiniram at ginamit dito. Hindi inaangkin ni kinakatawan ng tagapaglathala (publisher) at mga may-akda ang karapatang-aring iyon. Inilathala ng Kagawaran ng Edukasyon Kalihim: Br. Armin A. Luistro FSC Pangalawang Kalihim: Dina S. Ocampo, PhD Mga Bumuo ng Gabay sa Pagtuturo Mga Konsultant: Manuel B. Dy Jr., PhD at Fe A. Hidalgo, PhD Editor: Luisita B. Peralta Mga Manunulat: Mary Jean B. Brizuela, Patricia Jane S. Arnedo, Goeffrey A. Guevara, Earl P. Valdez, Suzanne M. Rivera, Elsie G. Celeste, Rolando V. Balona Jr., Benedick Daniel O. Yumul, Glenda N. Rito, at Sheryll T. Gayola Tagaguhit: Gilbert B. Zamora Naglayout: Jerby S. Mariano Mga Tagapamahala: Dir. Jocelyn DR. Andaya, Jose D. Tuguinayo, Jr., Elizabeth G. Catao, at Luisita B. Peralta Inilimbag sa Pilipinas ng FEP Printing Corporation Department of Education-Instructional Materials Council Secretariat (DepEd-IMCS) Office Address: 5th Floor Mabini Bldg., DepEd Complex Meralco Avenue, Pasig City Philippines 1600 Telefax: (02) 634-1054 or 634-1072 E-mail Address: imcsetd@yahoo.com All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  3. 3. D EPED C O PY Talaan ng Nilalaman Unang Markahan Modyul1:AngMgaKatangianngPagpapakatao................................................1 Ano ang Inaasahang Maipamamalas Mo?..................................................3 Paunang Pagtataya ....................................................................................3 Pagtuklas ng Dating Kaalaman ..................................................................4 Paglinang ng mga Kaalaman, Kakayahan, at Pag-unawa .........................5 Pagpapalalim ..............................................................................................5 Pagsasabuhay ng mga Pagkatuto ..............................................................8 Modyul2:AngMataasnaGamitatTunguhinngIsipatKilos-loob......................11 Ano ang Inaasahang Maipamamalas Mo? ...............................................13 Paunang Pagtataya ..................................................................................13 Pagtuklas ng Dating Kaalaman ................................................................14 Paglinang ng mga Kaalaman, Kakayahan, at Pag-unawa .......................15 Pagpapalalim ............................................................................................16 Pagsasabuhay ng mga Pagkatuto ............................................................19 Modyul3:PaghubogngKonsensiyaBataysaLikasnaBatasMoral..................27 Ano ang Inaasahang Maipamamalas Mo? ...............................................29 Paunang Pagtataya ..................................................................................29 Pagtuklas ng Dating Kaalaman ................................................................30 Paglinang ng mga Kaalaman, Kakayahan, at Pag-unawa .......................30 Pagpapalalim ............................................................................................31 Pagsasabuhay ng mga Pagkatuto ............................................................33 Modyul4:AngMapanagutangPaggamitngKalayaan .................................38 Ano ang Inaasahang Maipamamalas Mo? ...............................................40 Paunang Pagtataya ..................................................................................41 Pagtuklas ng Dating Kaalaman ................................................................42 Paglinang ng mga Kaalaman, Kakayahan, at Pag-unawa .......................43 Pagpapalalim ........................................................................................44 Pagsasabuhay ng mga Pagkatuto ............................................................47 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  4. 4. D EPED C O PY RepublikangPilipinas KagawaranngEdukasyon DepEdComplex,MeralcoAvenue LungsodngPasig Disyembre2013 Kto12GabayPangkurikulum EDUKASYONSA PAGPAPAKATAO Baitang10 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  5. 5. D EPED C O PY viii Kto12BASICEDUCATIONCURRICULUM ANGBATAYANGKONSEPTWALNGEDUKASYONSAPAGPAPAKATAO Angtunguhino”outcome”ngpag-aaralsabatayangedukasyonayangpanlahatangpag–unladtaglayangmgakasanayansaika–dalawampu’tisangsiglo. Taglayitongisangmag-aaralkungmayroonsiyangmgakakayahangpangkaalaman,pandamdaminatpangkaasalannamagbibigaysakanyangkakayahan upang: 1.mamuhayatmagtrabaho 2.malinangangkanyangmgapotensiyal 3.magpasiyanangmapanuriatbataysaimpormasyon 4.makakilosnangepektibosalipunanatpamayanansakontekstongsandaigdiganupangmapabutianguringkanyangpamumuhayatngkanyang lipunan(LiteracyCoordinatingCouncil,Setyembre1997). IbinatayangkahuluganatanglimangpalatandaannitosaApatnaBatayan(Pillar)ngEdukasyonatsakonseptongUNESCOtungkolsamga panghabambuhaynakakayahan(lifeskills)nabinuongInternationalCommissiononEducationparasaika-21siglo.Angsumusunodanglimangpalatandaan nito:(a)maykakayahangmakipagtalastasan,(b)nag-iisipnangmapanuriatmaykakayahanglumutasngsuliranin,(c)ginagamitangmgalikasnayaman nangmapanagutanparasasusunodnasalinlahiat(d)produktibo,napauunladangsariliatangpakikipagkapwa,at(e)maymalawaknapananawsadaigdig. SaEdukasyonsaPagpapakatao(EsP),angpalatandaanobatayangkakayahanngfunctionalliteracyaynagpapasyaatkumikilosnangmapanagutantungosa kabutihangpanlahat.Ibigsabihin,nilalayonngEsPnalinanginatpaunlarinangpagkataongetikalngmag-aaral.AngEsPaynaglalayonggabayanangmag- aaralnamahanap/matagpuanangkabuluhanngkanyangbuhay,angpapelniyasalipunangPilipinoupangmakibahagisiyasapagtatayongpamayanang pinaiiralangkatotohanan,kalayaan,katarunganatpagmamahal.Upangmaipamalasito,kailangangtaglayniyaanglimangpangunahingkakayahan(macro skills)*:pag-unawa,pagninilay,pagsangguni,pagpapasiyaatpagkilos. 1.Pag-unawa.Mahalagangmaipamalasniyaangkakayahangmahinuhaangmgakonseptoatprinsipyongnagbibigay-paLiwanagsasarilingkaranasan, mgasitwasyongnamasid,sinuriatpinagnilayangamitangobhektibongpamantayanngmoralnapamumuhay. 2.Pagninilay.Sagitnangmabilisnadaloyngimpormasyonatingayngkapaligiran,kailangangmag-ukolngpanahonangmag-aaralsamaingatat malalimnapag-iisipsamgasitwasyongnaobserbahanatmgakonseptongnatutuhantungkolsamoralnapamumuhay. 3.Pagsangguni.Kailanganghumingisiyangpayoogabaysamgataongmayhigitnakaalamanokasanayansamoralnapamumuhayatmarunong magsala(weigh)ngmgaimpormasyongmulasaiba’tibanguringmediabataysaobhektibongpamantayanngmoralnapamumuhay. 4.Pagpapasiya.Kailangangmatutosiyangbumuongsarilingposisyon,paniniwala,paninindiganokilosnaisasagawabataysaobhektibongpamantayan ngmoralnapamumuhay. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  6. 6. D EPED C O PY ix Kto12BASICEDUCATIONCURRICULUM 5.Pagkilos.Mahalagangmailapatniyaangkonseptooprinsipyongnahinuhamulasamgakonkretongsitwasyonngbuhayatmaipakitaangkahandaang isabuhayangmgamabutingugali(virtues)nanatutuhanbataysaobhektibongpamantayanngmoralnapamumuhay. Angmgapangunahingkakayahangitoaynililinangsaapatnatemasabawattaonsaparaang“expandingspiral”mulaKindergartenhanggangGrade12.Ang sumusunodangapatnatema:(a)PananagutangPansariliatPagigingKasapingPamilya,(b)PakikipagkapwaatKatataganngPamilya,(c)PaggawaTungosa PambansangPag-unladatPakikibahagisaPandaigdigangPagkakaisa,at(d)Pagkamaka-DiyosatPreperensyasaKabutihan.Pitongpangunahing pagpapahalaga(corevalues)angnililinangsamgatemangito:KalusuganatPakikiisasaKalikasan,KatotohananatPaggalang,PagmamahalatKabutihan, Ispiritwalidad,KapayapaanatKatarungan,Likas-kayangPag-unlad,Pagkamaka-PilipinoatPakikibahagisaPambansangPagkakaisa(ValuesEducationforthe Filipino:1997RevisedVersionoftheDECSValuesEducationProgram,ph.10-11). AngPilosopiyaatmgaBatayangTeoryangPagtuturo-Pagkatuto AngBatayangKonseptwalngEdukasyonsaPagpapakataoaybataysapilosopiyangPersonalismotungkolsapagkataongtaoatsaEtikangKabutihangAsal (VirtueEthics).AyonsapilosopiyangPersonalismo,nakaugatlagisapagpapakataoangatingmgaugnayan.Nililikhanatinangatingpagpapakataosaating pakikipagkapwa.SaVirtueEthicsnaman,sinasabingangisangmabutingtaoaynagsasabuhayngmgavirtueomabutinggawi(habits)atumiiwassamga bisyoomasamanggawi.Samakatwid,angnagpapabutisataoayangpagtataglayatangpagsasabuhayngmgamabutinggawi. Samurangedadna6hanggang12taon,maaaringhindipalubosnamaunawaanngisangbataangkanyangpagkataobilangtaoayonsapaLiwanagng pilosopiyangPersonalismo.Ngunitmaaarisiyangsanayinsamgavirtueatpagpapahalagaupanglumakisiyangisangmabutingtao.Samgaedadnaito, mauunawaanniyanadapatsiyangmagpakabutihindilamangsapagkatitoanginaasahansakanyanglipunankundidahiltaosiya-maydignidadatlikas angpagigingmabuti.Maydignidadangtaodahilsiyaaybukod-tangiatmayugnayansakanyangkapwa,saDiyos,atkalikasan. AngInteraktibongTeoryangPagkatuto(SocialLearningTheory)niAlbertBandura,PagkatutongPangkaranasan(ExperientialLearning)niDavidKolb, Konstruktibismo(Constructivism)atTeoryangPamimilingKurso(TheoryofCareerDevelopment)niGinzberg,et.al.atSuperangibapangteoryana nagpapaLiwanagkungpaanonatututoangmag-aaralsaEsP. AyonsapaLiwanagngInteraktibongTeoryangPagkatuto(SocialLearningTheory)niAlbertBandura,maaaringmakuhasapagmamasidsaibangtaoang mgapagkatutotuladngpagkakaroonngmabutingugaliatbagongimpormasyon.Ayonparinsateoryangito,mahalagaangmgainiisipngtaosakanyang pagkatutongunithindinangangahulugangmagbubungaitongpagbabagosakilos. AngmgakaranasandinangpinagkukunanngmgapagkatutoayonkayDavidKolbatsaTeoryangPagkatutongKonstruktibismo.AyonsaTeoryang PagkatutongPangkaranasanniKolb,angmganasaedad(adults)aynatututosapamamagitanngkanilangpagninilaysakanilangmgakaranasan,pagbuong mgakonklusyonoinsightmulasamgaito,atpaglalapatngmgaitosaangkopnamgasitwasyonngbuhay.SinusuportahanangpananawniKolbngTeorya ngKonstruktibismo.Sinasabingteoryangitonanagkakaroonngpagkatutoangtaoatgumagawangkabuluhan(meaning)bataysakanyangmgakaranasan. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  7. 7. D EPED C O PY x Kto12BASICEDUCATIONCURRICULUM Naipamamalasitosapagtuturosapamamagitanngpagbibigayngtuonsamag-aaral.Nagkakaroonsiyangmgabagongpagkatutogamitangmgatanongng guroatngkanyangmalikhaingparaan. Nailalapatangmgapagkatutongitosapaggawangmgapasiyatuladngkukuningkursoopropesyon.AyonsaTeoryangCareerDevelopmentninaGinzberg, et.al.atSuper,dumadaansaiba’tibangyugtoangpagpapasyangbataukolsakursoopropesyonbataysakanyangpagtinginsasarili(self-concept), saloobin(attitude)atmgapagpapahalaga.Tinatanggapotinatanggihanniyaangisangkursootrabahobataysaobserbasyonniya(halimbawa,mgakilosng kanyangmagulangayonsapropesyonnito)atsatinuturingniyangmahalaga(halimbawa,malakingsweldoopaglilingkodsalipunan). MgaDisiplinangEdukasyonsaPagpapakatao AngnilalamanatistrakturangEdukasyonsaPagpapakataoaynakaanklasadalawangdisiplina:EthicsatCareerGuidance.AngEtikaayangsiyensyang moralidadngkilosngtao.SamantalangCareerGuidancenamanangpaggabaysamag-aaralnamagpasiyangkursongakademiko,siningatisportso teknikal-bokasyonalnatugmasakanyangmgatalento,kakayahanataptitudeatmgatrabahongkailanganngindustriya. MgaDulogsaPagtuturo Angmgapangunahingdulognagagamitinsapagtuturongmgakonseptoayangpagpapasyangetikal(ethicaldecisionmaking)sapamamagitanngpagsusuri ngsuliraninoisyu),angPanlipunan–PandamdamingPagkatuto(Social-EmotionalLearning),atpagpaplanongkursongakademikooteknikal-bokasyonal. Angpaggawangpagpapasyangetikalomoralayangpagbuongpasiyanamaypreperensyasakabutihanatmagpapatingkadomaglilinangngpagkataong tao.Prosesoitonakinapapaloobanng(a)pag-alamsamgadetalyengsitwasyonat(b)maingatnapagsasaalang-alangngmgamoralnapagpapahalagana mahalagasaisangsitwasyon.Mahalagarinditoangpagigingsensitibosamgaaspetongmoralngmgasitwasyonsapang-araw-arawnabuhayatang kamalayansamgataoopangkatnamaaapektuhanngpasiya. AngPanlipunan–PandamdamingPagkatuto(Social-EmotionalLearning)ayangpagkakaroonngmgakakayahangkailangansapagkilalaatpamamahalang sarili,paglinangngpagmamalasakitsakapwa,paggawangmapanagutangpasiya,pakikipag-ugnayan,atpagharapnangepektibosamgamapanghamong sitwasyon.Paraanitongpaglinangngmgakakayahanngmag-aaralupangmagtagumpaysamgagawainsabuhay.Nahahatisalimanguriangmga kakayahangito:KamalayangPansarili,PamamahalangSarili,KamalayangPanlipunan,PamamahalangPakikipag-ugnayanatMapanagutangPagpapasiya. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  8. 8. D EPED C O PY xi Kto12BASICEDUCATIONCURRICULUM Figure1.AngBatayangKonseptwalngEdukasyonsaPagpapakatao PilosopiyangPersonalismo All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  9. 9. D EPED C O PY xii Kto12BASICEDUCATIONCURRICULUM DeskripsyonngAsignatura AngEdukasyonsaPagpapakatao(EsP)ayisasamgaasignaturangPinaunladnaProgramangBatayangEdukasyonnaKto12nagagabayat huhubogsamgakabataan.Tunguhinnitoangpaghubogngkabataangnagpapasyaatkumikilosnangmapanagutantungosakabutihangpanlahat. Nangangahuluganitonalilinanginatpauunlarinangpagkataongetikalngbawatmag-aaral.Upangmaipamalasito,kailangangmagtaglaysiyanglimang pangunahingkakayahan(macroskills):pag-unawa,pagninilay,pagsangguni,pagpapasyaatpagkilos. NililinangsaapatnatemasabawatantasmulaKindergartenhanggangBaitang10angmgapangunahingkakayahangito:(a)PananagutangPansarili atMabutingKasapingPamilya,(b)Pakikipagkapwa-tao,(c)PaggawaTungosaPambansangPag-unladatPakikibahagisaPandaigdigangPagkakaisa,at(d) PananaligatPagmamahalsaDiyosatPaninindigansaKabutihan. MGAPAMANTAYANSAPROGRAMA(LEARNINGAREASTANDARDS) Naipamamalasngmag-aaralangpag-unawasamgakonseptosapananagutangpansarili,pamilya,kapwa,bansa/daigdigatDiyos;nakapagpapasiyaat nakakikilosnangmapanagutantungosakabutihangpanlahatupangmamuhaynangmaayosatmaligaya. PANGUNAHINGPAMANTAYANNGBAWATYUGTO(KEYSTAGESTANDARDS) K–Baitang3Baitang4–6Baitang7–10 Naipamamalasngmag-aaralangpag-unawasa konseptoatgawaingnagpapakitangpananagutang pansarili,pampamilya,pagmamahalsakapwa/ pamayanan,sabansaatsaDiyostungosamaayos atmasayangpamumuhay. Naipamamalasngmag-aaralangpag-unawasa konseptoatgawaingnagpapakitang pananagutangpansarili,pampamilya, pagmamahalsakapwa,sabansa/daigdigatsa Diyostungosakabutihangpanlahat. Naipamamalasngmag-aaralangpag-unawasa mgakonseptosapananagutangpansarili, pagkataongtao,pamilyaatpakikipagkapwa, lipunan,paggawaatmgapagpapahalagangmoral atnagpapasiyaatkumikilosnangmapanagutan tungosakabutihangpanlahatupangmamuhay nangmaykaayusanatkaligayahan. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  10. 10. D EPED C O PY xiii Kto12BASICEDUCATIONCURRICULUM ANGBATAYANGKONSEPTWALNGEDUKASYONSAPAGPAPAKATAO GradeLevelStandards(PamantayansaBawatBaitang/Antas) BAITANGPAMANTAYAN K Naipamamalasngmag-aaralangpag-unawasapagkakaroonngkamalayansapaggalangatpagmamahalsasarili,kapwaatDiyosbilang gabaytungosamaayosatmasayangtahanan. 1 Naipamamalasngmag-aaralangpag-unawasamgaparaanngpaggalangsasarili,kapwa,bansaatDiyosbilanggabaytungosamaayosat masayangtahananatpaaralan. 2 Naipamamalasngmag-aaralangpag-unawasapagpapakikitangmgakilosnanagpapahalagasasarili,kapwa,bansa,Diyosatsa Kanyangmganilikhabilangpatnubaysamaayosatmasayangpaaralanatpamayanan. 3 Naipamamalasngmag-aaralangpag-unawasamgagawainnanagpapakitangpagpapahalagatungosamaayosatmasayang pamumuhaynamaymapanagutangpagkilosatpagpapasiyaparasasarili,kapwa,pamayanan,bansaatDiyos. 4 Naipamamalasngmag-aaralangpag-unawasamgamakabuluhanggawainnamaykaakibatnapagpapahalagatungosawasto, maayos,masayaatmapayapangpamumuhayparasasarili,kapwa,bansaatDiyos. 5 Naipamamalasngmag-aaralangpag-unawasamasusingpagsusurisapagpapahayag,pagganapngtungkulinnamay pananagutanatpagsasabuhayngmgaitotungosamasaya,mapayapaatmaunladnapamumuhayparasasarili/mag-anak, kapwa/pamayanan,bansa/daigdigatDiyos. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  11. 11. D EPED C O PY xiv Kto12BASICEDUCATIONCURRICULUM BAITANGPAMANTAYAN 6 Naipamamalasngmag-aaralangpag-unawasamgagawainnatumutulongsapag-angatngsarilingdignidad,pagmamahalsakapwa namaymapanagutangpagkilosatpagpapasiyatungosamaayos,mapayapaatmaunladnapamumuhayparasakabutihangpanlahat. 7 Naipamamalasngmag-aaralangpag-unawasamgaangkopnainaasahangkakayahanatkilossapanahonngpagdadalaga/ pagbibinata,kakayahanattalento,hiligatpagkataongtaotungosapagtupadngmgatungkulinsasarili,sakapwa,sabansa/ daigdigatsaDiyosatpagtatakdangmithiinupangmapanagutanangkahihinatnanngmgapasyaatkilos. 8 Naipamamalasngmag-aaralangpag-unawasalayuninatkahalagahanngpamilyaatpakikipagkapwaupangmagingmapanagutansa pakikipag-ugnayansaibatungosamakabuluhangbuhaysalipunan. 9Naipamamalasngmag-aaralangpag-unawasamgakonseptotungkolsalipunanatpaggawabilangpaglilingkodtungosa tamangpagpilingkursoohanapbuhaynamagigingmakabuluhanatkapaki-pakinabangsakanyaatsalipunan. 10 Naipamamalasngmag-aaralangpag-unawasamgakonseptotungkolsapagkataongtao,makataongkilos,pagpapahalagangmoral atmgaisyungmoralatnagpapasyaatkumikilosnangmaypreperensyasakabutihanupangmagingmatatagsagitnangmgaisyungmoral atimpluwensyangkapaligiran. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  12. 12. D EPED C O PY xv GABAYPangkurikulumsaEdukasyonsaPagpapakatao(ESP) BAITANG10 NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE UNANGMARKAHAN:AngMoralnaPagkatao Pamantayang Pangnilalaman Naipamamalasngmag-aaralangpag-unawasamgakonseptotungkolsapagpapakataoatpagkatao ngtaoupangmakapagpasiyaatkumilosnangmaypreperensyasakabutihan. BatayangKonsepto Angpag-unawasakahalagahanngpagkilosayonsapagkataongtaoaydaantungosapagiging moralnanilalang. 1.AngmgaKatangian ngPagpapakatao Naipamamalasng mag-aaralangpag- unawasamga katangianng pagpapakatao. Nailalapatngmag- aaralangmga tiyaknahakbang upang paunlarinangmga katangianng pagpapakatao. 1.1Natutukoyangmgakatangianng pagpapakatao EsP10MP -Ia-1.1 1.2Nasusuriangsarilikunganong katangianngpagpapakataoang makatutulongsapagtupadngiba’t ibangpapelsabuhay(upang magampananangkaniyangmisyon sabuhay) EsP10MP -Ia-1.2 1.3Napatutunayannaangpag-unlad samgakatangianngpagpapakatao ayinstrumentosapagganapngtao sakaniyangmisyonsabuhaytungo sakaniyangkaligayahan. EsP10MP -Ib-1.3 1.4Nailalapatangmgatiyakna hakbangupangpaunlarinangmga katangianngpagpapakatao EsP10MP -Ib-1.4 Pangkalahatang Pamantayan Naipamamalasngmag-aaralangpag-unawasamgakonseptotungkolsapagpapakatao, makataongkilos,pagpapahalagangmoralatmgaisyungmoralatnagpapasiyaatkumikilosnang maypreperensyasakabutihanupangmagingmatatagsagitnangmgaisyungmoralat impluwensyangkapaligiran. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  13. 13. D EPED C O PY xvi NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 2.AngMataasna GamitatTunguhin ngIsipatKilos-Loob (Will) Naipamamalasng mag-aaralangpag- unawasamga konseptotungkolsa paggamitngisipsa paghahanapng katotohananat paggamitngkilos- loobsapaglilingkod/ pagmamahal. Nakagagawaang mag-aaralngmga angkopnakilos upangmaipakita angkakayahang hanapinang katotohananat maglingkodat magmahal. 2.1Natutukoyanggamitattunguhin ngisipatkilos-loobsaangkopna sitwasyon EsP10MP -Ic-2.1 2.2Nasusurikungginamitnangtama angisipatkilos-loobayonsa tunguhinngmgaito EsP10MP -Ic-2.2 2.3Naipaliliwanagnaangisipatkilos- loobayginagamitparalamangsa paghahanapngkatotohananatsa paglilingkod/pagmamahal EsP10MP -Ic-2.3 2.4Nakagagawangmgaangkopna kilosupangmaipakitaang kakayahanghanapinang katotohananatmaglingkodat magmahal EsP10MP -Ic-2.4 3.Paghubogng Konsensiyabataysa LikasnaBatasMoral Naipamamalasng mag-aaralangpag- unawasakonsepto ngpaghubogng konsiyensiyabatay saLikasnaBatas Moral. Nakagagawaang mag-aaralng angkopnakilos upangitamaang mgamaling pasiyangginawa. 3.1Nakikilalaangmgayugtong konsensiyasa pagsusuriopagninilaysaisang pagpapasiyangginawa EsP10MP -Id-3.1 3.2Nakapagsusuringmgapasiyang ginawabataysamgaPrinsipyong LikasnaBatasMoral EsP10MP -Id-3.2 3.3Napatutunayannaang konsensiyangnahubogbataysa LikasnaBatasMoralaynagsisilbing gabaysatamangpagpapasiyaat pagkilos EsP10MP -Ie-3.3 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  14. 14. D EPED C O PY xvii NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 3.Paghubogng Konsensiyabataysa LikasnaBatasMoral Naipamamalasng mag-aaralangpag- unawasakonsepto ngpaghubogng konsiyensiyabatay saLikasnaBatas Moral. Nakagagawaang mag-aaralng angkopnakilos upangitamaang mgamaling pasiyangginawa. 3.4Nakagagawangangkopnakilos bataysakonsensiyangnahubogng LikasnaBatasMoral EsP10MP -Ie-3.4 4.AngMapanagutang PaggamitngKalayaan Naipamamalasng mag-aaralangpag- unawasatunayna kahuluganng kalayaan. Nakagagawaang mag-aaralngmga angkopnakilos upangmaisabuhay angpaggamitng tunaynakalayaan: tumugonsatawag ngpagmamahalat paglilingkod. 4.1Natutukoyangmgapasiyaatkilos natumutugonsatunaynagamit ngkalayaan EsP10MP -If-4.1 4.2Nasusuriangtunaynakahulugan ngkalayaan EsP10MP -If-4.2 4.3Naipaliliwanagnaangtunayna kalayaanayangkakayahang tumugonsatawagngpagmamahal atpaglilingkod EsP10MP -Ig-4.3 4.4Nakagagawangmgaangkopna kilosupangmaisabuhayang paggamitngtunaynakalayaan: tumugonsatawagngpagmamahal atpaglilingkod EsP10MP -Ig-4.4 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  15. 15. D EPED C O PY xviii NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE IKALAWANGMARKAHAN:AngMakataongKilos Pamantayang Pangnilalaman Naipamamalasngmag-aaralangpag-unawasamgakonseptotungkolsamakataongkilosupang makapagpasiyanangmaypreperensyasakabutihansagitnangmgaisyungmoralatimpluwenysa ngkapaligiran. BatayangKonsepto Angpag-unawasamgakonseptongmoralidadngkilosaygabaysapagpilingmoralnapasiyaat kilossagitnangmgaisyungmoralatimpluwensyangkapaligiran. 5.AngPagkukusang MakataongKilosat MgaSalikna Nakaaapektosa PananagutanngTao saKahihinatnanng KilosatPasiya Naipamamalasng mag-aaralangpag- unawasakonsepto ngpagkukusang makataongkilosat mgasaliksa nakaaapektosa pananagutanngtao sakahihinatnanng kilosatpasiya. Nakapagsusuriang mag-aaralng: a.sarilingkilosna dapat panagutanat nakagagawang paraanupang maging mapanagutan sapagkilos b.sarilibataysa mgasalikna nakaaapektosa pananagutan ngtaosa kahihinatnanng kilosatpasiya atnakagagawa 5.1Nakikilala: a.namaypagkukusasa makataongkiloskung nagmumulaitosamalayang pagsasagawangkilos-loobsa pamamatnubayngisip. b.angbawatsaliknanakaaapekto sapananagutanngtaosa kahihinatnanngkaniyangkilosat pasiya EsP10MK -IIa-5.1 5.2Nakapagsusuring: a.mgakilosnamaypanagutan b.mgasitwasyongnakaaapektosa pagkukusasakilosdahilsa kamangmangan,masidhing damdamin,takot,karahasanat gawi EsP10MK -IIa-5.2 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  16. 16. D EPED C O PY xix NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 5.AngPagkukusang MakataongKilosat MgaSalikna Nakaaapektosa PananagutanngTao saKahihinatnanng KilosatPasiya Naipamamalasng mag-aaralangpag- unawasakonsepto ngpagkukusang makataongkilosat mgasaliksa nakaaapektosa pananagutanngtao sakahihinatnanng kilosatpasiya. ngmga hakbangupang mahubogang kaniyang kakayahansa pagpapasiya 5.3Napatutunayanna: a.Angmakataongkilosaysinadya (deliberate)atniloobngtao, gamitangisip,kaya pananagutanniyaang kahihinatnannito(kabutihano kasamaan). b.Nakaaapektoang kamangmangan,masidhing damdamin,takot,karahasanat gawisapananagutanngtaosa kahihinatnanngkaniyangkilos dahilmaaaringmawalaang pagkukusangkilos. EsP10MK -IIb-5.3 5.4Nakapagsusuring: a.sarilingkilosnadapatpanagutan atnakagagawangparaanupang magingmapanagutansa pagkilos b.Sarilibataysamgasalikna nakaaapektosapananagutanng taosakahihinatnanngkilosat pasiyaatnakagagawangmga hakbangupangmahubogang kaniyangkakayahansa pagpapasiyanangtamaat mabuti EsP10MK -IIb-5.4 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  17. 17. D EPED C O PY xx NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 6.Layunin,Paraan, Sirkumstansiya,at Kahihinatnanng MakataongKilos Naipamamalasng mag-aaralangpag- unawasalayunin, paraanatmga sirkumstansiyang makataongkilos. Nakapagsusuriang mag-aaralng kabutihano kasamaanng sarilingpasiyao kilossaisang sitwasyonbataysa layunin,paraanat sirkumstansiya nito. 6.1Naipaliliwanaganglayunin,paraan atsirkumstansiya,atkahihinatnan ngmakataongkilos EsP10MK -IIc-6.1 6.2Nakapagsusuringkabutihano kasamaanngsarilingpasiyaokilos saisangsitwasyonbataysa layunin,paraan,sirkumstansiya,at kahihinatnannito EsP10MK -IIc-6.2 6.3Napatutunayannaanglayunin, paraan,sirkumstansiya,at kahihinatnanngkilosay nagtatakdangpagkamabutio pagkamasamanito EsP10MK -IId-6.3 6.4Nakapagtatayangkabutihano kasamaanngpasiyaokilossa isangsitwasyongmaysuliranin (dilemma)bataysalayunin,paraan sirkumstansiya,atkahihinatnan nito EsP10MK -IId-6.4 7.AngKabutihano KasamaanngKilos AyonsaPaninindigan, GintongAralat Pagpapahalaga Naipamamalasng mag-aaralangpag- unawasakabutihan okasamaanngkilos ayonsa pagpapahalaga. Naitatamang mag-aaralang isangmalingkilos sapamamagitan ngpagpapasiya gamitangmas mataasna pagpapahalaga. 7.1Natutukoyangbatayansa paghusgasakabutihano kasamaanngkilosayonsa panininindigan,GintongAralat mataasnaPagpapahalaga EsP10MK -IIe-7.1 7.2Nakapagsusurikungpaanopaiiralin angmasmataasnapagpapahalaga saisangsitwasyongmayconflict EsP10MK -IIe-7.2 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  18. 18. D EPED C O PY xxi NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 7.AngKabutihano KasamaanngKilos AyonsaPaninindigan, GintongAralat Pagpapahalaga Naipamamalasng mag-aaralangpag- unawasakabutihan okasamaanngkilos ayonsa pagpapahalaga. Naitatamang mag-aaralang isangmalingkilos sapamamagitan ngpagpapasiya gamitangmas mataasna pagpapahalaga. 7.3Naipaliliwanagnakasamasa nararapatnagamitingbatayansa paghusgangkabutihanokasamaan ngkilosangKautusangWalang Pasubali,GintongAralatmga pagpapahalaga EsP10MK -IIf-7.3 7.4Naitatamaangisangmalingkilossa pamamagitanngpaggawangmga tiyaknahakbangbataysa paninidigan,GintongAral,atmas mataasnapagpapahalaga EsP10MK -IIf-7.4 8.MgaYugtong MakataongKilosat MgaHakbangsa Moralna Pagpapasiya Naipamamalasng mag-aaralangpag- unawasamga yugtongmakataong kilosatmga hakbangsamoral napagpapasiya. Nakapagsusuriang mag-aaralng sarilingkilosat pasiyabataysa mgayugtong makataongkilosat nakagagawang planoupang maitamaangkilos opasiya. 8.1Naipaliliwanagangbawatyugtong makataongkilosatmgahakbang samoralnapagpapasiya EsP10MK -IIg-8.1 8.2Natutukoyangmgakilosat pasiyangnagawana umaayonsabawatyugtong makataongkilos EsP10MK -IIg-8.2 8.3Naipaliliwanagnaangbawatyugto ngmakataongkilosaykakikitaan ngkahalagahanngdeliberasyonng isipatkatataganngkilos-loobsa paggawangmoralnapasiyaat kilos EsP10MK -IIh-8.3 8.4Nakapagsusuringsarilingmgakilos atpasiyabataysamgayugtong makataongkilosatnakagagawang planoupangmaitamaangmga kilosopasiya EsP10MK -IIh-8.4 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  19. 19. D EPED C O PY xxii NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE IKATLONGMARKAHAN:MgaPangunahingBirtudatPagpapahalagangMoral Pamantayang Pangnilalaman Naipamamalasngmag-aaralangpag-unawasamgakonseptotungkolsamgapagpapahalagang moralupangmakapagpasiyaatmakakilostungosamakabuluhanatmabutingpakikipag-ugnayansa Diyos,sakapwaatsakapaligiran. BatayangKonsepto Angpag-unawasamgakonseptotungkolsamgapagpapahalagangmoralaykailanganupang makapagpasiyaatmakakilosnangmaypreperensyasakabutihan. 9.Maingatna Paghuhusga (Prudence) Naipamamalasng mag-aaralangpag- unawasamaingat napaghuhusga (prudence). Nakagagawaang mag-aaralngmga angkopnakilosna nagpapakitang maingatna paghuhusga. 9.1Natutukoyangmgakilosna nagpapakitangmaingatna paghuhusga EsP10PB -IIIa-9.1 9.2Nasusuriangmgakilosna nagpapakitangmaingatna paghuhusga EsP10PB -IIIa-9.2 9.3Napatutunayannaangmaingatna paghuhusgaaymahalagang kasanayansatamangpagpapasiya upangmapaunladangpaninindigan sapagpapakatao EsP10PB -IIIb-9.3 9.4Nakagagawangmgaangkopna kilosnanagpapakitangmaingatna paghuhusga EsP10PB -IIIb-9.4 10.Pagmamahalsa Bayan Naipamamalasng mag-aaralangpag- unawasa pagmamahalsa bayan. Nakagagawaang mag-aaralng angkopnakilos upangmaipamalas angpagmamahal saBayan (Patriyotismo). 10.1Nakikilalasasariliangmga indikasyonngpagmamahalsa bayan EsP10PB -IIIc-10.1 10.2Nahuhusgahanangangkopna kilosotugonsamgasitwasiyong kailanganangmapanuringpag- iisipbilangpagpapakitang EsP10PB -IIIc-10.2 EsP10PB -IIIc-10.2 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  20. 20. D EPED C O PY xxiii NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 10.Pagmamahalsa Bayan Naipamamalasng mag-aaralangpag- unawasa pagmamahalsa bayan. Nakagagawaang mag-aaralng angkopnakilos upangmaipamalas angpagmamahal saBayan (Patriyotismo). pagmamahalsabayan 10.3Nahihinuhanaangpagmamahalsa bayanaymasasalaminsa pagsisikapnamaisabuhayangmga pagpapahalagaatnakaaambagsa pag-angatngkulturangPilipinoat kaunlaranngbansa EsP10PB -IIId-10.3 10.4Nakagagawangmgaangkopna kilossapamayananobarangay upangmaipamalasang pagmamahalsabayan EsP10PB -IIId-10.4 11.Pangangalagasa Kalikasan . Naipamamalasng mag-aaralangpag- unawasa pangangalagasa kalikasan. Nakagagawaang mag-aaralng angkopnakilos upang maipamalasang pangangalagasa kalikasan. 11.1Nakapagpapaliwanagng kahalagahanngpangangalagasa kalikasan EsP10PB -IIIe-11.1 11.2Natutukoyangmgapaglabagsa pangangalagasakalikasanna umiiralsalipunan EsP10PB -IIIe-11.2 11.3Napangangatwirananna: a.Lahattayoaymamamayanng iisangmundo,dahilnabubuhay tayosaiisangkalikasan(Mother Nature) b.InutusantayongDiyosna alagaanangkalikasan (stewards)athindimaging tagapagdominaparasasusunod nahenerasyon. c.Binubuhaytayongkalikasan EsP10PB -IIIf-11.3 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  21. 21. D EPED C O PY xxiv NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 11.Pangangalagasa Kalikasan Naipamamalasng mag-aaralangpag- unawasa pangangalagasa kalikasan. Nakagagawaang mag-aaralng angkopnakilos upang maipamalasang pangangalagasa kalikasan. 11.4Nakagagawangmgaangkopna kilosupangmaipamalasang pangangalagasakalikasan EsP10PB -IIIf-11.4 12.Espiritwalidadat Pananampalataya Naipamamalasng mag-aaralangpag- unawasa pananampalatayaat espiritwalidad. Nakagagawaang mag-aaralng angkopnakilos upangmapaunlad angsariling pananampalataya atespiritwalidad. 12.1Natutukoyangmgakatangianng taobilangespiritwalnanilalang EsP10PB -IIIg-12.1 12.2Nasusuriangsarilingugnayansa Diyos EsP10PB -IIIg-12.2 12.3Nahihinuhana: a.Nasapagsisikapnahanapinang kahuluganngbuhay,hindiang mgabagaynamateryal,ang pagigingespiritwalngtao. b.Angpagsisikapnamapanatili angugnayansaDiyos,bilang indikasyonngpagigingispiritwal, angnagpapatibaysaating pananampalataya. c.Naipakikitaangtunayna pananampalatayasapag-ibigsa kapwaatpreperensyasa kabutihan. EsP10PB -IIIh-12.3 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  22. 22. D EPED C O PY xxv NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 12.Espiritwalidadat Pananampalataya Naipamamalasng mag-aaralangpag- unawasa pananampalatayaat espiritwalidad. Nakagagawaang mag-aaralng angkopnakilos upangmapaunlad angsariling pananampalataya atespiritwalidad. 12.4Nakagagawangmgaangkopna kilosupangmapaunladangsariling pananampalatayaat espiritwalidadEsP10PB -IIIh-12.4 IKAAPATNAMARKAHAN:AngAkingPosisyonsamgaIsyungMoral Pamantayang Pangnilalaman Naipamamalasngmag-aaralangpag-unawasamgaisyungmoralupangmagkaroonngmatatagna paninindigansakabutihansagitnangiba’tibangpananawsamgaisyungitoatmgaimpluwensya ngkapaligiran. BatayangKonsepto Angpag-unawasamgaisyungmoralaynakatutulongsapagbuongmapaninindigangpananaw bataysaapatnapangunahingbirtudougali(cardinalvirtues)atanimnapangunahing pagpapahalagangmoral(coremoralvalues). 13.MgaIsyuTungkolsa Buhay(Paggamitng droga,Aborsyon, Pagpapatiwakal, Euthanasia) Naipamamalasng mag-aaralangpag- unawasamga gawaingtaliwassa batasngDiyosatsa kasagraduhanng buhay. Nakagagawaang mag-aaralng sarilingpahayag tungkolsamga gawaingtaliwassa batasngDiyosat sakasagraduhan ngbuhay. 13.1Natutukoyangmgagawaing taliwassabatasngDiyosatsa kasagraduhanngbuhay EsP10PI -IVa-13.1 13.2Nasusuriangmgagawaingtaliwas sabatasngDiyosatsa kasagraduhanngbuhay EsP10PI -IVa-13.2 13.3Napatutunayanna: Angpagbuongposisyontungkolsa mgaisyungmaykinalamansa paninindiganngtaosapagmamahal niyasabuhaybilangkaloobng Diyosaykailanganupang mapatibayangatingpagkilalasa EsP10PI -IVb-13.3 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  23. 23. D EPED C O PY xxvi NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 13.MgaIsyuTungkolsa Buhay(Paggamitng droga,Aborsyon, Pagpapatiwakal, Euthanasia) Naipamamalasng mag-aaralangpag- unawasamga gawaingtaliwassa batasngDiyosatsa kasagraduhanng buhay. Nakagagawaang mag-aaralng sarilingpahayag tungkolsamga gawaingtaliwassa batasngDiyosat sakasagraduhan ngbuhay. Kaniyangkadakilaanat kapangyarihanatkahalagahanng taobilangnilalangngDiyos. 13.4Nakagagawangsarilingpahayag tungkolsamgagawaingtaliwassa batasngDiyosatsakasagraduhan ngbuhay EsP10PI -IVb-13.4 14.MgaIsyuTungkol saSekswalidad (Pre-maritalsex, pornograpiya Pang-aabusong Seksuwal, prostitusyon) Naipamamalasng mag-aaralangpag- unawasamgaisyu tungkolsa sekswalidad(pre- maritalsex, pornograpiyapang- aabusongsekswal, prostitusyon). Nakagagawaang mag-aaralng malinawna posisyontungkol saisangisyusa kawalanng paggalangsa dignidadat sekswalidad. 14.1Natutukoyangmgaisyungkaugnay sakawalanngpaggalangsa dignidadatseksuwalidad EsP10PI -IVc-14.1 14.2Nasusuriangmgaisyungkaugnay sakawalanngpaggalangsa dignidadatseksuwalidad EsP10PI -IVc-14.2 14.3Angmalawaknakaalamansamga isyungmaykinalamansakawalan ngpaggalangsaseksuwalidaday daanupangmagkaroonng malinawnaposisyonsa kahalagahanngpaggalangsa kabuuanngpagkataongtaosa tunaynalayuninnito EsP10PI -IVd-14.3 14.4Nakagagawangmalinawna posisyontungkolsaisangisyusa kawalanngpaggalangsadignidad atseksuwalidad EsP10PI -IVd-14.4 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  24. 24. D EPED C O PY xxvii NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE 15.MgaIsyungMoral TungkolsaKawalan ngGalangsa Katotohanan Pagsasabingtotoo parasakabutihan- whistleblwoing, plagiarism, intellectualpiracy) Naipamamalasng mag-aaralangpag- unawasamgaisyu tungkolsapaglabag sakatotohanan (pagsasabingtotoo parasakabutihan- whistleblowing, plagiarism, intellectualpiracy). Nakabubuoang mag-aaralngmga hakbangupang maisabuhayang paggalangsa katotohanan. 15.1Natutukoyangmgaisyungkaugnay sakawalanngpaggalangsa katotohanan EsP10PI -IVe-15.1 15.2Nasusuriangmgaisyungmay kinalamansakawalanngpaggalang sakatotohanan EsP10PI -IVe-15.2 15.3Napatutunayanna:Angpagiging mulatsamgaisyutungkolsa kawalanngpaggalangsa katotohananaydaanupangisulong atisabuhayangpagiging mapanagutanattapatnanilalang EsP10PI -IVf-15.3 15.4Nakabubuongmgahakbangupang maisabuhayangpaggalangsa katotohanan EsP10PI -IVf-15.4 16.MgaIsyutungkol saPaggawa (Paggamitng kagamitanatoras satrabaho,Sugal, Gameofchance, Paggamitngorasat kagamitansa trabaho, Magkasalungatna interes(Conflictof interest)at Naipamamalasng mag-aaralangpag- unawasamgaisyu tungkolsapaggawa (Paggamitng kagamitanatoras satrabaho,Sugal, Gameofchance, Paggamitngorasat kagamitansa trabaho, Nakagagawaang mag-aaralng posisyontungkol saisangisyusa paggawaat paggamitng kapangyarihan. 16.1Natutukoyangmgaisyutungkolsa paggawaatpaggamitng kapangyarihan EsP10PI -IVg-16.1 16.2Nasusuriangmgaisyutungkolsa paggawaatpaggamitng kapangyarihan EsP10PI -IVg-16.2 16.3Napatutunayanna: Angpagkakaroonngmatibayna paninindigansapaggawaattamang paggamitngkapangyarihanay daanparasamapanagutang paglilingkod. EsP10PI -IVh-16.3 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  25. 25. D EPED C O PY xxviii NILALAMAN (ContentStandard) PAMANTAYANG PANGNILALAMAN (ContentStandard) PAMANTAYAN SAPAGGANAP (Performance Standard) MGAKASANAYANG PAMPAGKATUTO (LearningCompetencies) CODE Paggamitng Kapangyarihan (Pakikipagsabwatan, Panunuhol,Bribery, Kickback, Nepotismo) Magkasalungatna interes(Conflictof interest)at Paggamitng Kapangyarihan (Pakikipagsabwatan ,Panunuhol (Bribery),Kickback, Nepotismo). 16.4Nakabubuongmatatagnaposisyon tungkolsamgaisyusapaggawaat paggamitng kapangyarihan EsP10PI -IVh-16.4 All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  26. 26. D EPED C O PY xxix Kto12BASICEDUCATIONCURRICULUM CODEBOOKLEGEND Sample:EsP10PB-IIIg-12.1 LEGENDSAMPLE FirstEntry LearningArea andStrand/ Subjector Specialization Edukasyonsa Pagpapakatao EsP 10 GradeLevelBaitang10 UppercaseLetter/s Domain/Content/ Component/ Topic AngPagpapahalaga atBirtud PB - RomanNumeral *Zeroifnospecific quarter QuarterIkatlongMarkahanIII LowercaseLetter/s *Putahyphen(-)in betweenlettersto indicatemorethana specificweek WeekIkapitonglinggog - ArabicNumberCompetency NakapagpapaLiwanag ngkahalagahanng pangangalagasa kalikasan 12.1 DOMAIN/COMPONENTCODE TungkulinKoSaAkingSariliatPamilyaPKP MahalKo,KapwaKoP ParaSaKabutihanngLahat,SumunodTayoPPP PaggawangMabuti,KinalulugdanngDiyosPD PagkilalaatPamamahalasamgaPagbabagosa Sarili PS AngPagkataongTaoPT AngPagpapahalagaatBirtudPB AngPakikipagkapwaP MgaIsyusaPakikipagkapwaIP AngPapelngLipunansaTaoPL AngTungkulinngTaosaLipunanTT MgaKaugnaynaPagpapahalagasaPaggawaKP MapanagutangPagpaplanongKursong AkademikooTeknikal-Bokasyonal,Siningat Isports,NegosyooHanapbuhay PK AngMoralnaPagkataoMP AngMakataongKilosMK AngAkingPosisyonsamgaIsyungMoralPI All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  27. 27. D EPED C O PY 1 Edukasyon sa Pagpapakatao Baitang 10 Unang Markahan Gabay sa Pagtuturo sa Modyul 1: ANG MGA KATANGIAN NG PAGPAPAKATAO Bilang ng Oras: 4 I. Pag-uugnay ng mga Pamantayan sa Pagkatuto at mga Kasanayang Pampagkatuto Pamantayang Pangnilalaman: Naipamamalas ng mag-aaral ang pag- unawa sa mga katangian ng pagpapakatao Pamantayan sa Pagganap: Nailalapat ng mag-aaral ang mga tiyak na hakbang upang paunlarin ang mga katangian ng pagpapakatao Ano ang pinakamahalagang mensahe na dapat maunawaan at maipamalas ng mag-aaral? Ang pag-unlad sa mga katangian ng pagpapakatao ay instrumento sa pagganap ng tao sa kaniyang misyon sa buhay tungo sa kaniyang kaligayahan. Ano ang patunay ng pag-unawa? Nailalapat ang mga tiyak na hakbang upang paunlarin ang mga katangian ng pagpapakatao Anong kakayahan ang dapat maipamalas tungo sa pag-unawa? Nasusuri ang sarili kung anong katangian ng pagpapakatao ang makatutulong sa pagtupad ng iba’t ibang papel sa buhay (upang magampanan ang kaniyang misyon sa buhay) Anong kaalaman ang kailangan upang maipamalas ang pag-unawa? Natutukoy ang mga katangian ng pagpapakatao Pamantayan sa pagkatuto Batayang konsepto Pagsasabuhay ng mga pagkatuto Kakayahan Kaalaman All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  28. 28. D EPED C O PY 2 II. Pag-uugnay ng mga Kasanayang Pampagkatuto sa Pagtatasa Pagtatasa KP1: Pagsasadula ng taong nagpapakatao sa pamamagitan ng malikhaing pamamaraan Pagsulat ng pinaunlad na Personal na Pahayag ng Misyon sa Buhay (PPMB) KP2: Pagtukoy ng iba’t ibang papel sa buhay at mga gawain na makatutulong sa pagtupad ng Personal na Pahayag ng Misyon sa Buhay (PPMB) Pagtukoy ng mga katangian ng pagpapakatao na masasalamin sa gawain na makatutulong sa pagtupad ng PPMB KP3: Pagsagot sa mga tanong sa bahaging Tayahin ang Iyong Pag-unawa Pagbuo at pagpapaliwanag ng Batayang Konsepto KP4: Pagsagot sa matrix ng Plano ng Pagsasabuhay ng Aking Personal na Pahayag ng Misyon sa Buhay (PPMB) Pagtatala ng mga posibleng kilos na magagawa upang mapaunlad sa sarili ang mga katangian sa pagpapakatao Pagtupad ng konkretong plano tungo sa pag-unlad ng mga katangian sa pagpapakatao sa loob ng isang linggo Mga Kasanayang Pampagkatuto KP1: Natutukoy ang mga katangian ng pagpapakatao KP2: Nasusuri ang sarili kung anong katangian ng pagpapakatao ang makatutulong sa pagtupad ng iba’t ibang papel sa buhay (upang magampanan ang kaniyang misyon sa buhay) KP3: Napatutunayan na ang pag-unlad sa mga katangian ng pagpapakatao ay mga instrumento sa pagkamit ng tao sa kaniyang misyon sa buhay tungo sa kaniyang kaligayahan KP4: Nailalapat ang mga tiyak na hakbang upang paunlarin ang mga katangian ng pagpapakatao . All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  29. 29. D EPED C O PY 3 III. Plano ng Pagtuturo-Pagkatuto A. ANO ANG INAASAHANG MAIPAMAMALAS MO? 1. Talakayin ang panimula sa pahina 1 ng Modyul 1. Mahalagang maiugnay ang kasalukuyang aralin sa mga modyul sa Ikalawang Markahan ng Baitang 7 upang maipaunawa sa mga mag-aaral ang halaga ng pagkatuto mula sa mga ito at ang kaugnayan nito sa kasalukuyang modyul. 2. Mahalagang mapukaw ang isipan at damdamin ng mga mag-aaral sa panimula pa lamang upang matiyak na makukuha ang kanilang interes para sa pagsasagawa ng mga gawain. Maaaring tumawag ng ilang mga mag-aaral na magbabahagi ng kanilang karanasan kaugnay ng naunang pangungusap sa bahaging ito. 3. Ipabasa sa mga mag-aaral ang Mahalagang Tanong na nasa dulong bahagi ng panimula sa pahina 1. 4. Pagkatapos,ipabasaatisa-sahinangmgalayuningpampagkatuto(kasanayang pampagkatuto) para sa Modyul 1. 5. Sabihin: Mayroon ba kayong gustong linawin tungkol sa mga layuning binasa? Tandaan: Hindi binanggit sa Modyul sa Pagkatuto ang kabuuan ng KP3 upang maiwasan na kaagad na mailahad sa mga mag-aaral ang Batayang Konsepto. Mahalagang matiyak na sa pagdaloy ng mga gawain at kabuuan ng aralin, mahihinuha nila ang Batayang Konsepto. Paunang Pagtataya Layunin: Tayahin ang kaalaman ng mag-aaral tungkol sa paksa sa antas ng KAALAMAN, KASANAYAN (process/skills), AT PAG-UNAWA (understanding of concepts) 1. Ipabasa ang panuto para sa Paunang Pagtataya sa pahina 2 - 4 ng modyul. Tanungin sila: Mayroon bang kailangang linawin sa Panuto? 2. Pasagutan sa mga mag-aaral ang Paunang Pagtataya sa loob ng 10 hanggang 15 minuto. 3. Ipaskil o isulat sa pisara ang mga tamang sagot sa Paunang Pagtataya. 4. Gamiting gabay ang resulta nito upang mataya ang mga kasanayang nangangailangan ng mas malalim na pagtalakay. 5. Palagdaan sa mga mag-aaral ang ginawang pagtataya at atasan silang itabi ito upang magamit sa paghahambing sa resulta ng pagsagot muli nito pagkatapos basahin ang Pagpapalalim. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  30. 30. D EPED C O PY 4 Tandaan: Mahalagang ipaunawa sa mga mag-aaral na kung ano man ang maging resulta ng Paunang Pagtataya, hindi ito magiging bahagi ng pagbibigay ng marka, kundi isang mahalagang pagbabatayan ng kaniyang pag-unlad. Pagkatapos ng Paghinuha ng Batayang Konsepto, pasagutang muli sa mga mag-aaral ang pagtataya upang malaman ang antas ng kanilang pag-unawa sa mga konsepto at kung nagkaroon ng pag-unlad ang kanilang kakayahan sa pagpapasiya at pagkilos gamit ang mga katangian ng pagpapakatao. B. PAGTUKLAS NG DATING KAALAMAN Layunin: Tayahin ang mga dating kaalaman ng mga mag-aaral tungkol sa paksa na nakabatay sa karanasan upang matukoy ng guro ang mga maling kaalaman ng mga mag-aaral (misconceptions o alternative conceptions). Gawain 1 1. Ipagawa ang Gawain 1 sa bahaging Pagtuklas ng Dating Kaalaman sa mga mag-aaral sa pahina 4 - 5 ng Modyul 1. 2. Ipabasa ang Panuto at saka tanungin: Mayroon bang kailangang linawin sa Panuto? 3. Bigyan ng 5 - 10 minuto ang mga mag-aaral upang maisagawa ang unang pangkatang gawain. 4. Pagkatapos ay pasagutan sa mga mag-aaral ang mga tanong sa bilang 3, pahina 5. 5. Atasan ang mga mag-aaral na humanda para sa pangkatang dula-dulaan ng taong nagpapakatao sa malikhaing pamamaraan. 6. Pagkatapos ng dula-dulaan, pasagutan sa mga mag-aaral ang mga tanong sa bilang 5, pahina 5. 7. Tiyaking magagamit ang pagkatuto sa mga nagdaang gawain upang maiugnay ito sa mga susunod na gawain. Gawain 2 1. Ipagawa ang Gawain 2 sa bahaging Pagtuklas ng Dating Kaalaman sa mga mag-aaral sa pahina 6. 2. Ipabasa ang Panuto at saka tanungin: Mayroon bang kailangang linawin sa Panuto? 3. Bigyan ng 10 -15 minuto ang mga mag-aaral upang maisagawa ang gawain. 4. Pagkatapos, pasagutan ang mga tanong sa bilang 1 at 2, pahina 6. 5. Tiyaking magagamit ang pagkatuto sa mga nagdaang gawain upang maiugnay ito sa mga susunod na gawain. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  31. 31. D EPED C O PY 5 C. PAGLINANG NG MGA KAALAMAN, KAKAYAHAN, AT PAG-UNAWA Layunin: Tulungan ang mag-aaral sa pagsagot sa Mahalagang Tanong (MT) at paghinuha ng Batayang Konsepto (BK) gamit ang mga kaalaman ng mag-aaral na hango sa karanasan 1. Maaaring simulan ang bahaging ito sa pamamagitan ng pagbabalik-aral. Mahalagang matiyak na nanatili ang pagkatuto sa mga mag-aaral upang matiyak na maiuugnay nila ang pagkatuto rito sa susunod na gawain. Muling itanong sa mga mag-aaral ang kanilang mga pagtuklas sa naunang mga gawain. 2. Pagkatapos, ipabasa sa isang mag-aaral ang Panuto at saka sabihin: Mayroon bang kailangang linawin sa Panuto? 3. Ipagawa ang Gawain 3 sa bahaging Paglinang ng Kaalaman, Kakayahan, at Pag-unawa sa pahina 7 ng Modyul 1. 4. Bigyan ang mga mag-aaral ng 10 - 15 minuto upang isagawa ang gawain. 5. Pagkatapos, gabayan ang mga mag-aaral sa pagbuo ng dyad sa bawat pangkat at ibahagi ang output sa bawat isa sa loob ng tatlong minuto. 6. Ibahagi sa pangkat ang mga sagot na magkapareho. Halimbawa: ang mga papel sa buhay at ang mga gawaing na makatutulong sa pagtupad ng iba’t ibang papel sa buhay. 7. Ilalahad ng bawat pangkat ang kanilang output. 8. Pasagutan sa mga mag-aaral ang mga tanong pagkatapos. 9. Magsagawa ng paglalahat sa klase. Tiyakin na naitatala sa pisara ang lahat ng mga sagot ng mga mag-aaral upang mabigyang-pansin ang mahahalagang konsepto na kanilang nabuo mula sa gawain. 10. Mahalagang maging bukas sa tanong ng mga mag-aaral. 11. Tiyakin na unti-unting nagagabayan ang mga mag-aaral sa paghinuha ng Batayang Konsepto. Mahalaga na unti-unti nang nagkakaroon ng linaw ang Batayang Konsepto sa bahaging ito. 12. Maaaring ibigay na muli ang Mahalagang Tanong sa bahaging ito at pasagutan sa ilang mga mag-aaral. D. PAGPAPALALIM Layunin: Gabayan ang mag-aaral sa pagsagot sa Mahalagang Tanong (MT) at paghinuha ng Batayang Konsepto (BK) gamit ang isang babasahin na naglalaman ng mga kaalaman at malalim na paliwanag sa paksa batay sa mga disiplina ng EsP – ang Etika at Career Guidance. (Ang gurong manunulat ang bumuo ng babasahin gamit ang mga mapagkakatiwalaang aklat, print at non-print.) All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  32. 32. D EPED C O PY 6 Paalala: Makatutulong kung ang sanaysay ay ipababasa na sa mga mag-aaral bilang Takdang-Aralin. 1. Bago simulan ang Pagpapalalim, maaaring balikan ng guro ang tanong sa bahagi ng Ano ang Inaasahang Maipamamalas Mo? na “Sa bawat kilos ko, anong uri ng tao ang binubuo ko sa aking sarili?” 2. Hikayatin ang mga mag-aaral na ipaliwanag ang kani-kanilang mga sagot. 3. Sabihin: Ngayon, sisikapin nating unawain ang mga mahalagang konsepto tungkol sa paksa gamit ang isang babasahin. Tingnan natin kung magkakaroon ng pagbabago sa inyong mga sagot matapos na maunawaan ang nilalaman ng babasahin. 4. Ipabasa ang kabuuan ng sanaysay sa pahina 9 - 15. Bigyan sila ng 15 - 20 minuto upang basahin ito. 5. Ipabasa sa isang mag-aaral ang bawat bahagi at tanungin ang pagkaunawa niya rito. Kung mali ang kaniyang pagkaunawa sa anumang talata, magbigay ng tanong upang gabayan siya sa pagbuo ng tamang pag-unawa (o paraphrasing). Tandaan: Mahalagang ipaunawa sa mga mag-aaral ang bawat bahagi ng babasahin at ang kabuuan nito dahil dito nila makukuha ang mga konseptong nakaangkla sa Pilosopiyang Moral. 6. Iminumungkahing gamitin ang pagkamalikhain upang hindi maging kabagot- bagot para sa mag-aaral ang bahaging ito. 7. Makatutulong ang pagsasagawa ng malikhaing presentasyon tulad ng pagre- record ng babasahin at paglalapat ng voice over dito upang maging kawili- wili ito sa mga mag-aaral at mapukaw ang kanilang interes o atensiyon. Ngunit mahalaga pa rin ang mabasa nila ang kabuuan ng sanaysay sa modyul upang mas maunawaan at mapagnilayan nila ang mahahalagang konsepto. 8. Bigyan ng sapat na panahon ang mga mag-aaral upang maisulat ang mga mahahalagang konsepto na kanilang nakuha sa babasahin. Bigyang-diin ang sumusunod: ang pagkakaiba ng pagka-ano at pagka-sino, ang tatlong yugto ng pagka-sino ng tao, ang tatlong katangian ng pagpapakatao o ng tao bilang persona, at ang pagmamahal bilang pagpapaunlad ng halaga ng minamahal ayon sa kalikasan nito. 9. Isulat sa pisara ang mga ideya na makatutulong sa pag-unawa ng paksa at paghinuha ng Batayang Konsepto. 10. Mahalagang tiyakin na sa bahaging ito ay handa na ang mga mag-aaral sa paghinuha ng Batayang Konsepto. Maaaring magdagdag ng mga tanong kung ito ang makatutulong upang mas mahinuha ng mga mag-aaral ang konsepto. 11. Mahalagang tiyakin na ang mga mag-aaral ang makatutuklas ng mga konsepto at hindi lamang tuwirang ibibigay ng guro. 12. Ipadaloy ang malayang talakayan. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  33. 33. D EPED C O PY 7 Paalala sa Guro: Sa pagitan ng mga talata sa babasahin ay may mga kahon na naglalaman ng mga tanong na magagamit upang mataya ang pag-unawa ng mga mag-aaral sa bawat bahagi ng babasahin. Nagsisilbing formative assessment ang mga ito. Mahalagang hindi piliting matapos sa iisang araw ang pagtalakay dito upang hindi magkaroon ng information overload ang mga bata at lalong hindi makamit ang layuning ganap na maunawaan ng mga mag-aaral ang kabuuan ng Batayang Konsepto. Paghinuha ng Batayang Konsepto 1. Ipagawa sa mga mag-aaral ang bahaging Paghinuha ng Batayang Konsepto. 2. Atasan ang mga mag-aaral na basahin ang panuto at sabihin: Mayroon bang kailangang linawin sa panuto? 3. Muling ulitin sa klase ang mahalagang tanong na: Paano makatutulong sa tao ang mga katangian ng pagpapakatao upang makamit niya ang kaniyang misyon sa buhay tungo sa kaniyang kaligayahan? 4. Bigyan ng limang minuto ang bawat pangkat upang makagawa ng pangkalahatang sagot sa mahalagang tanong. 5. Atasan ang bawat pangkat na ipaskil sa pisara ang kanilang output. 6. Muling bigyan ng limang minuto ang klase upang makabuo ng pangkalahatang sagot ng klase. 7. Ipabasa ito sa isang mag-aaral. Pagkatapos, hingin ang konklusyon ng ilang mag-aaral ukol sa naging pagkatuto nila mula sa babasahin. Patnubay: Naghanda ang mga manunulat ng mga Batayang Konsepto upang magsilbing gabay ng mga guro. Ngunit hindi hinahadlangan ang mga guro na gumawa ng Batayang Konsepto o di kaya naman ay mga karagdagang konsepto na pinaniniwalaan na mahalagang maitanim sa puso at isip ng mga mag-aaral. Mahalaga lamang na ang bubuuing Batayang Konsepto ay tumutugon sa sumusunod na pamantayan (EDUP-R): Enduring. Hindi ito dapat niluluma ng panahon o di kaya naman ay maaaring maaanod sa pagbabago ng panahon. Discipline-based. Ito ay nangangailangan ng matibay na batayan na mula sa malalim na pag-aaral o pagsasaliksik. Sa EsP ang mga batayang disiplina ay Etika at Career Guidance. Needs Uncoverage. Ito ay mapalalawak pa sa pamamagitan ng pagtalakay sa mga aralin. Ang malaking konsepto ay maaari pang mahimay sa maliliit na konsepto. Potentially Engaging. Nararapat na mapukaw nito ang interes at atensiyon ng mga mag-aaral upang matiyak na ito ay kanilang maaalala kahit pa lumipas ang matagal na panahon. Relationship between two variables. Ito ay dapat na pagsasalaysay ng ugnayan ng dalawang variable. Iwasan ang gumamit ng depinisyon sa pagbuo ng batayang konsepto. Halimbawa: Ano ang kabutihang maidudulot ng konsepto tungkol sa isip at kilos loob sa pagkatao at buhay ng mga mag-aaral? Narito ang Batayang Konsepto sa paksang isip at kilos-loob: Ang isip at kilos-loob ay nagpapabukod-tangi sa tao, kaya ang kaniyang mga pagpapasiya at pagkilos ay dapat patungo sa katotohanan at kabutihan. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  34. 34. D EPED C O PY 8 E. PAGSASABUHAY NG MGA PAGKATUTO Layunin ng mga Gawain sa bahagi ng Pagsasabuhay ng mga Pagkatuto na tayahin ang mga kaalaman, kakayahan, at pag-unawa ng mga mag-aaral upang mailapat ang mga tiyak na hakbang sa paghubog at pagpapaunlad ng mga katangian ng pagpapakatao. Pagganap 1. Ipagawa sa mga mag-aaral ang Gawain 4 sa bahaging Pagganap, pahina 16. 2. Ipabasa nang tahimik ang Panuto. Bigyan sila ng 3 minuto sa pagbasa. 3. Mahalagang maunawaan nang mabuti ng mga mag-aaral ang kanilang gagawin, kaya kailangang maging bukas sa kanilang mga tanong. Tanungin sila: Mayroon bang hindi malinaw sa panuto? 4. Bigyan ang klase ng 10 - 15 minuto upang isagawa ang gawain. 5. Sa klase, tumawag ng ilang mga mag-aaral na magbabahagi ng kanilang natapos na Plano ng Pagsasabuhay ng Personal na Pahayag ng Misyon sa Buhay (PPMB). 6. Matapos mapakinggan ang ilang pagbabahagi ng mag-aaral, pakinggan naman ang kanilang pagninilay sa natapos na gawain. Pagninilay 1. Ipagawa sa kanilang journal ang Gawain 5 sa bahaging Pagninilay sa pahina 18. 2. Ipabasa ang mga panuto at sabihin: Mayroon bang hindi malinaw sa panuto? 3. Bigyan ng sampung minuto ang mga mag-aaral upang isagawa ang bahaging ito. 4. Pagkatapos, pakinggan ang sagot ng ilang mga mag-aaral, ipabahagi ito sa klase. Pagsasabuhay 1. Ipagawa sa mga mag-aaral ang Gawain 6 sa bahaging Pagsasabuhay sa pahina 19. 2. Ipabasa nang tahimik sa mag-aaral ang panuto. Bigyan sila ng 3 minuto sa pagbasa at sabihin: Mayroon bang hindi malinaw sa panuto? 3. Ipakita sa klase ang katulad na pormat na nasa modyul. Ipaliwanag ang bawat bahagi nito. Gabayan ang mga mag-aaral upang mapahalagahan ang pagsangguni at pakikinig sa payo ng mga magulang at nakatatanda tungo sa pagsasabuhay sa mga katangian ng pagpapakatao. 4. Bigyan ang mga mag-aaral ng 10 - 15 minuto upang maisagawa ang gawain. 5. Papiliin ang mga mag-aaral ng kapareha upang maibahagi ang kanilang ginawa. Magandang pagkakataon din ito upang makapagbigay ang isa’t isa ng kanilang mga mungkahi. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  35. 35. D EPED C O PY 9 6. Ipagawa ang prosesong ito sa loob ng sampung minuto. Talaan ng Ispesipikasyon / Susi sa Pagwawasto Paksa Kasanayan Sagot 1. Pagka-ano ng tao c 2. Pagka-sino ng tao Pag-unawa d 3. Ang tao bilang indibidwal Ebalwasyon b 4. Ang tao bilang persona Pag-unawa a 5. Yugto ng pagka-sino ng tao Kaalaman b 6. Ang tao bilang persona Ebalwasyon d 7. Katangian ng pagpapakatao na may kamalayan sa sarili Pagbubuod a 8. Katangian ng pagpapakatao na may kakayahang kumuha ng buod o esensiya ng mga umiiral Pag-unawa c 9. Katangian ng pagpapakatao na umiiral na nagmamahal Pag-unawa b 10. Mga katangian ng pagpapakatao Kaalaman a Balangkas ng Pagpapalalim Modyul 1: Ang Mga Katangian ng Pagpapakatao I. Panimula: “Madaling maging tao, mahirap magpakatao.” A. Pagka-ano ng tao B. Pagka-sino ng tao II. Tatlong Yugto ng Paglikha ng Pagka-sino ng Tao A. Ang tao bilang indibidwal B. Ang tao bilang persona C. Ang tao bilang personalidad III. Tatlong Katangian ng Tao Bilang Persona: Mga Katangian ng Pagpapakatao A. May Kamalayan sa Sarili B. May Kakayahang Kumuha ng Buod o Esensiya C. Umiiral na Nagmamahal (Ens Amans) IV. Hamon ng Pagpapakatao: Tukuyin at Tuparin ang Misyon sa Buhay All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  36. 36. D EPED C O PY 10 Rubric para sa Plano ng Pagsasabuhay ng Aking Personal na Pahayag ng Misyon sa Buhay (PPMB) Kraytirya Antas ng Pagsasagawa 5 3 - 4 1 - 2 May PPMB sa taas ng Plano Natukoy ang gusto niyang maging o larawan ng kaniyang minimithi bilang tao sa maikling parirala; Naipahayag nang maikli at malinaw ang larawan ng kaniyang pagka-sino na nasasalamin ang kaniyang iba’t ibang papel sa buhay Natukoy ang gusto niyang maging o larawan ng kaniyang minimithi bilang tao sa isang pangungusap; Naipahayag nang maikli at malinaw ang larawan ng kaniyang pagka-sino, ngunit hindi nito nasasalamin ang kaniyang ibang papel sa buhay na tinukoy Hindi malinaw ang gusto niyang maging o larawan ng kaniyang minimithi bilang tao sa maikling parirala; Hindi malinaw ang larawan ng kaniyang pagka-sino at hindi nito nasasalamin ang kaniyang iba’t ibang papel sa buhay Natukoy ang kaniyang mga papel sa buhay Kumpleto ang mga papel na tinukoy ayon sa kaniyang edad at estado bilang kabataan at mag-aaral; May mga pang-uri na naglalarawan ng bawat papel; Masasalamin sa mga pang-uri ang mga pagpapahalaga niya bilang kabataan Kumpleto ang mga papel na tinukoy ayon sa kaniyang edad at estado bilang kabata- an at mag-aaral; May 1 papel na walang pang-uri; Masasalamin sa mga pang-uri ang mga pagpapahalaga niya bilang kabataan May kulang sa mga papel na tinukoy ayon sa kaniyang edad at estado bilang kabata- an at mag-aaral ; May 2-3 papel na walang pang-uri; Masasalamin sa mga pang-uri ang mga pagpapahalaga niya bilang kabataan Natukoy ang kaniyang mga gagawin sa bawat papel sa buhay at ang panahong gugugulin sa bawat gawain Angkop ang mga gawain sa bawat papel; Makatotohanan ang mga gawain ayon sa kaniyang edad at estado bilang kabataan at mag- aaral; Makatotohanan ang panahong gugugulin sa bawat gawain May mga gawain na hindi angkop sa bawat papel; Makatotohanan ang mga gawain ayon sa kaniyang edad at estado bilang kabataan at mag- aaral; Hindi makatotohanan ang panahong gugugulin sa 1-2 gawain May mga gawain na hindi angkop sa bawat papel; Hindi makatotohanan ang ibang gawain ayon sa kaniyang edad at estado bilang kabataan at mag-aaral Hindi makatotohanan ang panahong gugugulin sa karamihan sa mga gawain All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  37. 37. D EPED C O PY 11 Edukasyon sa Pagpapakatao Baitang 10 Unang Markahan Gabay sa Pagtuturo sa Modyul 2: ANG MATAAS NA GAMIT AT TUNGUHIN NG ISIP AT KILOS-LOOB Bilang ng Oras: 4 I. Pag-uugnay ng mga Pamantayan sa Pagkatuto at mga Kasanayang Pampagkatuto Pamantayang Pangnilalaman: Naipamamalas ng mag-aaral ang pag- unawa sa mga konsepto tungkol sa paggamit ng isip sa paghahanap ng katotohanan at paggamit ng kilos-loob sa paglilingkod/pagmamahal. Pamantayan sa Pagganap: Nakagagawa ang mag-aaral ng mga angkop na kilos upang maipakita ang kakayahang mahanap ang katotohanan na maglingkod at magmahal Ano ang pinakamahalagang mensahe na dapat maunawaan at maipamalas ng mag-aaral? Napatutunayan na ang isip at kilos-loob ay ginagamit para lamang sa paghahanap ng katotohanan at sa paglilingkod/pagmamahal. Ano ang patunay ng pag-unawa? Nakagagawa ng mga angkop na kilos upang maipakita ang kakayahang hanapin ang katotohanan na maglingkod at magmahal Anong kakayahan ang dapat maipamalas tungo sa pag-unawa? Nasusuri kung ginamit nang tama ang isip at kilos-loob ayon sa tunguhin ng mga ito Anong kaalaman ang kailangan upang maipamalas ang pag-unawa? Natutukoy ang gamit at tunguhin ng isip at kilos-loob sa angkop na sitwasyon Pamantayan sa Pagkatuto Batayang Konsepto Pagsasabuhay ng mga Pagkatuto Kakayahan Kaalaman All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  38. 38. D EPED C O PY 12 II. Pag-uugnay ng mga Kasanayang Pampagkatuto sa Pagtatasa Pagtatasa KP1: Paghambing ng kakayahang taglay ng tao at hayop Pagtukoy sa gamit at tunguhin ng isip at kilos-loob sa angkop na sitwasyon KP2: Pagsuri ng mga argumentong inilatag at pagbibigay reaksiyon kung ginamit nang tama ang isip at kilos-loob ayon sa tunguhin ng mga ito KP3: Pagpapaliwanag ng Batayang Konsepto gamit ang graphic organizer KP4: Pagsasagawa ng mga hakbang upang makahanap ng pagkakataon na maipakita ang pagmamahal sa kapuwa Mga Kasanayang Pampagkatuto KP1: Natutukoy ang gamit at tunguhin ng isip at kilos-loob sa angkop na sitwasyon KP2: Nasusuri kung ginamit nang tama ang isip at kilos-loob ayon sa tunguhin ng mga ito KP3: Napatutunayan na ang isip at kilos-loob ay ginagamit para lamang sa paghahanap ng katotohanan at sa paglilingkod/ pagmamahal KP4: Nakagagawa ng mga angkop na kilos upang maipakita ang kakayahang hanapin ang katotohanan na maglingkod at magmahal . All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  39. 39. D EPED C O PY 13 III. Plano ng Pagtuturo-Pagkatuto A. ANO ANG INAASAHANG MAIPAMAMALAS MO? 1. Talakayin ang panimula sa pahina 21 ng Modyul 2. Mahalagang maiugnay ang kasalukuyang aralin sa mga nagdaang aralin lalo na sa Modyul 1 at noong sila ay nasa Baitang 7 upang maipaunawa sa mga mag-aaral ang halaga ng pagkatuto mula sa mga ito at ang kaugnayan nito sa kasalukuyang mga modyul. 2. Mahalagang mapukaw ang kanilang isip at damdamin sa panimula pa lamang upang matiyak na makuha ang kanilang interes para sa pagsasagawa ng mga gawain. 3. Ipatukoy sa mga mag-aaral ang konteksto (thesis statement) na naglalarawan sa paksa at dapat bigyan-tuon. 4. Kailangang ipatukoy din sa mga mag-aaral ang Mahalagang Tanong na dapat sagutin sa modyul. 5. Ipabasa sa mga mag-aaral ang apat na Kasanayang Pampagkatuto para sa modyul na ito. 6. Ipaliwanag sa kanila ang mga kraytirya ng pagtataya ng output sa Kakayahang Pampagkatuto 2.4. 7. Ipaliwanag din na ang apat na KP ay nakaangkla saApat naAntas ng Pagtatasa (Four Levels of Assessment sa DepEd Order No. 73, s. 2012). 8. Sabihin: Mayroon ba kayong gustong linawin tungkol sa mga layuning binasa? Tandaan: Hindi binanggit sa Modyul sa Kasanayang Pampagkatuto ang kabuuan ng KP3 upang maiwasan na kaagad na mailahad sa mga mag-aaral ang Batayang Konsepto. Mahalagang matiyak na sa pagdaloy ng mga gawain at kabuuan ng aralin, mahihinuha nila ang Batayang Konsepto. Paunang Pagtataya Layunin: Tayahin ang kaalaman ng mag-aaral tungkol sa paksa sa antas ng KAALAMAN, KASANAYAN (process/skills), at PAG-UNAWA (understanding of concepts). (Maaaring dalawang bahagi: Self-assessment sa mga kakayahan tungkol sa paksa at Multiple Choice Test gamit ang Bloom’s Taxonomy of Cognitive Objectives) All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  40. 40. D EPED C O PY 14 1. Pasagutan sa mga mag-aaral ang Paunang Pagtataya na nasa pahina 22 - 24 sa kanilang kuwaderno. 2. Ipaunawa sa mga mag-aaral ang layunin sa pagbibigay ng Paunang Pagtataya. 3. Ipabasa ang Panuto sa bawat bahagi at sabihin: Mayroon bang kailangang linawin sa Panuto? 4. Maglaan ng 10 - 15 minuto para sa Pagtataya. Pagkatapos, iwasto ang kanilang mga sagot. 5. Gamiting gabay ang resulta ng Pagsusulit upang mataya ang mga kasanayang nangangailangan ng mas malalim na pagtalakay. 6. Palagdaan sa mag-aaral ang ginawang pagtataya at atasan silang itabi ito upang magamit sa paghahambing sa Panghuling Pagsusulit. B. PAGTUKLAS NG DATING KAALAMAN Layunin ng Pagtuklas ng Dating Kaalaman na tayahin ang mga dating kaalaman ng mga mag-aaral tungkol sa paksa na nakabatay sa karanasan upang matukoy ng guro ang mga maling kaalaman ng mga mag-aaral (misconceptions o alternative conceptions). Nakatuon ito sa pagkamit ng Kakayahang Pampagkatuto o Learning Competency (KP1) - Kaalaman Gawain 1 Layunin ng gawaing ito na mabalikan ng mga mag-aaral ang kanilang natutuhan noong sila ay nasa Baitang 7 tungkol sa isip at kilos-loob. Gayundin ang maihambing ang kakayahang taglay ng tao at hayop. Tandaan: Bago ang pagtalakay ng araling ito gawin ang sumusunod: 1. Ihanda ang dalawang larawan na nasa Gawain 1 na sapat ang laki upang maipaskil ito sa pisara. 2. Isulat din ang limang tanong na nasa tsart sa ibaba ng larawan sa limang metastrips. 3. Atasan ang mga mag-aaral na maghanda/magdala ng metastrips at pentel pen sa klase. Tandaan: Mahalagang ipaunawa sa mga mag-aaral na kung anuman ang maging resulta ng paunang pagtataya, hindi ito magiging bahagi ng pagbibigay ng marka, kundi isang mahalagang pagbabatayan ng kanilang pag-unlad. Pagkatapos ng Pagpapalalim, pasagutang muli sa mga mag-aaral ang pagtataya upang malaman ang antas ng kanilang pag-unawa sa mga konsepto at kung nagkaroon ng pag-unlad ang kanilang kakayahan sa pagkamit at pagpapanatili ng kabutihang panlahat. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  41. 41. D EPED C O PY 15 1. Upang maging masigla at kawili-wili ang gawain sa bahaging ito, pangkatin ang klase sa dalawa. Ipahanda ang metastrips na gagamitin at ang pentel pen para sa dalawang pangkat. Isulat ang tsart sa pisara. 2. Ipaskil ang larawan sa pisara. Hayaan ang mag-aaral na magbigay ng kanilang komento tungkol sa larawan sa loob ng isang minuto. Sabihin: Mayroon akong limang tanong na ipapaskil sa pisara. Ang unang pangkat ang sasagot para sa kakayahan ng tao at ang ikalawang pangkat ang sasagot para sa kakayahan ng hayop. Isulat sa metastrip ang sagot ng pangkat at ipaskil ito sa hanay na nakalaan para rito. 3. Itanong: Mayroon ba kayong nais linawin sa panuto? 4. Isa-isang ipaskil ang mga tanong sa pisara sa bahaging Tanong sa tsart, bigyan ng sapat na panahon ang mga mag-aaral na sagutin ang bawat tanong. 5. Talakayin ang mga sagot sa mga gabay na tanong pagkatapos ng gawain. Gawain 2A at 2B Sa gawaing ito, nilalayong makita ng mga mag-aaral ang kakayahan ng taong gamitin ang isip at kilos-loob upang mahanap ang katotohanan at mangibabaw sa kaniya ang pagmamahal sa kapuwa gamit ang mga sitwasyon bilang halimbawa. 1. Ipaliwanag ang panuto para sa gawaing ito. Itanong: Mayroon ba kayong nais linawin sa Panuto? 2. Bigyan ng sampung minuto ang mga mag-aaral upang isagawa ang gawain. Atasang kumuha ng kapareha para sa pagbabahagi. 3. Pagkatapos ng pagbahagi sa kapareha, tumawag ng piling mga mag-aaral na magbabahagi sa klase ng kanilang sagot sa mga tanong. 4. Tiyaking magagamit ang pagkatuto sa mga nagdaang gawain upang maiug- nay ito sa mga susunod na gawain. C. PAGLINANG NG MGA KAALAMAN, KAKAYAHAN, AT PAG-UNAWA Layunin : Tulungan ang mag-aaral sa pagsagot sa Mahalagang Tanong (MT) at paghinuha ng Batayang Konsepto (BK) gamit ang mga kaalaman ng mag-aaral na hango sa karanasan. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  42. 42. D EPED C O PY 16 Gawain 3 Ang gawaing ito ay naglalayong masuri ang paggamit ng isip at kung paano ito nakaaapekto sa kilos-loob gayundin kung nakakamit ang tunay na tunguhin ng mga ito. 1. Maaaring ipagawa ito bilang takdang-aralin. Bago pa ang pagsasagawa nito, maaaring atasan ang ilang mag-aaral na maghanda upang bigyang buhay ang usapan ng magkaibigang Buknoy at Tikboy. 2. Ipaliwanag ang panuto para sa gawaing ito. Sabihan ang mga mag-aaral na habang binibigyang buhay ang usapan, ituon nila ang mga argumento na sinasabi ng magkaibigan tungkol sa pangongopya. 3. Tawagin ang mga mag-aaral na naatasan upang bigyang buhay ang usapan ng magkaibigang Buknoy at Tikboy. 4. Atasan ang mga mag-aaral na ipahayag ang kanilang reaksiyon kaugnay ng mga argumentong nabanggit sa usapan. Pag-usapan ito sa klase. 5. Pasagutan din ang limang tanong pagkatapos. 6. Tulungan ang mga mag-aaral na tuklasin ang tunay na tunguhin ng isip at ng kilos-loob sa tulong ng sitwasyong ito. 7. Tiyakin na unti-unting nagagabayan ang mga mag-aaral sa paghinuha ng Batayang Konsepto. D. PAGPAPALALIM Layunin ng Pagpapalalim: Gabayan ang mga mag-aaral sa pagsagot sa Mahalagang Tanong (MT) at paghinuha ng Batayang Konsepto (BK) gamit ang isang babasahin na naglalaman ng mga kaalaman at malalim na paliwanag sa paksa batay sa disiplina ng EsP – ang Etika at Career Guidance. Nakatuon sa pagkamit ng KP 3. Paalala: Mahalagang mapag-aralan muna ng guro ang mga konseptong nakapaloob sa babasahing ito. Makatutulong din kung maghahanda ang guro ng balangkas (outline) ng mga konseptong binanggit sa sanaysay upang mas mabisang magabayan ang mga mag-aaral sa pagtuklas at pag-unawa sa mga ito tungo sa Batayang Konsepto. Makatutulong din kung ang sanaysay ay ipababasa na sa mga mag-aaral bilang takdang-aralin. Mahalaga ang pagpapakita ng malikhaing presentasyon o video upang mapukaw ang kanilang interes sa paksa, ngunit kailangan pa ring malinang ang kanilang kakayahan sa pag-unawa sa paksa gamit ang sanaysay. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  43. 43. D EPED C O PY 17 1. Ipaskil ang tanong na “Tao ka ba o hayop?” sa pisara upang pukawin ang interes ng mga mag-aaral. Gabayan ang mga mag-aaral na muling mabalikan ang konseptong natalakay tungkol sa katangian ng persona sa Modyul 1 bilang pagbabalik-aral. 2. Tanungin ang mga mag-aaral kung anong kakayahan mayroon ang tao upang taglayin at linangin niya ang kaniyang persona. Iugnay ito sa kasalukuyang paksa ng pag-aaral. 3. Tanungin ang mga mag-aaral kung ano ang kanilang nalaman at naunawaan tungkol sa isip noong sila ay nasa Baitang 7. Gayundin ang tungkol sa kilos- loob. 4. Sabihin: Ngayon, sisikapin nating unawain ang mga mahahalagang konsepto tungkol sa paksa gamit ang isang babasahin. Tingnan natin kung magkakaroon ng pagbabago sa inyong mga sagot matapos na maunawaan ang nilalaman ng babasahin. 5. Ipabasa sa isang mag-aaral ang bawat bahagi at tanungin ang pagkaunawa niya rito. Kung mali ang kaniyang pagkaunawa sa anumang talata, magbigay ng tanong upang gabayan siya sa pagbuo ng tamang pag-unawa (o paraphrasing). 6. Simulang talakayin ang nilalaman ng sanaysay. (Magiging kapaki-pakinabang sa bahaging ito ang inihandang balangkas ng guro sa mga konseptong tinalakay sa sanaysay). 7. Maaaring simulan ito sa pagpapaliwanag ng pilosopiya ni Santo Tomas de Aquino na ang tao ay binubuo ng espiritwal at materyal na kalikasan at ang tsart ng “Kabuuang Kalikasan ng Tao,” ni Esteban. Isulat ang tsart sa manila paper bago pa ang pagtalakay ng sanaysay na ito. 8. Talakayin ang mga katangiang parehong taglay ng hayop at tao subalit linawin kung paano nagkakaiba ang paggamit nila sa mga ito. 9. Bigyang linaw ang mga kakayahang tanging tao lamang ang nagtataglay. Talakayin din ang mga bagong konsepto tungkol sa isip na hindi pa natalakay sa Baitang 7 lalo na ang mataas na tunguhin nito. 10. Ganito rin ang gawin sa pagtalakay sa kilos-loob. 11. Tandaan: Mahalagang ipaunawa sa mga mag-aaral ang bawat bahagi ng babasahin at ang kabuuan nito dahil dito nila makukuha ang mga konseptong nakaangkla sa Pilosopiyang Moral. 12. Isulat sa pisara ang mga ideya na makatutulong sa pag-unawa sa paksa at paghinuha ng Batayang Konsepto. 13. Maging malikhain upang hindi maging kabagot-bagot sa mag-aaral ang bahaging ito. Ito ang mahalagang nilalaman ng aralin dahil ito ang magbibigay ng mga etikal na konsepto tungkol sa paksa. 14. Mahalagang tiyakin na ang mga mag-aaral ang makatutuklas ng mga konsepto at hindi lamang tuwirang ibibigay ng guro. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  44. 44. D EPED C O PY 18 15. Matapos ang pagtalakay ay pasagutan sa kanila ang mga tanong sa Tayahin ang iyong Pag-unawa. Hinihikayat din ang guro na maging malikhain sa pagsasagawa ng bahaging ito. 16. Mahalagang unti-unting magabayan ang mga mag-aaral na mahinuha ang Batayang Konsepto sa bahaging ito. 17. Ibigay sa bahaging ito ang Mahalagang Tanong. 18. Maaaring may mga konseptong hindi naging malinaw para sa kanila. Hikayatin ang mga mag-aaral na magtanong kaugnay ng paksa. Paghinuha ng Batayang Konsepto Layunin: Gabayan ang mag-aaral sa pagsagot sa Mahalagang Tanong (MT) sa pamamagitan ng paghinuha ng Batayang Konsepto (BK) gamit ang graphic organizer. 1. Pangkatin ang klase sa apat o limang grupo. 2. Atasan ang mga mag-aaral na bumuo ng graphic organizer batay sa kanilang naunawaang konsepto sa babasahin. Isulat ito sa ½ manila paper. Bigyan sila ng 15 minuto upang ito ay buuin. 3. Ipapaskil sa pisara o iba pang prominenteng lugar sa silid-aralan ang mga nabuong graphic organizer ng mga pangkat. 4. Tawagin ang mga pangkat upang magbahagi sa klase ng Batayang Konsepto na kanilang nagawa. 5. Pagkatapos na magbahagi ang mga pangkat, ilagay ng guro sa pisara ang katulad na graphic organizer na bubuuin ng mga mag-aaral mula sa graphic organizer na kanilang nagawa. Gabayan ang mga mag-aaral sa paggawa nito. 6. Mula sa graphic organizer na nabuo, isalin sa pangungusap ang nabuong mga sagot upang maipakita ang Batayang Konsepto ng modyul na ito. 7. Mahalagang tandaan na hindi maaaring lagpasan ang bahaging ito. Sa pamamagitan lamang nito, matitiyak ang pag-unawa ng mga mag-aaral sa Batayang Konsepto. 8. Ang Paghinuha ng Batayang Konsepto rin ang magdidikta kung maaari nang magtungo sa susunod na bahagi ng aralin o kailangang mas pagyamanin pa ang pagtalakay sa paksa. 9. Pasagutan sa mga mag-aaral ang mga tanong sa bahaging Pag-uugnay ng Batayang Konsepto sa Pag-unlad Ko bilang Tao. Paalala sa Guro: Sa pagitan ng mga pagtalakay ay mayroong mga kahon na naglalaman ng mga tanong na magagamit upang mataya ang pag-unawa ng mga mag-aaral sa bawat bahagi ng babasahin. Nagsisilbing formative assessment ang mga ito. Mahalagang huwag piliting tapusin sa isang araw ang pagtalakay dito upang hindi magkaroon ng information overload ang mga mag-aaral dahil lalong hindi makakamit ang layuning ganap na maunawaan ng mag-aaral ang kabuuan ng Batayang Konsepto. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  45. 45. D EPED C O PY 19 10. Pasagutang muli ang mga tanong sa Paunang Pagtataya. Ipahambing ang resulta ngayon sa unang resulta ng kanilang unang pagsagot nito. Batay dito malalaman ng guro kung kailangan pang pagyamanin ang pagtalakay sa paksa. E. PAGSASABUHAY NG MGA PAGKATUTO Layunin: Gabayan ang mag-aaral sa pagsasagawa ng Pagganap o Produkto, ang paggawa ng mga angkop na kilos upang maipakita ang kakayahang hanapin ang katotohanan, at maglingkod at magmahal. Pagganap Ang gawaing ito ay naglalayong masuri ng mga mag-aaral ang kanilang kilos at makita ang kanilang kakayahang pangasiwaan ang kanilang damdamin. Gayundin ang lampasan ang mga sagabal sa pagkamit ng isip ng katotohanan at piliin ng kilos- loob ang kung ano ang tama. 1. Ipagawa sa mga mag-aaral ang gawain sa bahaging Pagganap bilang takdang aralin. Maaari nila itong gawin sa kanilang activity book. 2. Ipabasa nang tahimik ang panuto. Bigyan sila ng tatlong minuto sa pagbasa. 3. Mahalagang maunawaan nang mabuti ng mga mag-aaral ang kanilang gagawin, kaya kailangang maging bukas sa kanilang mga katanungan. 4. Ipaalala sa mga mag-aaral na mahalagang mailapat ang mga pagkatuto sa modyul sa pagsasagawa ng gawaing ito. 5. Pagnilayan sa klase ang naging karanasan sa pagsasagawa ng gawain at iugnay ito sa aralin. Pagninilay Sa gawaing ito bibigyan ang mga mag-aaral ng pagkakataong suriin at pagnilayan ang sariling karanasan. Gayundin, tuklasin ang reyalisasyon nila sa sarili. 1. Ipagawa sa mga mag-aaral ang gawain sa bahaging Pagninilay. 2. Maaaring ibigay ang gawaing ito bilang takdang aralin. Maaari rin namang ipagawa ito sa klase. Kung ipagagawa sa klase, atasan silang dalhin ang mga kinakailangang kagamitan. 3. Ipabasa nang tahimik sa mag-aaral ang Panuto. Bigyan sila ng tatlong minuto sa pagbasa. Pagkatapos, itanong: “Mayroon bang hindi malinaw sa Panuto?” 4. Bigyan nang sapat na oras ang mga mag-aaral upang isagawa ang gawain. 5. Tandaan: Bigyan ng pagkakataon ang mga mag-aaral na makapagtanong tungkol sa paksa sa bahaging ito. 6. Ipasulat ang kanilang mga sagot sa kanilang kuwaderno/dyornal. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  46. 46. D EPED C O PY 20 Pagsasabuhay Ang gawaing ito ay naglalayong gawing makabuluhan ang kanilang buhay araw-araw sa pamamagitan ng paghanap o paglikha ng pagkakataon upang tumugon sa pangangailangan ng kapuwa o ng isang sitwasyon. 1. Ipagawa sa mga mag-aaral ang gawain sa bahaging Pagsasabuhay. Ipabasa nang tahimik sa mag-aaral ang panuto. Bigyan sila ng tatlong minuto sa pagbasa. 2. Bigyan nang sapat na panahon ang mga mag-aaral upang maisagawa ito. Maaaring gawin ito sa loob ng dalawang linggo. Layunin nitong sanayin ang mga mag-aaral na malinang ang pagiging mapagmasid at pagtugon sa mga pangangailangan ng kapuwa at ng kaniyang paligid. 3. Ipasulatangkanilangginagawaaraw-arawbilangpatunayngpagsasakatuparan nito. Atasan silang isulat din ang kanilang naging reyalisasyon sa buhay kaugnay ng pagsasagawa ng gawain. 4. Ang rubric sa pagmamarka ng output na ito ay nakapaloob sa Appendix ng modyul na ito. 5. Tapusin ang aralin sa pamamagitan ng pagbabahagi ng halaga ng pagkatuto sa Batayang Konsepto. Talaan ng Ispesipikasyon / Susi sa Pagwawasto Paksa Kasanayan Sagot 1. Kakayahang magkaparehong taglay ng hayop at tao Kaalaman b 2. Isip Pag-unawa a 3. Isip Pagbubuo a 4. Kilos-loob Pagtataya b 5. Pangkaalamang Pakultad Pagsusuri b 6. Isip Pagsusuri c 7. Kilos-loob Pagtataya d 8. Isip Pagbubuo b 9. Kilos-loob Pagtataya c 10. Kakayahang Magkaparehong taglay ng Hayop at Tao Pag-unawa b All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  47. 47. D EPED C O PY 21 Balangkas ng Pagpapalalim Modyul 2: Ang Mataas na Gamit at Tunguhin ng Isip at Kilos-loob I. Panimula II. Kakayahang Taglay ng Tao 1. Pangkaalamang Pakultad A.1. Panlabas na Pandamdam A.2. Panloob na Pandamdam B. Isip 2. Pagkagustong Pakultad A. Emosyon B. Kilos-loob III. Kakayahang magkaparehong taglay ng hayop at tao subali’t magkaiba ang paraan ng paggamit sa mga ito 1. Pandamdam 2. Pagkagusto 3. Paggalaw IV. Isip 1. Gamit 2. Tunguhin - Katotohanan - Kakayahang magnilay o magmuni-muni - Kakayahang mag-abstraksiyon V. Kilos-Loob 1. Kalikasan 2. Gamit 3. Tunguhin - Umiiral na nagmamahal - Pagmamahal - Paglilingkod VI. Pagbubuod All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  48. 48. D EPED C O PY 22 Rubric para sa Gawain sa Paglinang ng mga Kaalaman, Kakayahan at Pag-unawa Kraytirya 3 2 1 Kaalaman / Pag-unawa - Malalim ang pag-unawa sa sitwasyon na binibigyang reaksiyon - Nakaangkla sa moral na batayan ang ibinigay na reaksiyon - Katamtaman ang lalim ng pag-unawa sa sitwasyong binibigyang reaksiyon - May pinagbatayan ang ibinigay na reaksiyon - Mababaw ang pag-unawa sa sitwasyon na binibigyang reaksiyon - Walang pinagbatayan ang ibinigay na reaksiyon Gamit ng isip at kilos-loob Ipinakita ang mataas na gamit at tunguhin ng isip at kilos-loob Ipinakita ang gamit at tunguhin ng isip at kilos-loob Hindi masiyadong nabigyang pokus ang gamit at tunguhin ng isip at kilos-loob Organisasyon Maayos at malinaw ang pagkakabuo at pagkakalahad ng reaksiyon Hindi gaanong maayos at malinaw ang pagkakabuo at pagkakalahad ng reaksiyon May kalabuan ang pagkakabuo at pagkakalahad ng reaksiyon Bilang ng reaksiyong naibigay Nabigyan ng reaksiyon ang 4 na argumentong inilahad Nabigyan ng reaksiyon ang 3 argumentong inilahad Nabigyan ng reaksiyon ang 2 argumentong inilahad All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  49. 49. D EPED C O PY 23 Rubric para sa Pagpapaliwanag ng Batayang Konsepto Gamit ang Graphic Organizer Kraytirya 4 3 2 1 Paghinuha ng batayang konsepto Nahinuha ang batayang konsepto nang hindi ginagabayan ng guro. Nahinuha ang batayang konsepto nang may kaunting paggabay ng guro. Nahinuha ang batayang konsepto ngunit kailangan ng labis na paggabay ng guro. Nahinuha ang batayang konsepto sa paggabay ng guro sa kabuuan nito. Pagpapaliwanag ng konsepto Malinaw na naipaliwanag ang lahat ng mahahalagang konsepto. May isang konsepto na hindi malinaw na naipaliwanag. May dalawang konsepto na hindi naipaliwanag. May tatlo o higit pang konsepto na hindi naipaliwanag. Paggamit ng graphic organizer Nakalikha ng sariling graphic organizer na ginamit upang maibigay o maibahagi ang batayang konsepto. Ginamit ang graphic organizer na nasa modyul at maayos na naibigay ang batayang konseptong gamit ito. Nakalikha ng sariling graphic organizer ngunit hindi malinaw na naibigay o naibahagi ang batayang konsepto na gamit ito. Ginamit ang graphic organizer na nasa modyul ngunit hindi malinaw na naibigay o naibahagi ang batayang konsepto na gamit ito. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  50. 50. D EPED C O PY 24 Rubric para sa Pagtataya ng Pagganap Kraytirya 3 2 1 Makatotohanan ang sitwasyong inilahad. Nakabatay sa sariling karanasan ang sitwasyong inilahad. Nakabatay sa karanasan ng iba ang sitwasyong inilahad. Walang sitwasyong inilahad. Malinaw at maayos ang pagkakasunud- sunod ng presentasyon ng katuwiran. Hindi masyadong malinaw at maayos ang pagkasunud- sunod ng presentasyon ng katuwiran. Nakalilito ang pagkasunud-sunod ng presentasyon ng katuwiran. Hindi akma ang mga katuwiran sa sitwasyon. May konkretong plano ng solusyon kaugnay ng sitwasyong inilahad. Naipakita ang gagawing paraan sa pagsasakatuparan ng solusyon. Hindi masyadong malinaw ang solusyong inilahad. Walang solusyong inilahad. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  51. 51. D EPED C O PY 25 Rubric para sa Pagtataya ng Pagsulat ng Pagninilay Kraytirya 4 3 2 1 Paraan ng pagsusulat - May matatag na istilo sa pagsusulat. - Malinaw ang pagpapahayag ng kaisipan. - May maayos na istilo sa pagsusulat. - May kakayahang magpahayag ng kaisipan. - Naipahayag ang kaisipan. - Nahirapang ipahayag ang kaisipan. Pagkaunawa May pagkaunawa sa mataas na gamit at tunguhin ng isip at kilos-loob. May pagkaunawa sa gamit at tunguhin ng isip at kilos- loob. May pagkaunawa tungkol sa isip at kilos-loob. May kaunting pagkaunawa tungkol sa isip at kilos- loob. Komitment Nagpahayag ng matibay na personal na planong kailangang gagawin para sa pagpapaunlad ng paggamit ng isip at kilos- loob. Nagpahayag ng planong gagawin para sa pagpapa- unlad ng paggamit ng isip at kilos- loob. Nagpahayag ng gagawing paraan ng paggamit ng isip at kilos- loob. Walang naipahayag na planong gagawin upang mapaunlad ang paggamit ng isip at kilos-loob. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  52. 52. D EPED C O PY 26 Rubric para sa Pagsasabuhay ng mga Angkop na Kilos upang Maipakita ang Kakayahang Mahanap ang Katotohanan na Maglingkod at Magmahal 4 3 2 1 Nakagawa ng sampu, pataas na pagkakataong tumulong o tumugon sa namasdang pangangailangan ng kapuwa o hinihingi ng sitwasyon. Nakagawa ng walong pagkakataong tumulong o tumugon sa namasdang pangangailangan ng kapuwa o hinihingi ng sitwasyon. Nakagawa ng limang pagkakataong tumulong o tumugon sa namasdang pangangailangan ng kapuwa o hinihingi ng sitwasyon. Nakagawa ng tatlong pagkakataong tumulong o tumugon sa namasdang pangangailangan ng kapuwa o hinihingi ng sitwasyon. May naitalang petsa at oras ng bawat pagsasagawa. May kulang sa naitalang petsa at oras ng pagsasagawa. May kulang na 2 sa naitalang petsa at oras ng pagsasagawa. May kulang na 3 sa naitalang petsa at oras ng pagsasagawa. May pangalan ng mga taong natulungan at lagda nila. Nailarawan nang maayos ang sitwasyon na tinugunan. May pangalan ng mga taong natulungan ngunit may 2 na walang lagda. Nailarawan ang sitwasyon na tinugunan. May pangalan ng taong natulungan ngunit may 4 na walang lagda. Hindi malinaw ang paglalarawan ng sitwasyon na tinugunan. May pangalan ng taong natulungan ngunit may 5 na walang lagda. Hindi nailarawan ang sitwasyong tinugunan. Malinaw at naipahayag ang damdamin at reyalisasyon sa isinulat na pagninilay. May kaunting kulang sa paglalahad ng damdamin at reyalisasyon sa isinulat na pagninilay. Hindi masyadong naipahayag ang damdamin at reyalisasyon sa naging karanasan sa isinulat na pagninilay. Hindi malinaw ang isinulat na pagninilay. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  53. 53. D EPED C O PY 27 Edukasyon sa Pagpapakatao Baitang 10 Unang Markahan Gabay sa Pagtuturo sa Modyul 3: PAGHUBOG NG KONSENSIYA BATAY SA LIKAS NA BATAS MORAL Bilang ng Oras: 4 I. Pag-uugnay ng mga Pamantayan sa Pagkatuto at mga Kasanayang Pampagkatuto Pamantayang Pangnilalaman: Naipamamalas ng mag-aaral ang pag- unawa sa konsepto ng paghubog ng konsensiya batay sa Likas na Batas Moral Pamantayan sa Pagganap: Nakagagawa ang mga mag-aaral ng angkop na kilos upang itama ang mga maling pasiyang ginawa Ano ang pinakamahalagang mensahe na dapat maunawaan at maipamalas ng mag-aaral? Ang konsensiyang nahubog batay sa Likas na Batas Moral ay nagsisilbing gabay sa tamang pagpapasiya at pagkilos. Ano ang patunay ng pag-unawa? Nakagagawa ng angkop na kilos batay sa konsensiyang nahubog ng Likas na Batas Moral Anong kakayahan ang dapat maipamalas tungo sa pag-unawa? Nakapagsusuri ng mga pasiyang ginawa batay sa mga Prinsipyo ng Likas na Batas Moral Anong kaalaman ang kailangan upang maipamalas ang pag-unawa? Nakikilala ang mga yugto ng konsensiya sa pagsusuri o pagninilay sa isang pagpapasiyang ginawa Pamantayan sa pagkatuto Batayang konsepto Pagsasabuhay ng mga pagkatuto Kakayahan Kaalaman All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  54. 54. D EPED C O PY 28 II. Pag-uugnay ng mga Kasanayang Pampagkatuto sa Pagtatasa Pagtatasa KP1: Pagsulat ng mga paraan o hakbang ng pagkilos ng konsensiya KP2: Pagsulat ng nabuong pasiya at pagtukoy sa batayan/prinsipyo sa pagbuo ng pasiya KP3: Pagsagot sa mga tanong sa bahaging Tayahin ang Iyong Pag-unawa Pagbuo at pagpapaliwanag ng Batayang Konsepto. KP4: Pagtataya ng sariling kakayahan ng konsensiya na makabuo ng tama at mabuting pasiya. Pagtatala ng limang mahahalagang aral mula sa mga gawain at babasahin Paglalahad ng mga angkop na hakbang na gagawin upang mabago at mapaunlad ang mga masasamang pasiya at kilos. Mga Kasanayang Pampagkatuto KP1: Nakikilala ang mga yugto ng konsensiya sa pagsusuri o pagninilay sa isang pagpapasiyang ginawa KP2: Nakapagsusuri ng mga pasiyang ginawa batay sa mga Prinsipyo ng Likas na Batas Moral KP3: Napatutunayan na ang konsensiyang nahubog batay sa Likas na Batas Moral ay nagsisilbing gabay sa tamang pagpapasiya at pagkilos KP4: Nakagagawa ng angkop na kilos batay sa konsensiyang nahubog ng Likas na Batas Moral . All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.
  55. 55. D EPED C O PY 29 III. Plano ng Pagtuturo-Pagkatuto A. ANO ANG INAASAHANG MAIPAMAMALAS MO? 1. Talakayin ang panimula sa pahina 42 ng Modyul 3. Mahalagang maiugnay ang kasalukuyang aralin sa mga nagdaang aralin tungkol sa isip at kilos-loob upang maipaunawa sa mga mag-aaral ang halaga ng pagkatuto mula sa mga ito at ang kaugnayan nito sa kasalukuyang modyul. 2. Mahalagang mapukaw ang isipan at damdamin ng mga mag-aaral sa panimula pa lamang upang matiyak na makukuha ang kanilang interes para sa pagsasagawa ng mga gawain. Maaaring tumawag ng ilang mga mag-aaral na magbabahagi ng kanilang karanasan kaugnay ng naunang pangungusap sa bahaging ito. 3. Ipabasa sa mga mag-aaral ang mahalagang tanong na nasa dulong bahagi ng panimula sa pahina 42. 4. Pagkatapos, ipabasa ang pahina 43 at isa-sahin ang mga layuning pampagkatuto (kasanayang pampagkatuto) para sa Modyul 3. 5. Sabihin: Mayroon ba kayong gustong linawin tungkol sa mga layuning binasa? Paunang Pagtataya Layunin: Tayahin ang kaalaman ng mag-aaral tungkol sa paksa sa antas ng KAALAMAN, KASANAYAN (process/skills), AT PAG-UNAWA (understanding of concepts) 1. Ipabasa ang panuto para sa Paunang Pagtataya sa pahina 43-45 ng modyul. Mayroon bang kailangang linawin sa Panuto? 2. Pasagutan sa mga mag-aaral ang Paunang Pagtataya sa loob ng 10 hanggang 15 minuto. 3. Ipaskil o isulat sa pisara ang tamang mga sagot sa Paunang Pagtataya. 4. Gamiting gabay ang resulta nito upang mataya ang mga kasanayang nangangailangan ng mas malalim na pagtalakay. 5. Palagdaan sa mag-aaral ang ginawang pagtataya at atasan silang itabi ito upang magamit sa paghahambing sa resulta ng pagsagot muli nito pagkatapos basahin ang Pagpapalalim. Tandaan: Hindi binanggit sa Modyul sa Pagkatuto ang kabuuan ng KP3 upang maiwasan na kaagad na mailahad sa mga mag-aaral ang Batayang Konsepto. Mahalagang matiyak na sa pagdaloy ng mga gawain at kabuuan ng aralin, mahihinuha nila ang Batayang Konsepto. All rights reserved. No part of this material may be reproduced or transmitted in any form or by any means - electronic or mechanical including photocopying – without written permission from the DepEd Central Office. First Edition, 2015.

×