Advertisement
Role of the pearl millet Aquaporin genes in abiotic stress tolerance
Upcoming SlideShare
Production of Genetically Modified Grape (Vitis vinifera L.) PlantsProduction of Genetically Modified Grape (Vitis vinifera L.) Plants
Loading in ... 3
1 of 1
Advertisement

More Related Content

Advertisement

More from ICRISAT(20)

Advertisement

Recently uploaded(20)

Role of the pearl millet Aquaporin genes in abiotic stress tolerance

  1. Feb 2017 Role of the pearl millet Aquaporin genes in abiotic stress tolerance Reddy PS*, Divya K, Sivasakthi K, Tharanya M, Lale A, Bhatnagar-Mathur P, Kholova J, Sharma KK, Vadez V *E-mail: p.sudhakarreddy@cgiar.org Introduction • Pearl millet (Pennisetum glaucum L.) is an important cereal crop of semi-arid tropics, which is grown across India and Sub-Saharan Africa. It is well adapted to grow in regions of very low rainfall and it can withstand long periods of drought. • Aquaporins are members of Major Intrinsic Proteins (MIP) family known to be present in the cell membranes and are involved in the conductance of water. • Aquaporin proteins are of special interest for water deficit adaptations as changes in AQPs have been linked to improved abiotic stress response. Objective Harnessing the role of Aquaporins in water conservation and abiotic stress tolerance improvement in Pearl Millet. Results 1. Seven PgAQP genes were cloned using homology based gene cloning approach and evolutionarily closer to maize than rice. 0 2 4 6 8 10 12 14 Leaf Root Leaf Root Leaf Root Leaf Root ICMR 1122 ICMR 1086 ICMR 1152 ICMR 1078 Relativeexpression Genotypes PIP1.1 PIP1.2 PIP2.1 PIP2.3 PIP2.6 TIP1.1 TIP2.2 Figure 2. Transpiration rate (Tr) response to increasing VPD in High Resolution Cross (HRC) genotypes. Figure 3. Relative expression of PgAQP genes under high VPD conditions using qPCR. 3. PgPIP2;6 transgenic tobacco plants were generated and functional characterization was done in homozygous T2 generation plants. LB 35s pro npt Poly A 35s pro PgPIP2;6 NosT RBa. pMDC100 comprises AQP cassette b. Steps involved in tobacco transformation c. PCR confirmation of putative transgenic tobacco plants Figure 4. Genetic transformation of tobacco with 35s-PgPIP2;6-NosT construct using the Leaf disc method. Conclusion PgPIP2;6 can be deployed to engineer stress tolerant transgenic crops for sustained growth and productivity under unfavorable conditions. Acknowledgements Science and Engineering Research Board (SERB), DST, Govt. of India for the research grant through Young Scientist Scheme SB/YS/LS-12/2013. This work has been undertaken as part of the CGIAR Research Program on Dryland Cereals. 2. Pearl millet genotypes showing contrasting transpiration response to high vapour pressure deficit (VPD) were identified. PgAQPs exhibited increased expression in VPD-insensitive genotypes under low and high VPD conditions. 4. PgPIP2;6 transgenic plants showed a better performance under drought stress and salinity compared to wild type plants. e. Transpiration reduction of heat stressed transgenic and wild type plants in the presence of aquaporin inhibitor AgCl2 . f. Relative water content measurement of drought stressed plants transgenic treated with aquaporin inhibitor AgCl2 . � � a. Visual difference in wild type and transgenic leaf discs after 7 days of 300 mM salt stress. b. Depicting leaf disc assay under salt stress. c. The relative total chlorophyll levels of salt stressed leaf discs from transgenic as well as wild type plants. d. Lipid peroxidation levels in salt stressed plants. Figure 1. Cloning and sequence analysis of pearl millet AQP genes. Cloning ARGAGGTSGAYG TCCSGAARGART Degenerate primers from related species Phylogenetic analysis Motif 1 Motif 2 Motif 3 PgPIP1;1 1 MEGKEEDVRLGANKYSERQPIGTAAQGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMG--------VSKSNTKCATVGIQGIA 93 PgPIP1;2 1 MEGKEEDVRLGANKYSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYISILTVMG--------VSKSQSKCATVGIQGIA 93 PgPIP2;1 1 MGKDDVIES-----------GAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPTASGADAACGGVGILGIA 89 PgPIP2;6 1 MGKEVDVSA-----------LEAGG---VRDYADPPPAPLVDIDELGKWSLYRAVIAEFVATMLFLYITVATVIGYKHQTDASASGPDAACGGVGILGIA 86 PgTIP1;1 1 MAAAGIRLCRSESIAVGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFS------KLSPGG-SSPAGLISAA 69 PgTIP2;2 1 MSGNIAFGRFGDSFSAASLRAYVAEFISSLVFVFAGVGSAIAYR------KLSDGAPLDATGLVAVA 61 . .* ***... .*.. . . *. * Motif 4 Motif 5 PgPIP1;1 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANTVASGYTKGSGLGAEIIGTFVLVYTV 194 PgPIP1;2 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQEGLYMGNGGGANMVASGYTKGDGLGAEIVGTFVLVYTV 194 PgPIP2;1 90 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTV 190 PgPIP2;6 87 WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGVALVKGFQSGFYARYGGGANEVSAGYSTGTGLAAEIVGTFVLVYTV 187 PgTIP1;1 70 IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACFLLRFSTGGLPTGTFG-----LTGISVWEALVLEIVMTFGLVYTV 165 PgTIP2;2 62 VCHGFALFVAVAIGANISGGHVNPAVTFGLVLGGQITMLTGLFYWIAQLVGAIVGAVLVQFSTG-VATPTHG-----LSGIGTLEGVVMEIIVTFGLVYIV 156 . .* * *.*****.******* . ... . * * .*. ... * .* . **. ** *** * H2 Motif 6 Motif 5 PgPIP1;1 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRA------LPFKSRD 288 PgPIP1;2 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRSQAWDDHWIFWVGPFIGAALAAIYHQVIISA------IPFKSRS 288 PgPIP2;1 191 FSATDPKRNARDSHVPALAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA 290 PgPIP2;6 188 FSATDPKRNARDSHIPVLAPLPIGFAVFMVHLPTIPITGTGINPARSLGAAVVYNNSKAWSDQWIFWVGPFIGAAIAALYHQIVLRA-SARGYGSFRSNA 286 PgTIP1;1 166 YATAVD---PKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVS---WSWGYQWVYWVGPLIGGGLAGIIYEVLFIS---HTHEQLPSTDY 257 PgTIP2;2 157 YATAAD---PKKGSLGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVAS---GDFTNIWIYWVGPLVGGGLAGIVYRYIYMC---GDHAPVASSEF 248 .... . . .**. *** * * * .*** * * *. *..**** .* .* . . * H5 LE1 LE2/P2 P3 P4P5 Sequence analysis for PgAQPs Figure 5. Functional characterization of PgPIP2;6 transgenic tobacco plants under salt, drought and heat stress treatments. a. pMDC100 comprises PgPIP2;6 cassette About ICRISAT: www.icrisat.org ICRISAT’s scientific information: http://EXPLOREit.icrisat.org
Advertisement