SlideShare a Scribd company logo
1 of 1
Download to read offline
Feb
2017
Role of the pearl millet Aquaporin genes
in abiotic stress tolerance
Reddy PS*, Divya K, Sivasakthi K, Tharanya M, Lale A, Bhatnagar-Mathur P, Kholova J, Sharma KK, Vadez V
*E-mail: p.sudhakarreddy@cgiar.org
Introduction
•	Pearl millet (Pennisetum glaucum L.) is an important cereal crop of semi-arid
tropics, which is grown across India and Sub-Saharan Africa. It is well adapted to
grow in regions of very low rainfall and it can withstand long periods of drought.
•	Aquaporins are members of Major Intrinsic Proteins (MIP) family known to be
present in the cell membranes and are involved in the conductance of water.
•	Aquaporin proteins are of special interest for water deficit adaptations as
changes in AQPs have been linked to improved abiotic stress response.
Objective
Harnessing the role of Aquaporins in water conservation and abiotic stress
tolerance improvement in Pearl Millet.
Results
1. Seven PgAQP genes were cloned using homology based gene cloning approach
and evolutionarily closer to maize than rice.
0
2
4
6
8
10
12
14
Leaf Root Leaf Root Leaf Root Leaf Root
ICMR 1122 ICMR 1086 ICMR 1152 ICMR 1078
Relativeexpression
Genotypes
PIP1.1 PIP1.2 PIP2.1 PIP2.3
PIP2.6 TIP1.1 TIP2.2
Figure 2. Transpiration rate (Tr) response
to increasing VPD in High Resolution
Cross (HRC) genotypes.
Figure 3. Relative expression of PgAQP genes under
high VPD conditions using qPCR.
3. PgPIP2;6 transgenic tobacco plants were generated and functional
characterization was done in homozygous T2 generation plants.
LB
35s pro npt Poly A 35s pro PgPIP2;6 NosT
RBa. pMDC100 comprises AQP cassette
b. Steps involved in tobacco transformation
c. PCR
confirmation of
putative transgenic
tobacco plants
Figure 4. Genetic transformation of tobacco with 35s-PgPIP2;6-NosT construct using the Leaf
disc method.
Conclusion
PgPIP2;6 can be deployed to engineer stress tolerant transgenic crops for
sustained growth and productivity under unfavorable conditions.
Acknowledgements
Science and Engineering Research Board (SERB), DST, Govt. of India for the
research grant through Young Scientist Scheme SB/YS/LS-12/2013. This work has
been undertaken as part of the CGIAR Research Program on Dryland Cereals.
2. Pearl millet genotypes showing contrasting transpiration response to high
vapour pressure deficit (VPD) were identified. PgAQPs exhibited increased
expression in VPD-insensitive genotypes under low and high VPD conditions.
4. PgPIP2;6 transgenic plants showed a better performance under drought stress
and salinity compared to wild type plants.
e. Transpiration reduction of heat stressed
transgenic and wild type plants in the
presence of aquaporin inhibitor AgCl2
.
f. Relative water content measurement of
drought stressed plants transgenic treated with
aquaporin inhibitor AgCl2
.
� �
a. Visual difference in wild type and transgenic leaf
discs after 7 days of 300 mM salt stress.
b. Depicting leaf disc assay under salt
stress.
c. The relative total chlorophyll levels of salt
stressed leaf discs from transgenic as well as
wild type plants.
d. Lipid peroxidation levels in salt stressed
plants.
Figure 1. Cloning and sequence analysis of pearl millet AQP genes.
Cloning
ARGAGGTSGAYG
TCCSGAARGART
Degenerate primers from related species
Phylogenetic analysis
Motif 1 Motif 2 Motif 3
PgPIP1;1 1 MEGKEEDVRLGANKYSERQPIGTAAQGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMG--------VSKSNTKCATVGIQGIA 93
PgPIP1;2 1 MEGKEEDVRLGANKYSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYISILTVMG--------VSKSQSKCATVGIQGIA 93
PgPIP2;1 1 MGKDDVIES-----------GAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPTASGADAACGGVGILGIA 89
PgPIP2;6 1 MGKEVDVSA-----------LEAGG---VRDYADPPPAPLVDIDELGKWSLYRAVIAEFVATMLFLYITVATVIGYKHQTDASASGPDAACGGVGILGIA 86
PgTIP1;1 1 MAAAGIRLCRSESIAVGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFS------KLSPGG-SSPAGLISAA 69
PgTIP2;2 1 MSGNIAFGRFGDSFSAASLRAYVAEFISSLVFVFAGVGSAIAYR------KLSDGAPLDATGLVAVA 61
. .* ***... .*.. . . *. *
Motif 4 Motif 5
PgPIP1;1 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANTVASGYTKGSGLGAEIIGTFVLVYTV 194
PgPIP1;2 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQEGLYMGNGGGANMVASGYTKGDGLGAEIVGTFVLVYTV 194
PgPIP2;1 90 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTV 190
PgPIP2;6 87 WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGVALVKGFQSGFYARYGGGANEVSAGYSTGTGLAAEIVGTFVLVYTV 187
PgTIP1;1 70 IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACFLLRFSTGGLPTGTFG-----LTGISVWEALVLEIVMTFGLVYTV 165
PgTIP2;2 62 VCHGFALFVAVAIGANISGGHVNPAVTFGLVLGGQITMLTGLFYWIAQLVGAIVGAVLVQFSTG-VATPTHG-----LSGIGTLEGVVMEIIVTFGLVYIV 156
. .* * *.*****.******* . ... . * * .*. ... * .* . **. ** *** *
H2
Motif 6 Motif 5
PgPIP1;1 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRA------LPFKSRD 288
PgPIP1;2 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRSQAWDDHWIFWVGPFIGAALAAIYHQVIISA------IPFKSRS 288
PgPIP2;1 191 FSATDPKRNARDSHVPALAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA 290
PgPIP2;6 188 FSATDPKRNARDSHIPVLAPLPIGFAVFMVHLPTIPITGTGINPARSLGAAVVYNNSKAWSDQWIFWVGPFIGAAIAALYHQIVLRA-SARGYGSFRSNA 286
PgTIP1;1 166 YATAVD---PKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVS---WSWGYQWVYWVGPLIGGGLAGIIYEVLFIS---HTHEQLPSTDY 257
PgTIP2;2 157 YATAAD---PKKGSLGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVAS---GDFTNIWIYWVGPLVGGGLAGIVYRYIYMC---GDHAPVASSEF 248
.... . . .**. *** * * * .*** * * *. *..**** .* .* . . *
H5 LE1 LE2/P2 P3 P4P5
Sequence analysis for PgAQPs
Figure 5. Functional characterization of PgPIP2;6 transgenic tobacco plants under salt, drought
and heat stress treatments.
a. pMDC100 comprises PgPIP2;6 cassette
About ICRISAT: www.icrisat.org
ICRISAT’s scientific information: http://EXPLOREit.icrisat.org

More Related Content

What's hot

Genetics of Submergence Tolerance in Rice
Genetics of Submergence Tolerance in RiceGenetics of Submergence Tolerance in Rice
Genetics of Submergence Tolerance in RiceJyoti Prakash Sahoo
 
PCUBE--Protein Production Platform for mAb generation. Part I
PCUBE--Protein Production Platform for mAb generation. Part IPCUBE--Protein Production Platform for mAb generation. Part I
PCUBE--Protein Production Platform for mAb generation. Part Icarlociatto
 
2012. frank ordon. genomics based breeding research for improving resistance ...
2012. frank ordon. genomics based breeding research for improving resistance ...2012. frank ordon. genomics based breeding research for improving resistance ...
2012. frank ordon. genomics based breeding research for improving resistance ...FOODCROPS
 
CRISPR Is On The Move: Genome Editing From Rice To Wheat
CRISPR Is On The Move: Genome Editing From Rice To WheatCRISPR Is On The Move: Genome Editing From Rice To Wheat
CRISPR Is On The Move: Genome Editing From Rice To WheatFabio Caligaris
 
Appl. Environ. Microbiol.-2016-Chen-2156-66
Appl. Environ. Microbiol.-2016-Chen-2156-66Appl. Environ. Microbiol.-2016-Chen-2156-66
Appl. Environ. Microbiol.-2016-Chen-2156-66Lisa Stabryla
 
Genetic Engineering for drought
Genetic Engineering for droughtGenetic Engineering for drought
Genetic Engineering for droughtRachana Bagudam
 
Targeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-CasTargeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-CasKate Barlow
 
Plant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C Bansal
Plant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C BansalPlant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C Bansal
Plant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C BansalGlobal Plant Council
 
Genome editing as a tool for enhancing disease resistance in crops - Vladimir...
Genome editing as a tool for enhancing disease resistance in crops - Vladimir...Genome editing as a tool for enhancing disease resistance in crops - Vladimir...
Genome editing as a tool for enhancing disease resistance in crops - Vladimir...OECD Environment
 
Next generation biotherapeutics production system Trichoderma reesei
Next generation biotherapeutics production system Trichoderma reeseiNext generation biotherapeutics production system Trichoderma reesei
Next generation biotherapeutics production system Trichoderma reeseiChristopher Landowski
 
Delayed ripening by anurag patel 2889[svpua&t meerut]
Delayed ripening by anurag patel  2889[svpua&t meerut]Delayed ripening by anurag patel  2889[svpua&t meerut]
Delayed ripening by anurag patel 2889[svpua&t meerut]ANURAG PATEL
 
2006 overexpressing a nam, ataf, and cuc (nac)
2006 overexpressing a nam, ataf, and cuc (nac)2006 overexpressing a nam, ataf, and cuc (nac)
2006 overexpressing a nam, ataf, and cuc (nac)Agrin Life
 
H gh power resources
H gh power resourcesH gh power resources
H gh power resourcesabhinav009
 
Bacterial Neuraminidase Simpson Lab
Bacterial Neuraminidase Simpson LabBacterial Neuraminidase Simpson Lab
Bacterial Neuraminidase Simpson LabRosemary Cullander
 

What's hot (17)

Genetics of Submergence Tolerance in Rice
Genetics of Submergence Tolerance in RiceGenetics of Submergence Tolerance in Rice
Genetics of Submergence Tolerance in Rice
 
PCUBE--Protein Production Platform for mAb generation. Part I
PCUBE--Protein Production Platform for mAb generation. Part IPCUBE--Protein Production Platform for mAb generation. Part I
PCUBE--Protein Production Platform for mAb generation. Part I
 
2012. frank ordon. genomics based breeding research for improving resistance ...
2012. frank ordon. genomics based breeding research for improving resistance ...2012. frank ordon. genomics based breeding research for improving resistance ...
2012. frank ordon. genomics based breeding research for improving resistance ...
 
CRISPR Is On The Move: Genome Editing From Rice To Wheat
CRISPR Is On The Move: Genome Editing From Rice To WheatCRISPR Is On The Move: Genome Editing From Rice To Wheat
CRISPR Is On The Move: Genome Editing From Rice To Wheat
 
Appl. Environ. Microbiol.-2016-Chen-2156-66
Appl. Environ. Microbiol.-2016-Chen-2156-66Appl. Environ. Microbiol.-2016-Chen-2156-66
Appl. Environ. Microbiol.-2016-Chen-2156-66
 
Genetic Engineering for drought
Genetic Engineering for droughtGenetic Engineering for drought
Genetic Engineering for drought
 
Targeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-CasTargeted Breeding Applications of CRISPR-Cas
Targeted Breeding Applications of CRISPR-Cas
 
Plant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C Bansal
Plant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C BansalPlant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C Bansal
Plant Genome Engineering for Agriculture, Food and Nutrition by Dr. K C Bansal
 
Genome editing as a tool for enhancing disease resistance in crops - Vladimir...
Genome editing as a tool for enhancing disease resistance in crops - Vladimir...Genome editing as a tool for enhancing disease resistance in crops - Vladimir...
Genome editing as a tool for enhancing disease resistance in crops - Vladimir...
 
Gibb history
Gibb historyGibb history
Gibb history
 
Next generation biotherapeutics production system Trichoderma reesei
Next generation biotherapeutics production system Trichoderma reeseiNext generation biotherapeutics production system Trichoderma reesei
Next generation biotherapeutics production system Trichoderma reesei
 
Delayed ripening by anurag patel 2889[svpua&t meerut]
Delayed ripening by anurag patel  2889[svpua&t meerut]Delayed ripening by anurag patel  2889[svpua&t meerut]
Delayed ripening by anurag patel 2889[svpua&t meerut]
 
Katagiri i 110614
Katagiri i 110614Katagiri i 110614
Katagiri i 110614
 
2006 overexpressing a nam, ataf, and cuc (nac)
2006 overexpressing a nam, ataf, and cuc (nac)2006 overexpressing a nam, ataf, and cuc (nac)
2006 overexpressing a nam, ataf, and cuc (nac)
 
H gh power resources
H gh power resourcesH gh power resources
H gh power resources
 
Bacterial Neuraminidase Simpson Lab
Bacterial Neuraminidase Simpson LabBacterial Neuraminidase Simpson Lab
Bacterial Neuraminidase Simpson Lab
 
Cryo Write Up
Cryo Write UpCryo Write Up
Cryo Write Up
 

Viewers also liked

Heat induced differential proteomic changes reveal molecular mechanisms respo...
Heat induced differential proteomic changes reveal molecular mechanisms respo...Heat induced differential proteomic changes reveal molecular mechanisms respo...
Heat induced differential proteomic changes reveal molecular mechanisms respo...ICRISAT
 
Sorghum early vigor affects grain size, striga resistance and might be linked...
Sorghum early vigor affects grain size, striga resistance and might be linked...Sorghum early vigor affects grain size, striga resistance and might be linked...
Sorghum early vigor affects grain size, striga resistance and might be linked...ICRISAT
 
Allelic diversity and association analysis for candidate abiotic stress respo...
Allelic diversity and association analysis for candidate abiotic stress respo...Allelic diversity and association analysis for candidate abiotic stress respo...
Allelic diversity and association analysis for candidate abiotic stress respo...ICRISAT
 
Utilizing genomic resources for understanding the stay-green QTLs interaction...
Utilizing genomic resources for understanding the stay-green QTLs interaction...Utilizing genomic resources for understanding the stay-green QTLs interaction...
Utilizing genomic resources for understanding the stay-green QTLs interaction...ICRISAT
 
Isolation and characterization of stress inducible promoters from Pennisetum ...
Isolation and characterization of stress inducible promoters from Pennisetum ...Isolation and characterization of stress inducible promoters from Pennisetum ...
Isolation and characterization of stress inducible promoters from Pennisetum ...ICRISAT
 
Screening for drought tolerance in finger millet germplasm
Screening for drought tolerance in finger millet germplasmScreening for drought tolerance in finger millet germplasm
Screening for drought tolerance in finger millet germplasmICRISAT
 
Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...
Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...
Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...ICRISAT
 
Genetic engineering for abiotic stress tolerance
Genetic engineering for abiotic stress toleranceGenetic engineering for abiotic stress tolerance
Genetic engineering for abiotic stress toleranceSachin Ekatpure
 
Drought n heat abiotic stress in plants
Drought n heat abiotic stress  in plantsDrought n heat abiotic stress  in plants
Drought n heat abiotic stress in plantsDr. Kirti Mehta
 
Credit seminar abiotic stress tolerance in cucurbits
Credit seminar abiotic stress tolerance in cucurbitsCredit seminar abiotic stress tolerance in cucurbits
Credit seminar abiotic stress tolerance in cucurbitsPrabhat Singh Sikarwar
 
Seminar abiotic stress
Seminar abiotic stressSeminar abiotic stress
Seminar abiotic stressAkula Dinesh
 
Abiotic stress resistance @ sid
Abiotic stress resistance @ sidAbiotic stress resistance @ sid
Abiotic stress resistance @ sidsidjena70
 
Plant response to stress
Plant response to stressPlant response to stress
Plant response to stressfloradelaterra
 

Viewers also liked (16)

Heat induced differential proteomic changes reveal molecular mechanisms respo...
Heat induced differential proteomic changes reveal molecular mechanisms respo...Heat induced differential proteomic changes reveal molecular mechanisms respo...
Heat induced differential proteomic changes reveal molecular mechanisms respo...
 
Sorghum early vigor affects grain size, striga resistance and might be linked...
Sorghum early vigor affects grain size, striga resistance and might be linked...Sorghum early vigor affects grain size, striga resistance and might be linked...
Sorghum early vigor affects grain size, striga resistance and might be linked...
 
Allelic diversity and association analysis for candidate abiotic stress respo...
Allelic diversity and association analysis for candidate abiotic stress respo...Allelic diversity and association analysis for candidate abiotic stress respo...
Allelic diversity and association analysis for candidate abiotic stress respo...
 
Utilizing genomic resources for understanding the stay-green QTLs interaction...
Utilizing genomic resources for understanding the stay-green QTLs interaction...Utilizing genomic resources for understanding the stay-green QTLs interaction...
Utilizing genomic resources for understanding the stay-green QTLs interaction...
 
Isolation and characterization of stress inducible promoters from Pennisetum ...
Isolation and characterization of stress inducible promoters from Pennisetum ...Isolation and characterization of stress inducible promoters from Pennisetum ...
Isolation and characterization of stress inducible promoters from Pennisetum ...
 
Screening for drought tolerance in finger millet germplasm
Screening for drought tolerance in finger millet germplasmScreening for drought tolerance in finger millet germplasm
Screening for drought tolerance in finger millet germplasm
 
Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...
Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...
Super-early pigeonpea varieties and hybrids: New intervener for maximized, ti...
 
Genetic engineering for abiotic stress tolerance
Genetic engineering for abiotic stress toleranceGenetic engineering for abiotic stress tolerance
Genetic engineering for abiotic stress tolerance
 
Drought n heat abiotic stress in plants
Drought n heat abiotic stress  in plantsDrought n heat abiotic stress  in plants
Drought n heat abiotic stress in plants
 
Credit seminar abiotic stress tolerance in cucurbits
Credit seminar abiotic stress tolerance in cucurbitsCredit seminar abiotic stress tolerance in cucurbits
Credit seminar abiotic stress tolerance in cucurbits
 
Temperature tolerance
Temperature toleranceTemperature tolerance
Temperature tolerance
 
Abiotic stresses in plant
Abiotic stresses in plantAbiotic stresses in plant
Abiotic stresses in plant
 
ACCASIA PPT
ACCASIA PPTACCASIA PPT
ACCASIA PPT
 
Seminar abiotic stress
Seminar abiotic stressSeminar abiotic stress
Seminar abiotic stress
 
Abiotic stress resistance @ sid
Abiotic stress resistance @ sidAbiotic stress resistance @ sid
Abiotic stress resistance @ sid
 
Plant response to stress
Plant response to stressPlant response to stress
Plant response to stress
 

Similar to Role of pearl millet Aquaporin genes in abiotic stress tolerance

Physiological and molecular basis of drought tolerance in rice
Physiological and molecular basis of drought tolerance in ricePhysiological and molecular basis of drought tolerance in rice
Physiological and molecular basis of drought tolerance in riceAlex Harley
 
Breeding for Drought resistance in Rice
Breeding for Drought resistance in RiceBreeding for Drought resistance in Rice
Breeding for Drought resistance in RiceRoshan Parihar
 
JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018 JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018 Irina Silva
 
Transgenic barley
Transgenic barley Transgenic barley
Transgenic barley Abhishek Das
 
JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018 JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018 Irina Silva
 
Loknath MuNAC4 plant expression
Loknath MuNAC4 plant expressionLoknath MuNAC4 plant expression
Loknath MuNAC4 plant expressionlokanadha
 
Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...
Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...
Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...Premier Publishers
 
Gluten Degrading Bacteria based on reasearch paper.pptx
Gluten Degrading Bacteria  based on reasearch paper.pptxGluten Degrading Bacteria  based on reasearch paper.pptx
Gluten Degrading Bacteria based on reasearch paper.pptxAdeeshRawat
 
Proposal march 2012
Proposal march 2012Proposal march 2012
Proposal march 2012valrivera
 
CRISPR-Cas9 : A novel tool for genome editing for crop improvement
CRISPR-Cas9 : A novel tool for genome editing for crop improvementCRISPR-Cas9 : A novel tool for genome editing for crop improvement
CRISPR-Cas9 : A novel tool for genome editing for crop improvementGarima188199
 
Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...
Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...
Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...ICRISAT
 
VIGS in barley seedlings leaves
VIGS in barley seedlings leavesVIGS in barley seedlings leaves
VIGS in barley seedlings leaveslokanadha
 
To study of the genetic variations among the Azospirillum lipoferu isolates u...
To study of the genetic variations among the Azospirillum lipoferu isolates u...To study of the genetic variations among the Azospirillum lipoferu isolates u...
To study of the genetic variations among the Azospirillum lipoferu isolates u...ijsrd.com
 
Honours Report Draft COMPLETE
Honours Report Draft COMPLETEHonours Report Draft COMPLETE
Honours Report Draft COMPLETEBjorn Hunter
 
JBEI highlights November 2019
JBEI highlights November 2019JBEI highlights November 2019
JBEI highlights November 2019LeahFreemanSloan
 

Similar to Role of pearl millet Aquaporin genes in abiotic stress tolerance (20)

Physiological and molecular basis of drought tolerance in rice
Physiological and molecular basis of drought tolerance in ricePhysiological and molecular basis of drought tolerance in rice
Physiological and molecular basis of drought tolerance in rice
 
Breeding for Drought resistance in Rice
Breeding for Drought resistance in RiceBreeding for Drought resistance in Rice
Breeding for Drought resistance in Rice
 
JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018 JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018
 
Transgenic barley
Transgenic barley Transgenic barley
Transgenic barley
 
JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018 JBEI Research Highlights - September 2018
JBEI Research Highlights - September 2018
 
Loknath MuNAC4 plant expression
Loknath MuNAC4 plant expressionLoknath MuNAC4 plant expression
Loknath MuNAC4 plant expression
 
Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...
Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...
Successful colonization of roots and Plant growth promotion of sorghum (Sorgh...
 
Gluten Degrading Bacteria based on reasearch paper.pptx
Gluten Degrading Bacteria  based on reasearch paper.pptxGluten Degrading Bacteria  based on reasearch paper.pptx
Gluten Degrading Bacteria based on reasearch paper.pptx
 
Proposal march 2012
Proposal march 2012Proposal march 2012
Proposal march 2012
 
CRISPR-Cas9 : A novel tool for genome editing for crop improvement
CRISPR-Cas9 : A novel tool for genome editing for crop improvementCRISPR-Cas9 : A novel tool for genome editing for crop improvement
CRISPR-Cas9 : A novel tool for genome editing for crop improvement
 
Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...
Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...
Fine mapping of stay-green QTLs on sorghum chromosome SBI-10L-An approach fro...
 
VIGS in barley seedlings leaves
VIGS in barley seedlings leavesVIGS in barley seedlings leaves
VIGS in barley seedlings leaves
 
To study of the genetic variations among the Azospirillum lipoferu isolates u...
To study of the genetic variations among the Azospirillum lipoferu isolates u...To study of the genetic variations among the Azospirillum lipoferu isolates u...
To study of the genetic variations among the Azospirillum lipoferu isolates u...
 
Honours Report Draft COMPLETE
Honours Report Draft COMPLETEHonours Report Draft COMPLETE
Honours Report Draft COMPLETE
 
JBEI highlights November 2019
JBEI highlights November 2019JBEI highlights November 2019
JBEI highlights November 2019
 
3065.pptx
3065.pptx3065.pptx
3065.pptx
 
2015
20152015
2015
 
Improvement of drought tolerance through genetic engineering
Improvement of drought tolerance through genetic engineeringImprovement of drought tolerance through genetic engineering
Improvement of drought tolerance through genetic engineering
 
My Book Polyglutamic acid
My Book Polyglutamic acidMy Book Polyglutamic acid
My Book Polyglutamic acid
 
CRISPR mediated haploid inducer stock development in rice
CRISPR mediated haploid inducer stock development in riceCRISPR mediated haploid inducer stock development in rice
CRISPR mediated haploid inducer stock development in rice
 

More from ICRISAT

ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...
ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...
ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...ICRISAT
 
Uzbek delegation explores climate-resilient crop options for arid, degraded e...
Uzbek delegation explores climate-resilient crop options for arid, degraded e...Uzbek delegation explores climate-resilient crop options for arid, degraded e...
Uzbek delegation explores climate-resilient crop options for arid, degraded e...ICRISAT
 
Indian Ambassador to Niger explores opportunities for South-South cooperation
Indian Ambassador to Niger explores opportunities for South-South cooperationIndian Ambassador to Niger explores opportunities for South-South cooperation
Indian Ambassador to Niger explores opportunities for South-South cooperationICRISAT
 
WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...
WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...
WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...ICRISAT
 
Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...
Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...
Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...ICRISAT
 
UK Ambassador to Niger discusses climate change adaptation and humanitarian i...
UK Ambassador to Niger discusses climate change adaptation and humanitarian i...UK Ambassador to Niger discusses climate change adaptation and humanitarian i...
UK Ambassador to Niger discusses climate change adaptation and humanitarian i...ICRISAT
 
New climate-resilient, disease-resistant chickpea varieties coming farmers’ way
New climate-resilient, disease-resistant chickpea varieties coming farmers’ wayNew climate-resilient, disease-resistant chickpea varieties coming farmers’ way
New climate-resilient, disease-resistant chickpea varieties coming farmers’ wayICRISAT
 
Deputy Collector gets training on agriculture research at ICRISAT Hyderabad
Deputy Collector gets training on agriculture research at ICRISAT HyderabadDeputy Collector gets training on agriculture research at ICRISAT Hyderabad
Deputy Collector gets training on agriculture research at ICRISAT HyderabadICRISAT
 
Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...
Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...
Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...ICRISAT
 
ICRISAT to share expertise on sorghum production with farmers in Somalia
ICRISAT to share expertise on sorghum production with farmers in SomaliaICRISAT to share expertise on sorghum production with farmers in Somalia
ICRISAT to share expertise on sorghum production with farmers in SomaliaICRISAT
 
4CAST: New digital tool to enhance farmers’ access to modern varieties
4CAST: New digital tool to enhance farmers’ access to modern varieties4CAST: New digital tool to enhance farmers’ access to modern varieties
4CAST: New digital tool to enhance farmers’ access to modern varietiesICRISAT
 
New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...
New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...
New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...ICRISAT
 
ICRISAT awarded 2021 Africa Food Prize
ICRISAT awarded 2021 Africa Food PrizeICRISAT awarded 2021 Africa Food Prize
ICRISAT awarded 2021 Africa Food PrizeICRISAT
 
Rooting for strong partnerships and participatory extension in Nigeria for ro...
Rooting for strong partnerships and participatory extension in Nigeria for ro...Rooting for strong partnerships and participatory extension in Nigeria for ro...
Rooting for strong partnerships and participatory extension in Nigeria for ro...ICRISAT
 
Understanding consumption preferences for sorghum and millets globally
Understanding consumption preferences for sorghum and millets globallyUnderstanding consumption preferences for sorghum and millets globally
Understanding consumption preferences for sorghum and millets globallyICRISAT
 
ICRISAT introduces an invigorated research structure (The research structure ...
ICRISAT introduces an invigorated research structure (The research structure ...ICRISAT introduces an invigorated research structure (The research structure ...
ICRISAT introduces an invigorated research structure (The research structure ...ICRISAT
 
Training on science communication to engage funders and stakeholders
Training on science communication to engage funders and stakeholdersTraining on science communication to engage funders and stakeholders
Training on science communication to engage funders and stakeholdersICRISAT
 
Virtual training in the use of remote sensing for the agriculture sector in P...
Virtual training in the use of remote sensing for the agriculture sector in P...Virtual training in the use of remote sensing for the agriculture sector in P...
Virtual training in the use of remote sensing for the agriculture sector in P...ICRISAT
 
Icrisat strategic plan 2021 2025
Icrisat strategic  plan 2021  2025Icrisat strategic  plan 2021  2025
Icrisat strategic plan 2021 2025ICRISAT
 
ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...
ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...
ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...ICRISAT
 

More from ICRISAT (20)

ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...
ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...
ICRISAT’s soil laboratory registers with FAO’s International Network on Ferti...
 
Uzbek delegation explores climate-resilient crop options for arid, degraded e...
Uzbek delegation explores climate-resilient crop options for arid, degraded e...Uzbek delegation explores climate-resilient crop options for arid, degraded e...
Uzbek delegation explores climate-resilient crop options for arid, degraded e...
 
Indian Ambassador to Niger explores opportunities for South-South cooperation
Indian Ambassador to Niger explores opportunities for South-South cooperationIndian Ambassador to Niger explores opportunities for South-South cooperation
Indian Ambassador to Niger explores opportunities for South-South cooperation
 
WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...
WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...
WFP, ICRISAT to partner on climate-resilience, food security, nutrition and l...
 
Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...
Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...
Visit by Sri Lankan Deputy High Commissioner to ICRISAT opens opportunities f...
 
UK Ambassador to Niger discusses climate change adaptation and humanitarian i...
UK Ambassador to Niger discusses climate change adaptation and humanitarian i...UK Ambassador to Niger discusses climate change adaptation and humanitarian i...
UK Ambassador to Niger discusses climate change adaptation and humanitarian i...
 
New climate-resilient, disease-resistant chickpea varieties coming farmers’ way
New climate-resilient, disease-resistant chickpea varieties coming farmers’ wayNew climate-resilient, disease-resistant chickpea varieties coming farmers’ way
New climate-resilient, disease-resistant chickpea varieties coming farmers’ way
 
Deputy Collector gets training on agriculture research at ICRISAT Hyderabad
Deputy Collector gets training on agriculture research at ICRISAT HyderabadDeputy Collector gets training on agriculture research at ICRISAT Hyderabad
Deputy Collector gets training on agriculture research at ICRISAT Hyderabad
 
Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...
Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...
Cereal-legume value chain stakeholders in WCA meet to develop demand-driven a...
 
ICRISAT to share expertise on sorghum production with farmers in Somalia
ICRISAT to share expertise on sorghum production with farmers in SomaliaICRISAT to share expertise on sorghum production with farmers in Somalia
ICRISAT to share expertise on sorghum production with farmers in Somalia
 
4CAST: New digital tool to enhance farmers’ access to modern varieties
4CAST: New digital tool to enhance farmers’ access to modern varieties4CAST: New digital tool to enhance farmers’ access to modern varieties
4CAST: New digital tool to enhance farmers’ access to modern varieties
 
New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...
New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...
New ‘one-stop shop’ team formed to take ICRISAT’S plant breeding program in W...
 
ICRISAT awarded 2021 Africa Food Prize
ICRISAT awarded 2021 Africa Food PrizeICRISAT awarded 2021 Africa Food Prize
ICRISAT awarded 2021 Africa Food Prize
 
Rooting for strong partnerships and participatory extension in Nigeria for ro...
Rooting for strong partnerships and participatory extension in Nigeria for ro...Rooting for strong partnerships and participatory extension in Nigeria for ro...
Rooting for strong partnerships and participatory extension in Nigeria for ro...
 
Understanding consumption preferences for sorghum and millets globally
Understanding consumption preferences for sorghum and millets globallyUnderstanding consumption preferences for sorghum and millets globally
Understanding consumption preferences for sorghum and millets globally
 
ICRISAT introduces an invigorated research structure (The research structure ...
ICRISAT introduces an invigorated research structure (The research structure ...ICRISAT introduces an invigorated research structure (The research structure ...
ICRISAT introduces an invigorated research structure (The research structure ...
 
Training on science communication to engage funders and stakeholders
Training on science communication to engage funders and stakeholdersTraining on science communication to engage funders and stakeholders
Training on science communication to engage funders and stakeholders
 
Virtual training in the use of remote sensing for the agriculture sector in P...
Virtual training in the use of remote sensing for the agriculture sector in P...Virtual training in the use of remote sensing for the agriculture sector in P...
Virtual training in the use of remote sensing for the agriculture sector in P...
 
Icrisat strategic plan 2021 2025
Icrisat strategic  plan 2021  2025Icrisat strategic  plan 2021  2025
Icrisat strategic plan 2021 2025
 
ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...
ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...
ICRISAT and HarvestPlus to collaborate on mainstreaming nutrition research an...
 

Recently uploaded

(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escorts
(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escorts(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escorts
(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escortsranjana rawat
 
Club of Rome: Eco-nomics for an Ecological Civilization
Club of Rome: Eco-nomics for an Ecological CivilizationClub of Rome: Eco-nomics for an Ecological Civilization
Club of Rome: Eco-nomics for an Ecological CivilizationEnergy for One World
 
Earth Day 2024 - AMC "COMMON GROUND'' movie night.
Earth Day 2024 - AMC "COMMON GROUND'' movie night.Earth Day 2024 - AMC "COMMON GROUND'' movie night.
Earth Day 2024 - AMC "COMMON GROUND'' movie night.Christina Parmionova
 
Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...
Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...
Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...narwatsonia7
 
VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...
VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...
VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...Suhani Kapoor
 
(多少钱)Dal毕业证国外本科学位证
(多少钱)Dal毕业证国外本科学位证(多少钱)Dal毕业证国外本科学位证
(多少钱)Dal毕业证国外本科学位证mbetknu
 
No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...
No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...
No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...narwatsonia7
 
history of 1935 philippine constitution.pptx
history of 1935 philippine constitution.pptxhistory of 1935 philippine constitution.pptx
history of 1935 philippine constitution.pptxhellokittymaearciaga
 
Powering Britain: Can we decarbonise electricity without disadvantaging poore...
Powering Britain: Can we decarbonise electricity without disadvantaging poore...Powering Britain: Can we decarbonise electricity without disadvantaging poore...
Powering Britain: Can we decarbonise electricity without disadvantaging poore...ResolutionFoundation
 
VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...
VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...
VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...Suhani Kapoor
 
2024: The FAR, Federal Acquisition Regulations - Part 28
2024: The FAR, Federal Acquisition Regulations - Part 282024: The FAR, Federal Acquisition Regulations - Part 28
2024: The FAR, Federal Acquisition Regulations - Part 28JSchaus & Associates
 
(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Service
(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Service(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Service
(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Serviceranjana rawat
 
##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas Whats Up Number
##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas  Whats Up Number##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas  Whats Up Number
##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas Whats Up NumberMs Riya
 
Jewish Efforts to Influence American Immigration Policy in the Years Before t...
Jewish Efforts to Influence American Immigration Policy in the Years Before t...Jewish Efforts to Influence American Immigration Policy in the Years Before t...
Jewish Efforts to Influence American Immigration Policy in the Years Before t...yalehistoricalreview
 
(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Service
(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Service(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Service
(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Serviceranjana rawat
 
Call Girl Benson Town - Phone No 7001305949 For Ultimate Sexual Urges
Call Girl Benson Town - Phone No 7001305949 For Ultimate Sexual UrgesCall Girl Benson Town - Phone No 7001305949 For Ultimate Sexual Urges
Call Girl Benson Town - Phone No 7001305949 For Ultimate Sexual Urgesnarwatsonia7
 
Call Girls Bangalore Saanvi 7001305949 Independent Escort Service Bangalore
Call Girls Bangalore Saanvi 7001305949 Independent Escort Service BangaloreCall Girls Bangalore Saanvi 7001305949 Independent Escort Service Bangalore
Call Girls Bangalore Saanvi 7001305949 Independent Escort Service Bangalorenarwatsonia7
 
Call Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls Service
Call Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls ServiceCall Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls Service
Call Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls Servicenarwatsonia7
 
Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...
Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...
Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...narwatsonia7
 

Recently uploaded (20)

(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escorts
(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escorts(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escorts
(NEHA) Bhosari Call Girls Just Call 7001035870 [ Cash on Delivery ] Pune Escorts
 
Club of Rome: Eco-nomics for an Ecological Civilization
Club of Rome: Eco-nomics for an Ecological CivilizationClub of Rome: Eco-nomics for an Ecological Civilization
Club of Rome: Eco-nomics for an Ecological Civilization
 
Earth Day 2024 - AMC "COMMON GROUND'' movie night.
Earth Day 2024 - AMC "COMMON GROUND'' movie night.Earth Day 2024 - AMC "COMMON GROUND'' movie night.
Earth Day 2024 - AMC "COMMON GROUND'' movie night.
 
Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...
Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...
Russian Call Girl Hebbagodi ! 7001305949 ₹2999 Only and Free Hotel Delivery 2...
 
VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...
VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...
VIP High Class Call Girls Amravati Anushka 8250192130 Independent Escort Serv...
 
(多少钱)Dal毕业证国外本科学位证
(多少钱)Dal毕业证国外本科学位证(多少钱)Dal毕业证国外本科学位证
(多少钱)Dal毕业证国外本科学位证
 
No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...
No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...
No.1 Call Girls in Basavanagudi ! 7001305949 ₹2999 Only and Free Hotel Delive...
 
Hot Sexy call girls in Palam Vihar🔝 9953056974 🔝 escort Service
Hot Sexy call girls in Palam Vihar🔝 9953056974 🔝 escort ServiceHot Sexy call girls in Palam Vihar🔝 9953056974 🔝 escort Service
Hot Sexy call girls in Palam Vihar🔝 9953056974 🔝 escort Service
 
history of 1935 philippine constitution.pptx
history of 1935 philippine constitution.pptxhistory of 1935 philippine constitution.pptx
history of 1935 philippine constitution.pptx
 
Powering Britain: Can we decarbonise electricity without disadvantaging poore...
Powering Britain: Can we decarbonise electricity without disadvantaging poore...Powering Britain: Can we decarbonise electricity without disadvantaging poore...
Powering Britain: Can we decarbonise electricity without disadvantaging poore...
 
VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...
VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...
VIP High Profile Call Girls Gorakhpur Aarushi 8250192130 Independent Escort S...
 
2024: The FAR, Federal Acquisition Regulations - Part 28
2024: The FAR, Federal Acquisition Regulations - Part 282024: The FAR, Federal Acquisition Regulations - Part 28
2024: The FAR, Federal Acquisition Regulations - Part 28
 
(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Service
(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Service(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Service
(ANIKA) Call Girls Wadki ( 7001035870 ) HI-Fi Pune Escorts Service
 
##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas Whats Up Number
##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas  Whats Up Number##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas  Whats Up Number
##9711199012 Call Girls Delhi Rs-5000 UpTo 10 K Hauz Khas Whats Up Number
 
Jewish Efforts to Influence American Immigration Policy in the Years Before t...
Jewish Efforts to Influence American Immigration Policy in the Years Before t...Jewish Efforts to Influence American Immigration Policy in the Years Before t...
Jewish Efforts to Influence American Immigration Policy in the Years Before t...
 
(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Service
(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Service(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Service
(PRIYA) Call Girls Rajgurunagar ( 7001035870 ) HI-Fi Pune Escorts Service
 
Call Girl Benson Town - Phone No 7001305949 For Ultimate Sexual Urges
Call Girl Benson Town - Phone No 7001305949 For Ultimate Sexual UrgesCall Girl Benson Town - Phone No 7001305949 For Ultimate Sexual Urges
Call Girl Benson Town - Phone No 7001305949 For Ultimate Sexual Urges
 
Call Girls Bangalore Saanvi 7001305949 Independent Escort Service Bangalore
Call Girls Bangalore Saanvi 7001305949 Independent Escort Service BangaloreCall Girls Bangalore Saanvi 7001305949 Independent Escort Service Bangalore
Call Girls Bangalore Saanvi 7001305949 Independent Escort Service Bangalore
 
Call Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls Service
Call Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls ServiceCall Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls Service
Call Girls Service AECS Layout Just Call 7001305949 Enjoy College Girls Service
 
Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...
Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...
Premium Call Girls Btm Layout - 7001305949 Escorts Service with Real Photos a...
 

Role of pearl millet Aquaporin genes in abiotic stress tolerance

  • 1. Feb 2017 Role of the pearl millet Aquaporin genes in abiotic stress tolerance Reddy PS*, Divya K, Sivasakthi K, Tharanya M, Lale A, Bhatnagar-Mathur P, Kholova J, Sharma KK, Vadez V *E-mail: p.sudhakarreddy@cgiar.org Introduction • Pearl millet (Pennisetum glaucum L.) is an important cereal crop of semi-arid tropics, which is grown across India and Sub-Saharan Africa. It is well adapted to grow in regions of very low rainfall and it can withstand long periods of drought. • Aquaporins are members of Major Intrinsic Proteins (MIP) family known to be present in the cell membranes and are involved in the conductance of water. • Aquaporin proteins are of special interest for water deficit adaptations as changes in AQPs have been linked to improved abiotic stress response. Objective Harnessing the role of Aquaporins in water conservation and abiotic stress tolerance improvement in Pearl Millet. Results 1. Seven PgAQP genes were cloned using homology based gene cloning approach and evolutionarily closer to maize than rice. 0 2 4 6 8 10 12 14 Leaf Root Leaf Root Leaf Root Leaf Root ICMR 1122 ICMR 1086 ICMR 1152 ICMR 1078 Relativeexpression Genotypes PIP1.1 PIP1.2 PIP2.1 PIP2.3 PIP2.6 TIP1.1 TIP2.2 Figure 2. Transpiration rate (Tr) response to increasing VPD in High Resolution Cross (HRC) genotypes. Figure 3. Relative expression of PgAQP genes under high VPD conditions using qPCR. 3. PgPIP2;6 transgenic tobacco plants were generated and functional characterization was done in homozygous T2 generation plants. LB 35s pro npt Poly A 35s pro PgPIP2;6 NosT RBa. pMDC100 comprises AQP cassette b. Steps involved in tobacco transformation c. PCR confirmation of putative transgenic tobacco plants Figure 4. Genetic transformation of tobacco with 35s-PgPIP2;6-NosT construct using the Leaf disc method. Conclusion PgPIP2;6 can be deployed to engineer stress tolerant transgenic crops for sustained growth and productivity under unfavorable conditions. Acknowledgements Science and Engineering Research Board (SERB), DST, Govt. of India for the research grant through Young Scientist Scheme SB/YS/LS-12/2013. This work has been undertaken as part of the CGIAR Research Program on Dryland Cereals. 2. Pearl millet genotypes showing contrasting transpiration response to high vapour pressure deficit (VPD) were identified. PgAQPs exhibited increased expression in VPD-insensitive genotypes under low and high VPD conditions. 4. PgPIP2;6 transgenic plants showed a better performance under drought stress and salinity compared to wild type plants. e. Transpiration reduction of heat stressed transgenic and wild type plants in the presence of aquaporin inhibitor AgCl2 . f. Relative water content measurement of drought stressed plants transgenic treated with aquaporin inhibitor AgCl2 . � � a. Visual difference in wild type and transgenic leaf discs after 7 days of 300 mM salt stress. b. Depicting leaf disc assay under salt stress. c. The relative total chlorophyll levels of salt stressed leaf discs from transgenic as well as wild type plants. d. Lipid peroxidation levels in salt stressed plants. Figure 1. Cloning and sequence analysis of pearl millet AQP genes. Cloning ARGAGGTSGAYG TCCSGAARGART Degenerate primers from related species Phylogenetic analysis Motif 1 Motif 2 Motif 3 PgPIP1;1 1 MEGKEEDVRLGANKYSERQPIGTAAQGGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMG--------VSKSNTKCATVGIQGIA 93 PgPIP1;2 1 MEGKEEDVRLGANKYSERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYISILTVMG--------VSKSQSKCATVGIQGIA 93 PgPIP2;1 1 MGKDDVIES-----------GAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPTASGADAACGGVGILGIA 89 PgPIP2;6 1 MGKEVDVSA-----------LEAGG---VRDYADPPPAPLVDIDELGKWSLYRAVIAEFVATMLFLYITVATVIGYKHQTDASASGPDAACGGVGILGIA 86 PgTIP1;1 1 MAAAGIRLCRSESIAVGSHQEVYHPGALKAAFAEFISTLIFVFAGQGSGMAFS------KLSPGG-SSPAGLISAA 69 PgTIP2;2 1 MSGNIAFGRFGDSFSAASLRAYVAEFISSLVFVFAGVGSAIAYR------KLSDGAPLDATGLVAVA 61 . .* ***... .*.. . . *. * Motif 4 Motif 5 PgPIP1;1 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGLYMGNGGGANTVASGYTKGSGLGAEIIGTFVLVYTV 194 PgPIP1;2 94 WSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQEGLYMGNGGGANMVASGYTKGDGLGAEIVGTFVLVYTV 194 PgPIP2;1 90 WAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTV 190 PgPIP2;6 87 WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYMAAQCLGAICGVALVKGFQSGFYARYGGGANEVSAGYSTGTGLAAEIVGTFVLVYTV 187 PgTIP1;1 70 IAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGNITLFRGILYWIAQLLGSTVACFLLRFSTGGLPTGTFG-----LTGISVWEALVLEIVMTFGLVYTV 165 PgTIP2;2 62 VCHGFALFVAVAIGANISGGHVNPAVTFGLVLGGQITMLTGLFYWIAQLVGAIVGAVLVQFSTG-VATPTHG-----LSGIGTLEGVVMEIIVTFGLVYIV 156 . .* * *.*****.******* . ... . * * .*. ... * .* . **. ** *** * H2 Motif 6 Motif 5 PgPIP1;1 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWSDHWIFWVGPFIGAALAAIYHQVIIRA------LPFKSRD 288 PgPIP1;2 195 FSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRSQAWDDHWIFWVGPFIGAALAAIYHQVIISA------IPFKSRS 288 PgPIP2;1 191 FSATDPKRNARDSHVPALAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA 290 PgPIP2;6 188 FSATDPKRNARDSHIPVLAPLPIGFAVFMVHLPTIPITGTGINPARSLGAAVVYNNSKAWSDQWIFWVGPFIGAAIAALYHQIVLRA-SARGYGSFRSNA 286 PgTIP1;1 166 YATAVD---PKKGSLGTIAPIAIGFIVGANILVGGAFDGASMNPAVSFGPALVS---WSWGYQWVYWVGPLIGGGLAGIIYEVLFIS---HTHEQLPSTDY 257 PgTIP2;2 157 YATAAD---PKKGSLGTIAPIAIGFIVGANILVAGPFSGGSMNPARSFGPAVAS---GDFTNIWIYWVGPLVGGGLAGIVYRYIYMC---GDHAPVASSEF 248 .... . . .**. *** * * * .*** * * *. *..**** .* .* . . * H5 LE1 LE2/P2 P3 P4P5 Sequence analysis for PgAQPs Figure 5. Functional characterization of PgPIP2;6 transgenic tobacco plants under salt, drought and heat stress treatments. a. pMDC100 comprises PgPIP2;6 cassette About ICRISAT: www.icrisat.org ICRISAT’s scientific information: http://EXPLOREit.icrisat.org