MODELACIÓN ESTRUCTURAL
DE ECORI POR HOMOLOGÍA
     DE SECUENCIA.

           Alumno: Eduardo A. Sagredo C.
               ...
ECORI
   Proteína caracterizada en Escherichia Coli.

   Mecanismo de eliminación DNA’s foráneos.

   Utilizada en Biol...
ECORI ESCHERICHIA COLI RESTRICTION ONE (FIRST)

    Cortan el ADN en
    puntos específicos
    Reconocen secuencias
   ...
ECORI




EcoRI, Horvath, M et Al
        1999.




                             EcoRI, PyMOL, Choi J.
                   ...
ECORI
 ID Pfam:
      Fam EcoRI PF02963
 ID InterPro:
      IPR004221
 PDB ID:
       1qri
 Identificada por :
       ...
ECORI
   Secuencia: (denominación 1qri)
SQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPD
   LGGTLFVSNSSIKPDGG...
PROTEÍNA A COMPARAR POR
  HOMOLOGÍA DE SECUENCIA << POR
          BLAST>>.

                        Secuencia a Utilizar “...
ESTRUCTURA 2D DE LA PROTEÍNA
COMPARADA POR HOMOLOGÍA CON
           1QRI.
   Existen Diferentes programas que realizan es...
ESTRUCTURA 2D DE LA PROTEÍNA
    COMPARADA POR HOMOLOGÍA CON
               1QRI (ECORI’’):
        UTILIZACIÓN DE PSIPRED...
RESULTADOS PSIPRED, 1 PAGINA.




      http://bioinf3.cs.ucl.ac.uk/psiout/405cd87ef31dfb15.psi.pdf
ESTRUCTURA 3D PROPUESTA POR
      HOMOLOGÍA : UTILIZACIÓN DE SWISS
                  MODEL.


   Para predecir la estruct...
ESTRUCTURA 3D PROPUESTA POR
        HOMOLOGÍA : UTILIZACIÓN DE SWISS
           MODEL, ALIGNEMENT MODE.

   Se introduce ...
ESTRUCTURA 3D PROPUESTA POR
HOMOLOGIA EN FORMATO PDB.
(VISUALIZADA EN PYMOL)
   Swiss Modeler entrega un PDB resultante e...
DIFERENCIAS ESTRUCTURALES
   ENTRE EL MODELO Y EL
       TEMPLADO.




Modelo Predictivo.   Modelo 1qri EcoRI.
DIFERENCIAS ESTRUCTURALES
   ENTRE EL MODELO Y EL
       TEMPLADO.




Modelo Predictivo.   Modelo 1qri EcoRI.
ALGUNOS APRONTES
                          CUATERNARIOS.
   EcoRI actúa en forma de Dímero.
   Actúa con sustrato de DNA...
¿SITIO ACTIVO? DOCKING
MELEGRO MOLECULAR VIEWER.
CONCLUSIONES.
 El análisis por homología resulta ser un primer
  apronte sobre la conformación espacial de una
  proteína...
BIBLIOGRAFÍA.
   Biología Molecular Del Gen. 3ra edición. Watson (1978).
   Biología Molecular Del Gen. 5ta edición. Bak...
VERIFICACIÓN DEL MODELO 3D.




             ProSA
                     Template 261 Aa.




                             ...
INTERPROSC
AN           ESTRUCTURAS PDB




CLUSTAL W2     FILOGRAMA
Upcoming SlideShare
Loading in …5
×

Eco R Ipptfinal

1,133 views

Published on

Modelacion por homologia EcoRI :) Biotecnologia Eduardo A. Sagredo Campos

0 Comments
0 Likes
Statistics
Notes
  • Be the first to comment

  • Be the first to like this

No Downloads
Views
Total views
1,133
On SlideShare
0
From Embeds
0
Number of Embeds
6
Actions
Shares
0
Downloads
0
Comments
0
Likes
0
Embeds 0
No embeds

No notes for slide

Eco R Ipptfinal

  1. 1. MODELACIÓN ESTRUCTURAL DE ECORI POR HOMOLOGÍA DE SECUENCIA. Alumno: Eduardo A. Sagredo C. Profesor: Andres I. Avila B. Clase: Bioinformática.
  2. 2. ECORI  Proteína caracterizada en Escherichia Coli.  Mecanismo de eliminación DNA’s foráneos.  Utilizada en Biología molecular, cliva en sitios específicos DNA de interés.  Primera “enzima de restricción” descrita en la bibliografía.
  3. 3. ECORI ESCHERICHIA COLI RESTRICTION ONE (FIRST)  Cortan el ADN en puntos específicos  Reconocen secuencias de entre 4 y 8 nucleótidos  Cortan en zonas circulares o de cadena. Nunca en las puntas  Secuencias de ADN que se cortan suelen ser “palindrómicas”
  4. 4. ECORI EcoRI, Horvath, M et Al 1999. EcoRI, PyMOL, Choi J. et Al (1999).
  5. 5. ECORI  ID Pfam: Fam EcoRI PF02963  ID InterPro: IPR004221  PDB ID: 1qri  Identificada por : Choi J. et Al. (Jun 99)  Expresada en E. Coli por contruccion sintetica  Metodologia utilizada : Dispersion de Rayos X
  6. 6. ECORI  Secuencia: (denominación 1qri) SQGVIGIFGDYAKAHDLAVGEVSKLVKKALSNEYPQLSFRYRDSIKKTEINEALKKIDPD LGGTLFVSNSSIKPDGGIVEVKDDYGEWRVVLVAEAKHQGKDIINIRNGLLVGKRGDQDL MAAGNAIDRSHKNISEIANFMLSESHFPYVLFLEGSNFLTENISITRPDGRVVNLEYNSG ILNRLDRLTAANYGMPINSNLCINKFVNHKDKSIMLQAASIYTQGDGREWDSKIMFEIMF DISTTSLRVLGRDLFEQLTSK • Blastp (default) • Matriz BLOSUM 62 • Gap valor 11 y extensión 1. • Largo de la secuencia: 884 Aa. • Largo comparado : 770 Aa.
  7. 7. PROTEÍNA A COMPARAR POR HOMOLOGÍA DE SECUENCIA << POR BLAST>>. Secuencia a Utilizar “ Enzima de Restricción Tipo II, EcoRI homologa expresada en Microcystis aeruginosa” >gi|166363607|ref|YP_001655880.1| type II restriction enzyme EcoRI homolog [Microcystis aeruginosa NIES-843] MTKKNQSKRLTNQHKESKGVVGIFGDEAKSHDITVGKISLFVIEQLEKEF PQLSFQYKTSIKKEEINEAL KKIDPELGQTLFVSNSSIIPDGGIIEVKDDNGNWRIVLVSEAKHQGKDIENI KAGKLVGAKNDQDLMAAG NAIERSHKNISEIANLMLSESHFPYVLFLEGSNFLTETISIKRPDGRVVTLE YNSGTLNRLDRLTSANYG Largo : 278 Aa MPINTNLCKNKFVKHKDKTIMLQATSIYTQGNGEKWDVKKMFDIMLEIS KTSLKVLGSEIFNQITKSK ID Acc: YP_001655880 Identidad 79% 86% de concordancias 0 gaps.
  8. 8. ESTRUCTURA 2D DE LA PROTEÍNA COMPARADA POR HOMOLOGÍA CON 1QRI.  Existen Diferentes programas que realizan estructuras de proteínas por homología, destacan:  AGADIR - An algorithm to predict the helical content of peptides  APSSP - Advanced Protein Secondary Structure Prediction Server  GOR - Garnier et al, 1996  HNN - Hierarchical Neural Network method (Guermeur, 1997)  HTMSRAP - Helical TransMembrane Segment Rotational Angle Prediction  Jpred - A consensus method for protein secondary structure prediction at University of Dundee  JUFO - Protein secondary structure prediction from sequence (neural network)  nnPredict - University of California at San Francisco (UCSF)  Porter - University College Dublin  PredictProtein - PHDsec, PHDacc, PHDhtm, PHDtopology, PHDthreader, MaxHom, EvalSec Utilizado from Columbia University  Prof - Cascaded Multiple Classifiers for Secondary Structure Prediction  PSA - BioMolecular Engineering Research Center (BMERC) / Boston  PSIpred - Various protein structure prediction methods at Brunel University Utilizado  SOPMA - Geourjon and Deléage, 1995  SSpro - Secondary structure prediction using bidirectional recurrent neural networks at University of California  DLP-SVM - Domain linker prediction using SVM at Tokyo University of Agriculture and Technology http://www.expasy.ch/tools/#secondary
  9. 9. ESTRUCTURA 2D DE LA PROTEÍNA COMPARADA POR HOMOLOGÍA CON 1QRI (ECORI’’): UTILIZACIÓN DE PSIPRED Se introduce el Query en En el mail se puede obtener en formato plano o FASTA. diferentes formato la conclusión que obtuvo PSIpred así como El Resultado es enviado por una web de compendio. mail. http://bioinf3.cs.ucl.ac.uk/cgi-bin/psipred/gra/nph-view2.cgi?id=405cd87ef31dfb15.psi
  10. 10. RESULTADOS PSIPRED, 1 PAGINA. http://bioinf3.cs.ucl.ac.uk/psiout/405cd87ef31dfb15.psi.pdf
  11. 11. ESTRUCTURA 3D PROPUESTA POR HOMOLOGÍA : UTILIZACIÓN DE SWISS MODEL.  Para predecir la estructura terciaria de la proteína Query (EcoRI Homologa) se utilizo el software “Swiss Model” en “Alignment Mode” y “Automated Mode” Compara el Query con DB. Compara el Query con Templado a elección.
  12. 12. ESTRUCTURA 3D PROPUESTA POR HOMOLOGÍA : UTILIZACIÓN DE SWISS MODEL, ALIGNEMENT MODE.  Se introduce el query y templado en formato FASTA, la web vuelve a preguntar cual es el templado, su ID PDB y la cadena a comparar. Resultado en Web del análisis. http://swissmodel.expasy.org/workspace/index.php?userid=sagredo1989@gmail.com&token=0019fbd2bfdd70cfbe0a0f59d4386036&prjid=P000009&func=workspac
  13. 13. ESTRUCTURA 3D PROPUESTA POR HOMOLOGIA EN FORMATO PDB. (VISUALIZADA EN PYMOL)  Swiss Modeler entrega un PDB resultante el cual puede ser observado por visualizadores de moléculas (VMD,PyMOL,etc).
  14. 14. DIFERENCIAS ESTRUCTURALES ENTRE EL MODELO Y EL TEMPLADO. Modelo Predictivo. Modelo 1qri EcoRI.
  15. 15. DIFERENCIAS ESTRUCTURALES ENTRE EL MODELO Y EL TEMPLADO. Modelo Predictivo. Modelo 1qri EcoRI.
  16. 16. ALGUNOS APRONTES CUATERNARIOS.  EcoRI actúa en forma de Dímero.  Actúa con sustrato de DNA de doble hebra.  <<en este caso no requiere de cofactor de Mg+2>>
  17. 17. ¿SITIO ACTIVO? DOCKING MELEGRO MOLECULAR VIEWER.
  18. 18. CONCLUSIONES.  El análisis por homología resulta ser un primer apronte sobre la conformación espacial de una proteína no caracterizada.  Este tipo de análisis en algunas proteínas puede ser bastante eficaz, tanto en otras muy dispar puesto que se basa en homologías cercanas o bajo el 50%.  El análisis de estructuras secundarias y terciarias resulta muy llevadero en comparación a la estructura cuaternaria.  Resultaría interesante ahondar en la preferencia de los Aa`s hacia ciertas estructuras.
  19. 19. BIBLIOGRAFÍA.  Biología Molecular Del Gen. 3ra edición. Watson (1978).  Biología Molecular Del Gen. 5ta edición. Baker et al (2005).  Bioquimica De Matthews Van Holde Matthews,Van Holde (1998).  Principios De Bioquímica De Lehninger. Cox et al (2006)(4ta edición Ingles).  Fundamentos y casos exitosos de la biotecnología moderna. F. Bolivar et al (2004).  Molecular Biology Problem Solver: A Laboratory Guide. Edited by Alan S. Gerstein Derek Robinson, Paul R.Walsh, and Joseph A. Bonventre Capitulo 9 (2006)  Solution Conformation of EcoRI Restriction Endonuclease Changes upon Binding of Cognate DNA and Mg2+ Cofactor ;Heather ,W. et al, (Nov 2000) Abstract.  The evolution of molecular markers — just a matter of fashion? C. Schlötterer. Nature Reviews Genetics 5, 63-69 (January 2004)
  20. 20. VERIFICACIÓN DEL MODELO 3D. ProSA Template 261 Aa. Modelo 261 Aa
  21. 21. INTERPROSC AN ESTRUCTURAS PDB CLUSTAL W2 FILOGRAMA

×