Glikolisis

7,517 views

Published on

Proses pemecahan glukosa menjadi asam piruvat

Published in: Education
0 Comments
19 Likes
Statistics
Notes
  • Be the first to comment

No Downloads
Views
Total views
7,517
On SlideShare
0
From Embeds
0
Number of Embeds
5
Actions
Shares
0
Downloads
0
Comments
0
Likes
19
Embeds 0
No embeds

No notes for slide
  • Berlangsng di sitoplasmaAdalahperubahanglukosamenjadiasampiruvat, melewati ~10 reaksiMembutuhkanglukosa, 2 ATP dan NAD+ATP berasaldarienzymtanpamelibatkanmembranseldangradien protonMenghasilkan 4 ATP (2 ATP netto), dan NADHBisaberlangsungsecaraanaerobik
  • Glikolisisberasaldari kata glukosadanlisis (pemecahan), adalahserangkaianreaksibiokimia di managlukosadioksidasimenjadimolekulasampiruvat. Glikolisisadalahsalahsatu proses metabolisme yang paling universal yang kitakenal, danterjadi (denganberbagaivariasi) di banyakjenisseldalamhampirseluruhbentukorganisme. Proses glikolisissendirimenghasilkanlebihsedikitenergi per molekulglukosadibandingkandenganoksidasiaerobik yang sempurna. Energi yang dihasilkandisimpandalamsenyawaorganikberupa adenosine triphosphate atau yang lebihumumdikenaldenganistilah ATP dan NADH.
  • Ringkasanreaksiglikolisispadalintasan EMP adalahsebagaiberikut:C6H12O6 + 2 ATP + 2 NAD+ 2Piruvat + 4 ATP + 2NADHSedangkanringkasanreaksidariglikolisis, siklusasamsitratdanfosforilasioksidatifadalah:C6H12O6 + 6 O2 6CO2 + 6H2O + Energi
  • Glyceraldehid 3 phosphat
  • PEP = phosphoenolpiruvate
  • Asampiruvat yang terbentukpadaglikolisistidakmemasukidaur Krebs danrantaitransporelektronkarenatakadaoksigensebagaipenerima H yang terakhir. Akibatnyaasampiruvatdireduksikarenamenerima H dari NADH yang terbentuksaatglikolisis, danterbentuklahasamlaktat yang menyebabkan rasa lelahpadaotot. Peristiwainihanyamenghasilkan 2 ATP untuksetiapmolglukosa yang direspirasi.
  • Glikolisis

    1. 1. GLIKOLISISKELOMPOK 1
    2. 2. ANGGOTA• Fardiana Muchita 201110410311205• M. Rizki Pratama 201110410311206• Alif Mukhlis Z. 201110410311211• Erry Probo S. 201110410311216• Dilla Novita 201110410311220• Rini Rakhmawati 201110410311221• Richa Elfira 201110410311223• Rahil Bunga Adinda 201110410311224
    3. 3. Pengertian Glikolisis• Glikolisis adalah reaksi pelepasan energi yangmemecah 1 molekul glukosa (terdiri dari 6atom karbon) atau monosakarida yang lainmenjadi 2 molekul asam piruvat (terdiri dari 3atom karbon, 2 NADH (Nicotinamide AdenineDinucleotide H), dan 2 ATP.• Glikolisis terjadi di dalam sitosol di dalam sel.
    4. 4. Glukosa + ATP glukosa-6 fosfat + ADPGlikolisis di awali dengan reaksi pembentukan glukosa-6 fosfatdari glukosa. Reaksi tersebut merupakan reaksi yangmembutuhkan energi yang di ambil dari pemutusan ikatan fosfatdari ATP. Reaksi ini di katalisis oleh enzim heksokinase atauglukokinase
    5. 5. glukosa-6 fosfat fruktosa-6 fosfatIsomerasi glukosa-6 fosfat.Reaksi kedua ini adalah pembentukan isomer fruktosa-6 fosfat dariglukosa-6 fosfat. Reaksi ini di katalis oleh fosfoglukoisomerase.
    6. 6. fruktosa-6 fosfat + ATP fruktosa-1,6 difosfat +ADPFosforilasi kedua.Reaksi fosforilasi fruktosa-6 fosfat menjadi fruktosa-1,6 difosfat olehenzim fosfofruktokinase. Reaksi ini berjalan spontan dan merupakanrate limiting step pada proses glikolisis. Pada reaksi ini dibutuhkan 1mol ATP dan diregulasi secara ketat. Fosfofruktokinase dapatdihambat oleh ATP.
    7. 7. fruktosa-1,6 difosfat 2 PGAL(fosfogliseraldehid)Reaksi ini adalah pemutusan fruktosa-1,6 dofosfat menjadi 2 PGAL.Reaksi ini di katalis oleh enzim aldolase, yang selanjutnyamengalami Isomerasi membentuk dihidroksiasetonfosfat.
    8. 8. PGAL + NAD+ + pi 1,3-difosfogliserat +NADHReaksi ini di katalisis oleh enzim gliseraldehid-3-fosfatdehidrogenase dengan NAD+ sebagai koenzimnya. Reaksi oksidasiini terjadi addisi gugus fosfat dan menghasilkan NADH. Pada tahapini terbentuk pertama kali senyawa yang mengandung energitinggi.
    9. 9. 1,3- difosfogliserat + ADP 3-fosfogliserat+ ATPSenyawa 1,3-difosfogliserat merupakan senyawa berenergi tinggiyang selanjutnya gugus fosfat tersebut ditransfer untuk membentukATP yang dikatalis oleh enzim fosfogliserat kinase dengan ko faktorMg+.
    10. 10. 3-fosfogliserat 2-fosfogliseratPada tahap ini terjadi reaksi perpindahan gugus fosfat pada 3-fosfogliserat yang berada pada posisi C-3 berpindah ke OH posisiC-2 yang di katalis oleh enzim fosfogliserat mutase. Pada katalisisini residu histidin berperan penting pada transfer fosfat iondengan memberikan dan menerima gugus fosfat.
    11. 11. 2-fosfogliserat PEP (3-fosfoenol piruvat)+ H2OPembentukan senyawa ini dilakukan dengan dehidrasi yangdikatalis oleh enzim enolase yang memiliki ko faktor Mg2+.
    12. 12. PEP + ADP Asam piruvat + ATPReaksi ini berjalan spontan dan terjadi transfer darifosfoenolpiruvat ke ADP membentuk ATP. Pelepasan fosfat ionmenyebabkan terjadinya ikatan enol yang tidak stabil sehinggaakan terkonveksi ke bentuk keto dan menjadi asam piruvat.Reaksi ini di katalisis oleh enzim piruvat kinase. Ensim inimemerlukan Mg+ sebagai ko-faktor. Asam piruvat sebagai hasilakhir glikolisis.
    13. 13. Reaksi Anaerob• Respirasi anaerob merupakan respirasi yangtidak menggunakan oksigen sebagai penerimaelektron akhir pada saat pembentukan ATP.Respirasi anaerob merupakan prosesfermentasi.
    14. 14. • Seperti pada respirasi aerob, glukosamerupakan substrat pada tahap awalfermentasi. Glukosa di pecah menjadi 2molekul asam piruvat, 2 NADH dan terbentuk2 ATP. Akan tetapi, reaksi fermentasi tidaksempurna memecah glukosa menjadi karbondioksida dan air, sehingga ATP yang di hasilkanlebih sedikit dari jumlah ATP yang di hasilkanoleh glikolisis.
    15. 15. Tahapan fermentasialkoholGlukosa 2 Asam piruvat 2asetaldehid2 etanolAsam piruvat yang di hasilkan dari proses glikolisis dari glukosa difermentasikan menjadi asetaldehid dengan membutuhkan 2 H2Odan menghasilkan 2 CO2 .NADH yang di hasilkan dari proses glikolisismemberikan elektronnya dan hidrogennya kepada asetaldehid,sehingga terbentuk produk akhir alkohol.
    16. 16. Tahapan fermentasi LaktatGlukosa 2 Asam piruvat 2asetaldehid2 laktatPada fermentasi asam laktat ini, molekul asam piruvat hasil glikolisismenerima elektron dan hidrogen dari NADH. Transfer elektron danhidrogen ini menghasilkan NAD+ kembali. Pada saat yang sama, asampiruvat diubah menjadi asam laktat dan menghasilkan 2 ATP.

    ×